BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039E12

Length=683
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789305.1|  PREDICTED: serine carboxypeptidase II-2            317   2e-102   Nicotiana sylvestris
ref|XP_009630744.1|  PREDICTED: serine carboxypeptidase II-2            313   5e-101   Nicotiana tomentosiformis
ref|XP_004242620.1|  PREDICTED: serine carboxypeptidase II-2            310   4e-100   Solanum lycopersicum
ref|XP_006343604.1|  PREDICTED: serine carboxypeptidase II-2-like       310   5e-100   Solanum tuberosum [potatoes]
gb|EYU34325.1|  hypothetical protein MIMGU_mgv1a005646mg                300   8e-96    Erythranthe guttata [common monkey flower]
emb|CDP02851.1|  unnamed protein product                                299   2e-95    Coffea canephora [robusta coffee]
ref|XP_011079368.1|  PREDICTED: serine carboxypeptidase II-2            292   8e-93    Sesamum indicum [beniseed]
ref|XP_002275081.1|  PREDICTED: serine carboxypeptidase II-2            278   1e-87    Vitis vinifera
emb|CAN75200.1|  hypothetical protein VITISV_014887                     279   4e-87    Vitis vinifera
ref|XP_007013884.1|  Serine carboxypeptidase-like 29                    276   1e-86    Theobroma cacao [chocolate]
ref|XP_010273729.1|  PREDICTED: serine carboxypeptidase II-2            276   2e-86    Nelumbo nucifera [Indian lotus]
ref|XP_007202013.1|  hypothetical protein PRUPE_ppa005192mg             275   3e-86    Prunus persica
ref|XP_004287151.1|  PREDICTED: serine carboxypeptidase II-2            275   4e-86    Fragaria vesca subsp. vesca
ref|XP_008243035.1|  PREDICTED: serine carboxypeptidase II-2            275   5e-86    Prunus mume [ume]
ref|XP_011018073.1|  PREDICTED: serine carboxypeptidase II-2-like       268   7e-85    Populus euphratica
ref|XP_010111113.1|  Serine carboxypeptidase-like 29                    270   3e-84    
ref|XP_011018071.1|  PREDICTED: serine carboxypeptidase II-2-like...    268   2e-83    Populus euphratica
emb|CBI36578.3|  unnamed protein product                                266   7e-83    Vitis vinifera
ref|XP_002273324.2|  PREDICTED: serine carboxypeptidase II-2            266   1e-82    Vitis vinifera
ref|XP_009358402.1|  PREDICTED: serine carboxypeptidase II-2            266   2e-82    Pyrus x bretschneideri [bai li]
ref|XP_006453577.1|  hypothetical protein CICLE_v10008112mg             265   2e-82    Citrus clementina [clementine]
gb|EPS71160.1|  hypothetical protein M569_03591                         264   2e-82    Genlisea aurea
gb|KDP38717.1|  hypothetical protein JCGZ_04070                         265   2e-82    Jatropha curcas
gb|AFK34001.1|  unknown                                                 256   5e-82    Medicago truncatula
ref|XP_006474032.1|  PREDICTED: serine carboxypeptidase-like 29-like    264   6e-82    Citrus sinensis [apfelsine]
ref|XP_008394291.1|  PREDICTED: serine carboxypeptidase II-2            263   1e-81    
ref|XP_007138291.1|  hypothetical protein PHAVU_009G196000g             263   1e-81    Phaseolus vulgaris [French bean]
ref|XP_002528403.1|  serine carboxypeptidase, putative                  262   3e-81    Ricinus communis
ref|XP_010687643.1|  PREDICTED: serine carboxypeptidase II-2            262   4e-81    Beta vulgaris subsp. vulgaris [field beet]
gb|KEH38195.1|  serine carboxypeptidase-like protein                    258   5e-80    Medicago truncatula
ref|XP_003595890.1|  Serine carboxypeptidase II-2                       258   7e-80    Medicago truncatula
ref|XP_009410194.1|  PREDICTED: serine carboxypeptidase II-2-like       258   8e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003595892.1|  Serine carboxypeptidase II-2                       258   1e-79    Medicago truncatula
ref|XP_008790132.1|  PREDICTED: serine carboxypeptidase II-2 isof...    258   1e-79    Phoenix dactylifera
gb|KHG11306.1|  Serine carboxypeptidase-like 29                         258   2e-79    Gossypium arboreum [tree cotton]
ref|XP_003595891.1|  Serine carboxypeptidase-like protein               258   2e-79    Medicago truncatula
ref|XP_004964646.1|  PREDICTED: serine carboxypeptidase II-2-like       256   6e-79    Setaria italica
ref|XP_010040844.1|  PREDICTED: serine carboxypeptidase II-2-like       256   7e-79    Eucalyptus grandis [rose gum]
ref|XP_010048771.1|  PREDICTED: serine carboxypeptidase II-2            256   8e-79    Eucalyptus grandis [rose gum]
gb|KHN02055.1|  Serine carboxypeptidase II-2                            256   8e-79    Glycine soja [wild soybean]
gb|ACF84647.1|  unknown                                                 249   9e-79    Zea mays [maize]
ref|XP_002324616.2|  hypothetical protein POPTR_0018s11210g             255   2e-78    
ref|XP_003522937.2|  PREDICTED: serine carboxypeptidase II-2-like       255   2e-78    Glycine max [soybeans]
ref|XP_006453578.1|  hypothetical protein CICLE_v10008112mg             254   5e-78    Citrus clementina [clementine]
ref|XP_010905043.1|  PREDICTED: serine carboxypeptidase II-2            253   8e-78    Elaeis guineensis
gb|EMT26558.1|  putative Serine carboxypeptidase II-2                   248   1e-76    
ref|NP_001057009.1|  Os06g0186400                                       250   2e-76    
ref|XP_004144720.1|  PREDICTED: serine carboxypeptidase-like 29-like    249   3e-76    Cucumis sativus [cucumbers]
sp|P55748.1|CBP22_HORVU  RecName: Full=Serine carboxypeptidase II...    248   3e-76    Hordeum vulgare [barley]
dbj|BAJ99024.1|  predicted protein                                      249   3e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146398.1|  Serine carboxypeptidase K10B2.2 precursor          249   5e-76    Zea mays [maize]
ref|XP_008452541.1|  PREDICTED: serine carboxypeptidase II-2            248   6e-76    Cucumis melo [Oriental melon]
gb|KGN61064.1|  hypothetical protein Csa_2G036620                       250   8e-76    Cucumis sativus [cucumbers]
gb|ABK24285.1|  unknown                                                 247   1e-75    Picea sitchensis
ref|XP_009395827.1|  PREDICTED: serine carboxypeptidase II-2-like       247   2e-75    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK02147.1|  predicted protein                                      247   3e-75    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003596536.1|  Serine carboxypeptidase                            249   3e-75    
gb|KJB76659.1|  hypothetical protein B456_012G098600                    247   4e-75    Gossypium raimondii
ref|XP_003564183.1|  PREDICTED: serine carboxypeptidase II-2            246   6e-75    Brachypodium distachyon [annual false brome]
ref|XP_004162685.1|  PREDICTED: serine carboxypeptidase-like 29-like    246   7e-75    
ref|XP_004488608.1|  PREDICTED: serine carboxypeptidase II-2-like       246   7e-75    Cicer arietinum [garbanzo]
gb|AES66787.2|  serine carboxypeptidase-like protein                    245   1e-74    Medicago truncatula
ref|XP_006655861.1|  PREDICTED: serine carboxypeptidase II-2-like       245   2e-74    Oryza brachyantha
gb|AIN39846.1|  hypothetical protein                                    233   1e-73    Zoysia matrella [Japanese carpet grass]
ref|XP_006845388.1|  hypothetical protein AMTR_s00019p00053910          242   2e-73    Amborella trichopoda
ref|XP_002324520.1|  serine carboxypeptidase S10 family protein         239   2e-72    
ref|XP_009137969.1|  PREDICTED: serine carboxypeptidase-like 29         239   3e-72    Brassica rapa
emb|CDY13387.1|  BnaA03g51050D                                          238   5e-72    Brassica napus [oilseed rape]
ref|XP_009127491.1|  PREDICTED: serine carboxypeptidase-like 29         238   6e-72    Brassica rapa
emb|CDX68696.1|  BnaC01g07570D                                          238   1e-71    
emb|CDX72270.1|  BnaC07g42920D                                          241   2e-71    
ref|XP_010526302.1|  PREDICTED: serine carboxypeptidase-like 29         236   3e-71    Tarenaya hassleriana [spider flower]
emb|CDY28217.1|  BnaA01g06320D                                          235   9e-71    Brassica napus [oilseed rape]
ref|XP_006470942.1|  PREDICTED: serine carboxypeptidase II-2-like       229   2e-70    
emb|CDY55623.1|  BnaC03g77560D                                          234   2e-70    Brassica napus [oilseed rape]
gb|ACG38162.1|  serine carboxypeptidase K10B2.2 precursor               233   4e-70    Zea mays [maize]
ref|XP_008654560.1|  PREDICTED: uncharacterized protein LOC100273...    233   4e-70    
gb|ACF79757.1|  unknown                                                 233   5e-70    Zea mays [maize]
dbj|BAH20278.1|  AT4G30810                                              229   9e-70    Arabidopsis thaliana [mouse-ear cress]
emb|CDY23258.1|  BnaA08g12880D                                          232   2e-69    Brassica napus [oilseed rape]
emb|CDY28216.1|  BnaA01g06330D                                          232   2e-69    Brassica napus [oilseed rape]
ref|XP_010525795.1|  PREDICTED: serine carboxypeptidase-like 29         226   2e-69    Tarenaya hassleriana [spider flower]
ref|XP_002457307.1|  hypothetical protein SORBIDRAFT_03g005360          231   3e-69    Sorghum bicolor [broomcorn]
gb|KFK29659.1|  hypothetical protein AALP_AA7G162000                    231   3e-69    Arabis alpina [alpine rockcress]
ref|XP_010253608.1|  PREDICTED: serine carboxypeptidase-like 27         230   3e-69    Nelumbo nucifera [Indian lotus]
ref|XP_009127511.1|  PREDICTED: serine carboxypeptidase-like 29         231   3e-69    Brassica rapa
emb|CDX68695.1|  BnaC01g07580D                                          230   8e-69    
ref|XP_010669644.1|  PREDICTED: serine carboxypeptidase-like 27         229   9e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|NP_567854.1|  serine carboxypeptidase-like 29                       230   9e-69    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004968265.1|  PREDICTED: serine carboxypeptidase 2-like          231   1e-68    Setaria italica
ref|XP_010527107.1|  PREDICTED: serine carboxypeptidase-like 29         221   1e-68    Tarenaya hassleriana [spider flower]
emb|CDO99730.1|  unnamed protein product                                229   1e-68    Coffea canephora [robusta coffee]
ref|XP_009108967.1|  PREDICTED: serine carboxypeptidase-like 29         229   2e-68    
ref|XP_003556225.1|  PREDICTED: serine carboxypeptidase-like 27-l...    228   2e-68    Glycine max [soybeans]
ref|XP_002312024.1|  serine carboxypeptidase S10 family protein         228   4e-68    Populus trichocarpa [western balsam poplar]
ref|XP_010264739.1|  PREDICTED: serine carboxypeptidase-like 27         228   4e-68    Nelumbo nucifera [Indian lotus]
ref|XP_002869361.1|  hypothetical protein ARALYDRAFT_491673             228   5e-68    
ref|XP_011076996.1|  PREDICTED: serine carboxypeptidase-like 27         228   5e-68    Sesamum indicum [beniseed]
dbj|BAO04184.1|  hypothetical protein                                   227   5e-68    Delphinium grandiflorum
gb|KDP25725.1|  hypothetical protein JCGZ_23946                         227   7e-68    Jatropha curcas
ref|XP_006850617.1|  hypothetical protein AMTR_s00034p00161680          227   8e-68    Amborella trichopoda
ref|XP_006412667.1|  hypothetical protein EUTSA_v10025076mg             227   1e-67    Eutrema salsugineum [saltwater cress]
ref|XP_009378094.1|  PREDICTED: serine carboxypeptidase-like 27         226   1e-67    Pyrus x bretschneideri [bai li]
ref|XP_011031767.1|  PREDICTED: serine carboxypeptidase-like 27         226   1e-67    Populus euphratica
ref|XP_006645520.1|  PREDICTED: serine carboxypeptidase II-1-like       225   1e-67    Oryza brachyantha
ref|XP_008368824.1|  PREDICTED: serine carboxypeptidase-like 27         226   2e-67    Malus domestica [apple tree]
gb|KJB78938.1|  hypothetical protein B456_013G026200                    226   2e-67    Gossypium raimondii
gb|AFK43035.1|  unknown                                                 226   2e-67    Medicago truncatula
ref|XP_003591950.1|  Serine carboxypeptidase-like protein               226   2e-67    Medicago truncatula
ref|XP_010447670.1|  PREDICTED: serine carboxypeptidase-like 29         226   3e-67    Camelina sativa [gold-of-pleasure]
ref|XP_006286217.1|  hypothetical protein CARUB_v10007783mg             226   3e-67    Capsella rubella
dbj|BAK06862.1|  predicted protein                                      218   3e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003560871.1|  PREDICTED: serine carboxypeptidase 2-like          226   4e-67    Brachypodium distachyon [annual false brome]
ref|XP_010438130.1|  PREDICTED: serine carboxypeptidase-like 29         225   7e-67    Camelina sativa [gold-of-pleasure]
ref|XP_009592854.1|  PREDICTED: serine carboxypeptidase-like 27         224   9e-67    Nicotiana tomentosiformis
gb|KHG25905.1|  Serine carboxypeptidase-like 27                         224   1e-66    Gossypium arboreum [tree cotton]
ref|XP_009802382.1|  PREDICTED: serine carboxypeptidase-like 27         224   1e-66    Nicotiana sylvestris
ref|XP_011040963.1|  PREDICTED: serine carboxypeptidase-like 27         224   1e-66    Populus euphratica
ref|NP_001042076.1|  Os01g0158200                                       224   2e-66    
gb|KHN17121.1|  Serine carboxypeptidase-like 27                         223   2e-66    Glycine soja [wild soybean]
ref|XP_006589433.1|  PREDICTED: serine carboxypeptidase-like 27-like    223   2e-66    Glycine max [soybeans]
ref|XP_004496292.1|  PREDICTED: serine carboxypeptidase-like 27-l...    223   2e-66    Cicer arietinum [garbanzo]
ref|XP_010541227.1|  PREDICTED: serine carboxypeptidase-like 29         220   2e-66    
gb|KJB76568.1|  hypothetical protein B456_012G094900                    218   3e-66    Gossypium raimondii
dbj|BAB08188.1|  unnamed protein product                                224   3e-66    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007219592.1|  hypothetical protein PRUPE_ppa023509mg             221   3e-66    
ref|XP_002457308.1|  hypothetical protein SORBIDRAFT_03g005370          223   3e-66    Sorghum bicolor [broomcorn]
tpg|DAA53383.1|  TPA: hypothetical protein ZEAMMB73_784297              219   3e-66    
ref|XP_006410747.1|  hypothetical protein EUTSA_v10016650mg             222   4e-66    Eutrema salsugineum [saltwater cress]
ref|XP_007143689.1|  hypothetical protein PHAVU_007G093300g             222   5e-66    Phaseolus vulgaris [French bean]
gb|EEC69980.1|  hypothetical protein OsI_00486                          222   8e-66    Oryza sativa Indica Group [Indian rice]
emb|CAN74854.1|  hypothetical protein VITISV_028701                     221   8e-66    Vitis vinifera
ref|XP_006350225.1|  PREDICTED: serine carboxypeptidase-like 27-like    221   8e-66    Solanum tuberosum [potatoes]
ref|XP_004968264.1|  PREDICTED: serine carboxypeptidase-like 27-like    221   1e-65    Setaria italica
ref|XP_003564543.1|  PREDICTED: serine carboxypeptidase-like 27         221   1e-65    Brachypodium distachyon [annual false brome]
gb|AAV43957.1|  putative serine carboxypeptidase II                     221   2e-65    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002274723.1|  PREDICTED: serine carboxypeptidase-like 27         221   2e-65    Vitis vinifera
gb|EAY76388.1|  hypothetical protein OsI_04319                          221   2e-65    Oryza sativa Indica Group [Indian rice]
ref|XP_008805039.1|  PREDICTED: serine carboxypeptidase-like 27         221   2e-65    Phoenix dactylifera
ref|NP_001044713.1|  Os01g0833500                                       221   2e-65    
ref|XP_003591949.1|  Serine carboxypeptidase-like protein               221   2e-65    
ref|XP_002315292.2|  serine carboxypeptidase S10 family protein         221   2e-65    Populus trichocarpa [western balsam poplar]
ref|XP_008233341.1|  PREDICTED: serine carboxypeptidase-like 27         221   2e-65    Prunus mume [ume]
ref|XP_003591947.1|  Serine carboxypeptidase-like protein               221   2e-65    Medicago truncatula
gb|ABK21145.1|  unknown                                                 217   2e-65    Picea sitchensis
ref|XP_006655142.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    221   3e-65    
ref|XP_010908844.1|  PREDICTED: serine carboxypeptidase-like 27         220   3e-65    Elaeis guineensis
dbj|BAJ99174.1|  predicted protein                                      219   4e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDO48447.1|  hypothetical protein CISIN_1g012819mg                   220   4e-65    Citrus sinensis [apfelsine]
ref|XP_010432944.1|  PREDICTED: serine carboxypeptidase-like 29         220   6e-65    Camelina sativa [gold-of-pleasure]
ref|XP_008381976.1|  PREDICTED: serine carboxypeptidase-like 27         219   7e-65    
ref|XP_004236634.1|  PREDICTED: serine carboxypeptidase-like 27         219   8e-65    Solanum lycopersicum
ref|XP_004307401.1|  PREDICTED: serine carboxypeptidase-like 27         219   8e-65    Fragaria vesca subsp. vesca
tpg|DAA53384.1|  TPA: serine carboxypeptidase K10B2.2                   219   8e-65    
gb|KJB76569.1|  hypothetical protein B456_012G094900                    219   9e-65    Gossypium raimondii
gb|KJB76563.1|  hypothetical protein B456_012G094900                    219   9e-65    Gossypium raimondii
ref|NP_001150676.1|  serine carboxypeptidase K10B2.2 precursor          219   1e-64    Zea mays [maize]
gb|EMS47606.1|  Serine carboxypeptidase-like 27                         219   1e-64    Triticum urartu
gb|KHG08205.1|  Serine carboxypeptidase-like 27                         218   1e-64    Gossypium arboreum [tree cotton]
ref|XP_006644961.1|  PREDICTED: serine carboxypeptidase-like 27-like    218   2e-64    Oryza brachyantha
ref|XP_006436271.1|  hypothetical protein CICLE_v10031497mg             218   2e-64    Citrus clementina [clementine]
sp|P55747.1|CBP21_HORVU  RecName: Full=Serine carboxypeptidase II...    214   2e-64    Hordeum vulgare [barley]
ref|XP_004962519.1|  PREDICTED: serine carboxypeptidase 2-like          218   3e-64    Setaria italica
ref|XP_008649461.1|  PREDICTED: serine carboxypeptidase 2-like is...    218   3e-64    Zea mays [maize]
ref|XP_009333715.1|  PREDICTED: serine carboxypeptidase-like 27         217   4e-64    Pyrus x bretschneideri [bai li]
gb|KFK38250.1|  hypothetical protein AALP_AA3G088900                    217   5e-64    Arabis alpina [alpine rockcress]
ref|XP_003566409.1|  PREDICTED: serine carboxypeptidase II-1            217   5e-64    
gb|ACU19747.1|  unknown                                                 212   6e-64    Glycine max [soybeans]
ref|XP_002459313.1|  hypothetical protein SORBIDRAFT_02g002260          217   6e-64    Sorghum bicolor [broomcorn]
ref|XP_009141519.1|  PREDICTED: serine carboxypeptidase-like 26         216   6e-64    Brassica rapa
ref|XP_006407773.1|  hypothetical protein EUTSA_v10020705mg             217   6e-64    Eutrema salsugineum [saltwater cress]
emb|CDY35977.1|  BnaA05g29730D                                          217   7e-64    Brassica napus [oilseed rape]
ref|XP_008446902.1|  PREDICTED: serine carboxypeptidase-like 27         216   7e-64    Cucumis melo [Oriental melon]
emb|CDY32091.1|  BnaC04g44750D                                          216   8e-64    Brassica napus [oilseed rape]
ref|XP_010547376.1|  PREDICTED: serine carboxypeptidase-like 27         216   8e-64    Tarenaya hassleriana [spider flower]
emb|CDY40438.1|  BnaA04g20790D                                          216   9e-64    Brassica napus [oilseed rape]
gb|EMS66624.1|  Serine carboxypeptidase II-1                            213   9e-64    Triticum urartu
ref|XP_010486379.1|  PREDICTED: serine carboxypeptidase-like 27         216   1e-63    Camelina sativa [gold-of-pleasure]
ref|NP_187456.1|  serine carboxypeptidase-like 27                       216   1e-63    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147009.1|  PREDICTED: serine carboxypeptidase-like 27 i...    216   1e-63    Brassica rapa
ref|XP_009147010.1|  PREDICTED: serine carboxypeptidase-like 27 i...    216   1e-63    
emb|CDY28004.1|  BnaC05g44060D                                          216   1e-63    Brassica napus [oilseed rape]
gb|EMT21139.1|  putative Serine carboxypeptidase II-1                   215   1e-63    
ref|XP_008649460.1|  PREDICTED: serine carboxypeptidase 2-like is...    216   2e-63    Zea mays [maize]
ref|XP_002458719.1|  hypothetical protein SORBIDRAFT_03g038940          215   3e-63    Sorghum bicolor [broomcorn]
ref|XP_010464446.1|  PREDICTED: serine carboxypeptidase-like 27         215   3e-63    Camelina sativa [gold-of-pleasure]
ref|XP_006297635.1|  hypothetical protein CARUB_v10013654mg             215   4e-63    
ref|XP_004142401.1|  PREDICTED: serine carboxypeptidase-like 27-like    214   4e-63    Cucumis sativus [cucumbers]
ref|XP_008673013.1|  PREDICTED: LOC100285510 isoform X1                 214   5e-63    
ref|NP_001151874.1|  LOC100285510 precursor                             214   5e-63    
ref|XP_008789080.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    214   6e-63    
dbj|BAK02399.1|  predicted protein                                      214   7e-63    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002882565.1|  hypothetical protein ARALYDRAFT_478140             214   7e-63    Arabidopsis lyrata subsp. lyrata
ref|XP_010920885.1|  PREDICTED: serine carboxypeptidase-like 27         215   7e-63    Elaeis guineensis
emb|CDM82001.1|  unnamed protein product                                214   8e-63    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003566533.2|  PREDICTED: serine carboxypeptidase 2-like          214   9e-63    Brachypodium distachyon [annual false brome]
ref|XP_004970465.1|  PREDICTED: serine carboxypeptidase-like 27-like    214   9e-63    Setaria italica
ref|XP_009410600.1|  PREDICTED: serine carboxypeptidase-like 27 i...    214   1e-62    
ref|XP_010460785.1|  PREDICTED: serine carboxypeptidase-like 27         213   1e-62    Camelina sativa [gold-of-pleasure]
ref|XP_009414289.1|  PREDICTED: serine carboxypeptidase-like 27         214   1e-62    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP11023.1|  unnamed protein product                                214   2e-62    Coffea canephora [robusta coffee]
ref|XP_009410601.1|  PREDICTED: serine carboxypeptidase-like 27 i...    213   2e-62    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007009787.1|  Serine carboxypeptidase-like 27 isoform 1          215   3e-62    
emb|CAA18212.1|  SERINE CARBOXYPEPTIDASE II-like protein                211   7e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003548016.1|  PREDICTED: serine carboxypeptidase-like 27-like    212   9e-62    Glycine max [soybeans]
gb|EMT12249.1|  Serine carboxypeptidase 2                               211   1e-61    
gb|KHN13367.1|  Serine carboxypeptidase-like 27                         212   1e-61    Glycine soja [wild soybean]
gb|KCW65386.1|  hypothetical protein EUGRSUZ_G02816                     211   1e-61    Eucalyptus grandis [rose gum]
ref|XP_006294202.1|  hypothetical protein CARUB_v10023198mg             211   1e-61    Capsella rubella
gb|ACA61621.1|  hypothetical protein AP7_B10.1                          210   2e-61    Arabidopsis lyrata subsp. petraea
pdb|1BCR|B  Chain B, Complex Of The Wheat Serine Carboxypeptidase...    201   2e-61    Triticum aestivum [Canadian hard winter wheat]
pdb|3SC2|B  Chain B, Refined Atomic Model Of Wheat Serine Carboxy...    201   2e-61    unidentified
pdb|1WHS|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    201   2e-61    Triticum aestivum [Canadian hard winter wheat]
pdb|1WHT|B  Chain B, Structure Of The Complex Of L-Benzylsuccinat...    201   2e-61    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010067290.1|  PREDICTED: serine carboxypeptidase-like 27         211   4e-61    Eucalyptus grandis [rose gum]
ref|XP_010937832.1|  PREDICTED: serine carboxypeptidase-like 27         210   4e-61    Elaeis guineensis
ref|XP_002881414.1|  hypothetical protein ARALYDRAFT_482550             209   4e-61    
ref|XP_009386999.1|  PREDICTED: serine carboxypeptidase-like 27         209   5e-61    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007154876.1|  hypothetical protein PHAVU_003G155400g             206   1e-60    Phaseolus vulgaris [French bean]
gb|AES62200.2|  serine carboxypeptidase-like protein                    209   1e-60    Medicago truncatula
ref|XP_010505098.1|  PREDICTED: serine carboxypeptidase-like 26         207   2e-60    Camelina sativa [gold-of-pleasure]
ref|XP_003519151.1|  PREDICTED: serine carboxypeptidase 24-like i...    207   3e-60    Glycine max [soybeans]
ref|XP_010509560.1|  PREDICTED: serine carboxypeptidase-like 26         207   3e-60    Camelina sativa [gold-of-pleasure]
ref|XP_010516783.1|  PREDICTED: serine carboxypeptidase-like 26         206   6e-60    Camelina sativa [gold-of-pleasure]
emb|CAI64396.1|  serine carboxypeptidase II                             201   6e-60    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003549539.1|  PREDICTED: serine carboxypeptidase 24-like         206   1e-59    Glycine max [soybeans]
ref|XP_011469672.1|  PREDICTED: serine carboxypeptidase-like 27 i...    205   2e-59    Fragaria vesca subsp. vesca
gb|KHN42831.1|  Serine carboxypeptidase 24                              204   3e-59    Glycine soja [wild soybean]
ref|XP_004307399.1|  PREDICTED: serine carboxypeptidase-like 27 i...    204   5e-59    Fragaria vesca subsp. vesca
ref|XP_008352213.1|  PREDICTED: serine carboxypeptidase 24-like         200   7e-59    
gb|KDO59486.1|  hypothetical protein CISIN_1g0120681mg                  201   8e-59    Citrus sinensis [apfelsine]
ref|XP_007011905.1|  Alpha/beta-Hydrolases superfamily protein          203   1e-58    
gb|KJB76567.1|  hypothetical protein B456_012G094900                    203   2e-58    Gossypium raimondii
sp|P08819.2|CBP2_WHEAT  RecName: Full=Serine carboxypeptidase 2; ...    202   2e-58    Triticum aestivum [Canadian hard winter wheat]
ref|XP_006453596.1|  hypothetical protein CICLE_v10008182mg             202   3e-58    Citrus clementina [clementine]
gb|KFK36474.1|  hypothetical protein AALP_AA4G129400                    202   3e-58    Arabis alpina [alpine rockcress]
ref|NP_181121.1|  serine carboxypeptidase-like 26                       201   4e-58    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006474013.1|  PREDICTED: serine carboxypeptidase 24-like         202   4e-58    Citrus sinensis [apfelsine]
prf||1408163B  CPase II B                                               192   4e-58 
gb|KDP38690.1|  hypothetical protein JCGZ_04043                         196   5e-58    Jatropha curcas
ref|XP_010656616.1|  PREDICTED: serine carboxypeptidase 24 isofor...    198   2e-57    
ref|XP_008394313.1|  PREDICTED: LOW QUALITY PROTEIN: serine carbo...    200   2e-57    
ref|XP_008790133.1|  PREDICTED: serine carboxypeptidase II-2 isof...    199   2e-57    Phoenix dactylifera
ref|XP_009358427.1|  PREDICTED: serine carboxypeptidase 24              200   2e-57    Pyrus x bretschneideri [bai li]
ref|XP_004288721.2|  PREDICTED: serine carboxypeptidase 24              200   3e-57    Fragaria vesca subsp. vesca
emb|CAN79972.1|  hypothetical protein VITISV_010072                     198   5e-57    Vitis vinifera
ref|XP_006297594.1|  hypothetical protein CARUB_v10013616mg             199   6e-57    Capsella rubella
emb|CDY39224.1|  BnaA03g50360D                                          198   8e-57    Brassica napus [oilseed rape]
ref|XP_002440854.1|  hypothetical protein SORBIDRAFT_09g008660          199   8e-57    
ref|XP_010265560.1|  PREDICTED: serine carboxypeptidase 24-like i...    197   1e-56    Nelumbo nucifera [Indian lotus]
ref|XP_002275684.1|  PREDICTED: serine carboxypeptidase 24 isofor...    198   1e-56    Vitis vinifera
ref|XP_009137947.1|  PREDICTED: serine carboxypeptidase 24              197   1e-56    Brassica rapa
gb|KJB75608.1|  hypothetical protein B456_012G048700                    198   1e-56    Gossypium raimondii
emb|CDP02317.1|  unnamed protein product                                197   2e-56    Coffea canephora [robusta coffee]
ref|XP_008230880.1|  PREDICTED: serine carboxypeptidase-like 25         192   2e-56    
ref|XP_010265559.1|  PREDICTED: serine carboxypeptidase 24-like i...    197   2e-56    Nelumbo nucifera [Indian lotus]
ref|XP_010108549.1|  Serine carboxypeptidase 24                         198   2e-56    
ref|XP_004232164.1|  PREDICTED: serine carboxypeptidase-like 25         197   2e-56    Solanum lycopersicum
gb|KHG16869.1|  Serine carboxypeptidase-like 25                         197   2e-56    Gossypium arboreum [tree cotton]
gb|KFK29637.1|  hypothetical protein AALP_AA7G159500                    197   3e-56    Arabis alpina [alpine rockcress]
gb|AAK44013.1|AF370198_1  putative serine carboxypeptidase II           197   3e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204505.1|  hypothetical protein PRUPE_ppa019210mg             196   3e-56    
ref|XP_010548637.1|  PREDICTED: serine carboxypeptidase 24              197   4e-56    Tarenaya hassleriana [spider flower]
ref|NP_194790.1|  serine carboxypeptidase 24                            196   4e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412682.1|  hypothetical protein EUTSA_v10025119mg             196   4e-56    Eutrema salsugineum [saltwater cress]
ref|XP_007032750.1|  Serine carboxypeptidase-like 25 isoform 3          194   4e-56    
ref|XP_011009402.1|  PREDICTED: serine carboxypeptidase-like 25 i...    195   5e-56    Populus euphratica
ref|XP_010942076.1|  PREDICTED: serine carboxypeptidase 24 isofor...    193   7e-56    Elaeis guineensis
ref|XP_008243007.1|  PREDICTED: serine carboxypeptidase 24              196   7e-56    Prunus mume [ume]
gb|KJB07561.1|  hypothetical protein B456_001G032600                    194   7e-56    Gossypium raimondii
ref|XP_002280058.1|  PREDICTED: serine carboxypeptidase-like 25         196   8e-56    Vitis vinifera
ref|XP_008460256.1|  PREDICTED: serine carboxypeptidase-like 25 i...    194   8e-56    Cucumis melo [Oriental melon]
emb|CBI21207.3|  unnamed protein product                                196   8e-56    Vitis vinifera
ref|XP_002869369.1|  hypothetical protein ARALYDRAFT_491690             196   9e-56    Arabidopsis lyrata subsp. lyrata
emb|CAA70815.1|  serine carboxypeptidase II, CP-MII                     196   1e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009792407.1|  PREDICTED: serine carboxypeptidase 24-like         195   1e-55    Nicotiana sylvestris
ref|XP_006296368.1|  hypothetical protein CARUB_v10025540mg             194   1e-55    
ref|XP_006373361.1|  hypothetical protein POPTR_0017s12960g             191   1e-55    
ref|XP_010273635.1|  PREDICTED: serine carboxypeptidase 24-like         195   1e-55    Nelumbo nucifera [Indian lotus]
ref|XP_004304228.1|  PREDICTED: serine carboxypeptidase-like 25         195   1e-55    
ref|XP_006338367.1|  PREDICTED: serine carboxypeptidase-like 25-like    195   1e-55    
ref|XP_002308408.1|  BRI1 SUPPRESSOR 1 family protein                   194   2e-55    
ref|XP_011009401.1|  PREDICTED: serine carboxypeptidase-like 25 i...    194   2e-55    
gb|KHG14577.1|  Serine carboxypeptidase 24 -like protein                194   2e-55    
gb|KJB07564.1|  hypothetical protein B456_001G032600                    195   2e-55    
ref|XP_002529402.1|  serine carboxypeptidase, putative                  194   2e-55    
ref|XP_004137284.1|  PREDICTED: serine carboxypeptidase-like 25-like    194   2e-55    
gb|KJB07559.1|  hypothetical protein B456_001G032600                    195   2e-55    
ref|XP_010549997.1|  PREDICTED: serine carboxypeptidase-like 25         194   3e-55    
ref|XP_008460255.1|  PREDICTED: serine carboxypeptidase-like 25 i...    194   3e-55    
ref|XP_010432964.1|  PREDICTED: serine carboxypeptidase 24 isofor...    193   3e-55    
ref|XP_006408447.1|  hypothetical protein EUTSA_v10020652mg             194   3e-55    
ref|XP_011033395.1|  PREDICTED: serine carboxypeptidase 24-like         194   3e-55    
gb|KJB07563.1|  hypothetical protein B456_001G032600                    195   3e-55    
gb|KCW78823.1|  hypothetical protein EUGRSUZ_C00253                     192   3e-55    
ref|XP_007032748.1|  Serine carboxypeptidase-like 25 isoform 1          195   4e-55    
sp|P08818.2|CBP2_HORVU  RecName: Full=Serine carboxypeptidase 2; ...    194   4e-55    
gb|KDP27243.1|  hypothetical protein JCGZ_19942                         194   4e-55    
ref|XP_004489523.1|  PREDICTED: serine carboxypeptidase-like 25-like    194   5e-55    
ref|XP_009631140.1|  PREDICTED: serine carboxypeptidase 24-like         193   5e-55    
ref|XP_010432963.1|  PREDICTED: serine carboxypeptidase 24 isofor...    194   6e-55    
ref|XP_011079399.1|  PREDICTED: serine carboxypeptidase 24              193   6e-55    
ref|XP_010447693.1|  PREDICTED: serine carboxypeptidase 24-like         193   6e-55    
ref|XP_010429355.1|  PREDICTED: putative serine carboxypeptidase-...    193   6e-55    
ref|XP_008810326.1|  PREDICTED: serine carboxypeptidase 24              192   7e-55    
ref|XP_002306020.2|  serine carboxypeptidase S10 family protein         193   9e-55    
ref|XP_010942075.1|  PREDICTED: serine carboxypeptidase 24 isofor...    193   1e-54    
ref|XP_006285794.1|  hypothetical protein CARUB_v10007268mg             193   1e-54    
ref|XP_008443851.1|  PREDICTED: serine carboxypeptidase 24-like i...    192   1e-54    
ref|XP_010485446.1|  PREDICTED: serine carboxypeptidase-like 25         192   1e-54    
gb|EMT08964.1|  Serine carboxypeptidase 2                               191   1e-54    
ref|XP_008443850.1|  PREDICTED: serine carboxypeptidase 24-like i...    192   2e-54    
ref|XP_010551814.1|  PREDICTED: serine carboxypeptidase-like 25 i...    192   2e-54    
ref|XP_002325127.2|  BRI1 SUPPRESSOR 1 family protein                   191   2e-54    
ref|XP_006482750.1|  PREDICTED: serine carboxypeptidase-like 25-l...    192   2e-54    
ref|XP_008443849.1|  PREDICTED: serine carboxypeptidase 24-like i...    192   2e-54    
ref|XP_006404896.1|  hypothetical protein EUTSA_v10000274mg             187   2e-54    
ref|XP_010032541.1|  PREDICTED: serine carboxypeptidase-like 25         193   2e-54    
ref|XP_007216267.1|  hypothetical protein PRUPE_ppa017321mg             192   2e-54    
emb|CDP10248.1|  unnamed protein product                                192   2e-54    
emb|CDX76845.1|  BnaC08g34310D                                          191   2e-54    
ref|XP_006431295.1|  hypothetical protein CICLE_v10011605mg             192   3e-54    
ref|XP_010047069.1|  PREDICTED: serine carboxypeptidase 24-like         192   3e-54    
ref|XP_008645971.1|  PREDICTED: serine carboxypeptidase-like 34         183   3e-54    
gb|AAC63669.1|  putative serine carboxypeptidase II                     191   3e-54    
ref|XP_009596929.1|  PREDICTED: serine carboxypeptidase-like 25         192   3e-54    
ref|XP_002324116.2|  serine carboxypeptidase S10 family protein         191   3e-54    
ref|XP_006482748.1|  PREDICTED: serine carboxypeptidase-like 25-l...    192   3e-54    
ref|XP_006482747.1|  PREDICTED: serine carboxypeptidase-like 25-l...    192   3e-54    
ref|XP_009771074.1|  PREDICTED: serine carboxypeptidase-like 25         191   3e-54    
ref|XP_006845845.1|  hypothetical protein AMTR_s00154p00033550          191   3e-54    
ref|NP_179979.4|  serine carboxypeptidase-like 23                       191   4e-54    
gb|AFK37459.1|  unknown                                                 191   4e-54    
ref|XP_006373364.1|  hypothetical protein POPTR_0017s12960g             192   4e-54    
ref|XP_006482749.1|  PREDICTED: serine carboxypeptidase-like 25-l...    191   4e-54    
sp|O82229.2|SCP23_ARATH  RecName: Full=Putative serine carboxypep...    191   4e-54    
gb|AAM65698.1|  putative serine carboxypeptidase II                     191   5e-54    
ref|NP_186860.1|  serine carboxypeptidase-like 25                       191   5e-54    
ref|XP_009365880.1|  PREDICTED: serine carboxypeptidase-like 25         191   6e-54    
ref|XP_009117259.1|  PREDICTED: serine carboxypeptidase-like 22         191   6e-54    
ref|XP_007139483.1|  hypothetical protein PHAVU_008G033300g             191   6e-54    
ref|XP_004146676.1|  PREDICTED: serine carboxypeptidase 24-like         191   6e-54    
gb|EPS67928.1|  hypothetical protein M569_06845                         191   6e-54    
ref|XP_004161865.1|  PREDICTED: serine carboxypeptidase 24-like         191   6e-54    
ref|XP_006294162.1|  hypothetical protein CARUB_v10023155mg             191   6e-54    
gb|KFK32686.1|  hypothetical protein AALP_AA6G275800                    191   7e-54    
ref|XP_009420309.1|  PREDICTED: serine carboxypeptidase 24-like         190   8e-54    
ref|XP_010260044.1|  PREDICTED: serine carboxypeptidase-like 25 i...    190   8e-54    
ref|XP_010445019.1|  PREDICTED: serine carboxypeptidase-like 25         190   9e-54    
ref|XP_007032749.1|  Serine carboxypeptidase-like 25 isoform 2          190   1e-53    
ref|XP_011083950.1|  PREDICTED: serine carboxypeptidase 24-like i...    188   1e-53    
gb|EMT11707.1|  Serine carboxypeptidase-like 27                         192   1e-53    
ref|XP_010463602.1|  PREDICTED: serine carboxypeptidase-like 25         190   1e-53    
gb|KEH21654.1|  serine carboxypeptidase-like protein                    190   1e-53    
emb|CDY34805.1|  BnaA09g41720D                                          191   1e-53    
gb|ACF87497.1|  unknown                                                 185   1e-53    
ref|XP_002884303.1|  hypothetical protein ARALYDRAFT_477440             190   2e-53    
ref|XP_002527614.1|  serine carboxypeptidase, putative                  189   2e-53    
ref|XP_010323186.1|  PREDICTED: serine carboxypeptidase 24 isofor...    190   2e-53    
ref|XP_004242603.2|  PREDICTED: serine carboxypeptidase 24 isofor...    190   2e-53    
ref|XP_010551812.1|  PREDICTED: serine carboxypeptidase-like 25 i...    189   2e-53    
ref|XP_011000079.1|  PREDICTED: serine carboxypeptidase-like 25         189   3e-53    
ref|XP_002451122.1|  hypothetical protein SORBIDRAFT_05g024440          189   3e-53    
ref|XP_011098746.1|  PREDICTED: serine carboxypeptidase-like 25         189   3e-53    
ref|XP_009399563.1|  PREDICTED: serine carboxypeptidase 24-like         189   3e-53    
ref|XP_008357780.1|  PREDICTED: serine carboxypeptidase-like 25 i...    189   3e-53    
ref|XP_008357779.1|  PREDICTED: serine carboxypeptidase-like 25 i...    189   4e-53    
ref|NP_001145702.1|  hypothetical protein                               186   4e-53    
ref|NP_001077950.1|  serine carboxypeptidase-like 22                    187   4e-53    
ref|XP_011018040.1|  PREDICTED: serine carboxypeptidase 24-like i...    188   4e-53    
ref|XP_011083949.1|  PREDICTED: serine carboxypeptidase 24-like i...    188   5e-53    
ref|XP_002983919.1|  serine carboxypeptidase-like enzyme                188   5e-53    
dbj|BAD25095.1|  putative carboxypeptidase D                            185   6e-53    
gb|KHN13554.1|  Serine carboxypeptidase-like 25                         188   7e-53    
gb|KHN41581.1|  Serine carboxypeptidase-like 25                         187   7e-53    
ref|XP_006343642.1|  PREDICTED: serine carboxypeptidase 24-like         188   8e-53    
ref|XP_006841720.1|  hypothetical protein AMTR_s00003p00256450          186   9e-53    
ref|XP_003552566.1|  PREDICTED: serine carboxypeptidase-like 25-l...    187   9e-53    
ref|XP_004953203.1|  PREDICTED: serine carboxypeptidase-like 34-like    187   1e-52    
ref|XP_002878712.1|  hypothetical protein ARALYDRAFT_320208             187   1e-52    
ref|NP_179978.2|  serine carboxypeptidase-like 22                       187   1e-52    
ref|XP_006845380.1|  hypothetical protein AMTR_s00019p00043630          187   2e-52    
gb|KFK37671.1|  hypothetical protein AALP_AA3G013500                    187   2e-52    
ref|XP_002960751.1|  serine carboxypeptidase-like enzyme                187   2e-52    
ref|XP_010258045.1|  PREDICTED: serine carboxypeptidase-like 25         187   2e-52    
ref|XP_011022271.1|  PREDICTED: serine carboxypeptidase-like 34         187   2e-52    
gb|AAC63668.1|  putative serine carboxypeptidase II                     187   2e-52    
ref|XP_008677402.1|  PREDICTED: lysosomal protective protein isof...    187   3e-52    
ref|XP_009147382.1|  PREDICTED: serine carboxypeptidase-like 25         186   3e-52    
ref|XP_010472396.1|  PREDICTED: serine carboxypeptidase-like 22         186   3e-52    
ref|XP_010323187.1|  PREDICTED: serine carboxypeptidase 24 isofor...    184   4e-52    
emb|CDY43258.1|  BnaC05g48510D                                          186   4e-52    
ref|NP_001047514.1|  Os02g0634700                                       186   6e-52    
gb|EEC73659.1|  hypothetical protein OsI_08191                          186   6e-52    
ref|NP_001152245.1|  lysosomal protective protein precursor             186   7e-52    
ref|XP_008643436.1|  PREDICTED: hypothetical protein isoform X2         186   7e-52    
ref|XP_010089631.1|  Serine carboxypeptidase-like 25                    186   7e-52    
dbj|BAD19262.1|  putative carboxypeptidase D                            183   7e-52    
ref|XP_003530438.1|  PREDICTED: serine carboxypeptidase-like 25-l...    185   7e-52    
gb|KDO52736.1|  hypothetical protein CISIN_1g0420602mg                  180   8e-52    
gb|EYU44197.1|  hypothetical protein MIMGU_mgv1a005600mg                185   9e-52    
ref|XP_010429353.1|  PREDICTED: serine carboxypeptidase-like 22         185   1e-51    
ref|XP_010417140.1|  PREDICTED: serine carboxypeptidase-like 22         184   1e-51    
gb|AFW85537.1|  hypothetical protein ZEAMMB73_208131                    184   1e-51    
ref|XP_002452974.1|  hypothetical protein SORBIDRAFT_04g035810          185   1e-51    
ref|XP_003570294.1|  PREDICTED: serine carboxypeptidase 24              184   2e-51    
emb|CAN70886.1|  hypothetical protein VITISV_009829                     182   2e-51    
ref|XP_009413121.1|  PREDICTED: serine carboxypeptidase-like 34         184   2e-51    
ref|XP_002452495.1|  hypothetical protein SORBIDRAFT_04g026900          184   2e-51    
ref|XP_004158226.1|  PREDICTED: serine carboxypeptidase-like 34-like    182   2e-51    
ref|XP_008643435.1|  PREDICTED: hypothetical protein isoform X1         184   2e-51    
gb|ABF70080.1|  serine carboxypeptidase (carboxypeptidase D), put...    184   2e-51    
ref|XP_003593501.1|  Serine carboxypeptidase-like protein               184   3e-51    
ref|XP_003572740.1|  PREDICTED: serine carboxypeptidase-like 34         184   3e-51    
gb|EAY87844.1|  hypothetical protein OsI_09265                          184   3e-51    
gb|KCW76300.1|  hypothetical protein EUGRSUZ_D00674                     177   3e-51    
gb|EPS59460.1|  hypothetical protein M569_15347                         178   3e-51    
ref|NP_001048377.1|  Os02g0794500                                       183   4e-51    
ref|XP_006648043.1|  PREDICTED: serine carboxypeptidase 24-like         181   5e-51    
gb|ACU21427.1|  unknown                                                 177   8e-51    
ref|NP_001150705.1|  LOC100284338 precursor                             183   8e-51    
ref|XP_008461360.1|  PREDICTED: serine carboxypeptidase-like 34         182   9e-51    
ref|XP_010669643.1|  PREDICTED: serine carboxypeptidase-like 28         182   9e-51    
ref|XP_001772135.1|  predicted protein                                  182   9e-51    
ref|XP_001785856.1|  predicted protein                                  182   1e-50    
ref|XP_004135953.1|  PREDICTED: serine carboxypeptidase-like 34-like    182   1e-50    
emb|CDY65614.1|  BnaCnng47980D                                          177   1e-50    
gb|EMT14017.1|  Serine carboxypeptidase-like 34                         180   1e-50    
ref|XP_010054359.1|  PREDICTED: serine carboxypeptidase-like 31         178   2e-50    
ref|XP_010067797.1|  PREDICTED: serine carboxypeptidase-like 40 i...    179   2e-50    
gb|AFK36150.1|  unknown                                                 175   3e-50    
ref|XP_006648863.1|  PREDICTED: serine carboxypeptidase-like 34-like    180   4e-50    
dbj|BAJ85578.1|  predicted protein                                      181   5e-50    
ref|XP_006437593.1|  hypothetical protein CICLE_v10031313mg             181   5e-50    
ref|XP_006484531.1|  PREDICTED: serine carboxypeptidase-like 34-like    181   5e-50    
ref|XP_007223035.1|  hypothetical protein PRUPE_ppa005368mg             180   5e-50    
ref|XP_008803196.1|  PREDICTED: serine carboxypeptidase-like 34         179   6e-50    
ref|XP_002307165.1|  hypothetical protein POPTR_0005s09440g             180   9e-50    
dbj|BAJ92218.1|  predicted protein                                      181   1e-49    
ref|XP_010052354.1|  PREDICTED: serine carboxypeptidase-like 31         180   1e-49    
ref|XP_001765233.1|  predicted protein                                  179   1e-49    
ref|XP_010670278.1|  PREDICTED: serine carboxypeptidase-like 25         179   1e-49    
ref|XP_004954211.1|  PREDICTED: serine carboxypeptidase 24-like         179   2e-49    
ref|XP_001755195.1|  predicted protein                                  178   2e-49    
ref|XP_010933315.1|  PREDICTED: serine carboxypeptidase-like 34         177   2e-49    
ref|XP_011075284.1|  PREDICTED: serine carboxypeptidase-like 34         179   2e-49    
ref|XP_010067796.1|  PREDICTED: serine carboxypeptidase-like 40 i...    179   2e-49    
ref|XP_007131611.1|  hypothetical protein PHAVU_011G027900g             176   2e-49    
ref|XP_002312023.1|  hypothetical protein POPTR_0008s04130g             177   6e-49    
ref|XP_006847851.1|  hypothetical protein AMTR_s00029p00066410          175   6e-49    
gb|ABR16596.1|  unknown                                                 178   8e-49    
ref|XP_003537768.1|  PREDICTED: serine carboxypeptidase-like 34-like    177   1e-48    
ref|XP_004297735.1|  PREDICTED: serine carboxypeptidase-like 34         177   1e-48    
ref|XP_009591368.1|  PREDICTED: serine carboxypeptidase-like 31 i...    177   1e-48    
ref|XP_007043281.1|  Serine carboxypeptidase-like 34 isoform 1          177   2e-48    
ref|XP_009591367.1|  PREDICTED: serine carboxypeptidase-like 31 i...    176   2e-48    
ref|XP_010112534.1|  Serine carboxypeptidase-like 34                    177   2e-48    
ref|XP_007043282.1|  Serine carboxypeptidase-like 34 isoform 2          173   2e-48    
gb|EYU33331.1|  hypothetical protein MIMGU_mgv1a025174mg                176   2e-48    
ref|XP_006590795.1|  PREDICTED: serine carboxypeptidase-like 34-like    176   2e-48    
ref|XP_009800560.1|  PREDICTED: serine carboxypeptidase-like 31 i...    176   2e-48    
ref|XP_009800559.1|  PREDICTED: serine carboxypeptidase-like 31 i...    176   2e-48    
gb|EYU39589.1|  hypothetical protein MIMGU_mgv1a0101822mg               167   2e-48    
gb|KEH30582.1|  serine carboxypeptidase-like protein                    176   2e-48    
ref|XP_007131612.1|  hypothetical protein PHAVU_011G027900g             176   3e-48    
gb|EYU27945.1|  hypothetical protein MIMGU_mgv1a005674mg                176   3e-48    
ref|XP_010112533.1|  Serine carboxypeptidase-like 34                    176   4e-48    
ref|XP_011460258.1|  PREDICTED: serine carboxypeptidase-like 31         176   4e-48    
ref|XP_010031922.1|  PREDICTED: serine carboxypeptidase-like 34         176   5e-48    
gb|AFK45951.1|  unknown                                                 169   5e-48    
ref|XP_003607259.1|  Serine carboxypeptidase-like protein               175   5e-48    
ref|XP_009401001.1|  PREDICTED: serine carboxypeptidase-like 34         175   5e-48    
ref|XP_004979757.1|  PREDICTED: p-(S)-hydroxymandelonitrile lyase...    176   5e-48    
gb|ABR16997.1|  unknown                                                 176   5e-48    
ref|XP_011096266.1|  PREDICTED: serine carboxypeptidase-like 31         175   6e-48    
ref|XP_010546240.1|  PREDICTED: serine carboxypeptidase-like 34 i...    175   6e-48    
ref|XP_010274881.1|  PREDICTED: serine carboxypeptidase-like 34         175   7e-48    
ref|XP_010546241.1|  PREDICTED: serine carboxypeptidase-like 34 i...    175   8e-48    
ref|XP_002521402.1|  serine carboxypeptidase, putative                  175   8e-48    
emb|CDO99728.1|  unnamed protein product                                174   9e-48    
ref|XP_011031766.1|  PREDICTED: serine carboxypeptidase-like 27         174   1e-47    
gb|AAO24558.1|  At3g63470                                               168   1e-47    
gb|KHN05459.1|  Serine carboxypeptidase-like 34                         177   1e-47    
ref|XP_006583804.1|  PREDICTED: serine carboxypeptidase-like 31-l...    174   2e-47    
gb|KDP25724.1|  hypothetical protein JCGZ_23945                         174   2e-47    
ref|XP_003529304.1|  PREDICTED: serine carboxypeptidase-like 31-l...    174   2e-47    
ref|XP_004505704.1|  PREDICTED: serine carboxypeptidase-like 34-like    174   2e-47    
ref|XP_008224993.1|  PREDICTED: serine carboxypeptidase-like 31         174   2e-47    
pdb|1GXS|B  Chain B, Crystal Structure Of Hydroxynitrile Lyase Fr...    165   2e-47    
ref|XP_008221066.1|  PREDICTED: serine carboxypeptidase-like 34         174   3e-47    
ref|XP_002517750.1|  serine carboxypeptidase, putative                  174   3e-47    
gb|KDP20921.1|  hypothetical protein JCGZ_21392                         172   3e-47    
gb|KFK27639.1|  hypothetical protein AALP_AA8G409500                    173   4e-47    
gb|EMS66545.1|  Serine carboxypeptidase-like 34                         172   4e-47    
ref|XP_007148207.1|  hypothetical protein PHAVU_006G189100g             172   4e-47    
ref|XP_010533893.1|  PREDICTED: serine carboxypeptidase-like 31 i...    172   4e-47    
ref|XP_008654561.1|  PREDICTED: uncharacterized protein LOC100273...    172   5e-47    
emb|CDX72256.1|  BnaC07g42780D                                          175   5e-47    
gb|AFW73854.1|  hypothetical protein ZEAMMB73_784908                    173   6e-47    
ref|XP_010686577.1|  PREDICTED: serine carboxypeptidase-like 31         172   6e-47    



>ref|XP_009789305.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana sylvestris]
Length=470

 Score =   317 bits (811),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 167/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTCT  FS+++ +LKR +R VG LRR YDPCTE+HS IYFNLPEVQ+ALHVH  N
Sbjct  283  YSIFTPTCTAKFSMLNHLLKRSNR-VGHLRRSYDPCTEQHSVIYFNLPEVQEALHVHKRN  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            SSF+WV CS+EV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSIDAL
Sbjct  342  SSFKWVACSEEVSSGWKDSPKTVLDVYRELIQSGLRIWVFSGDTDAVIPVTSTRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+SPWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAG SM
Sbjct  402  KLPTISPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGASM  461

Query  141  PGLQRISDS  115
            P LQ+ISDS
Sbjct  462  PSLQQISDS  470



>ref|XP_009630744.1| PREDICTED: serine carboxypeptidase II-2 [Nicotiana tomentosiformis]
Length=470

 Score =   313 bits (802),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 166/189 (88%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT TCT  FSI++ +LKR +R VG LRR YDPCTE+HS IYFNLPEVQ+ALHVH  N
Sbjct  283  YSIFTQTCTAKFSILNHLLKRSNR-VGHLRRSYDPCTEQHSVIYFNLPEVQEALHVHKRN  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            SSF+WV CSDEV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSIDAL
Sbjct  342  SSFKWVACSDEVSSGWKDSPKTVLDVYRELIRSGLRIWVFSGDTDAVIPVTSTRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAG+SM
Sbjct  402  KLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGSSM  461

Query  141  PGLQRISDS  115
            P L+ ISDS
Sbjct  462  PSLELISDS  470



>ref|XP_004242620.1| PREDICTED: serine carboxypeptidase II-2 [Solanum lycopersicum]
Length=465

 Score =   310 bits (795),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP CT  FSI++ +L R+   VG LRR YDPCTE+HS IYFNLPEVQ ALHVH  N
Sbjct  278  YSIFTPACTAKFSILNHLL-RKSNSVGHLRRSYDPCTEQHSKIYFNLPEVQSALHVHMRN  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            SSF+WVTCS+EV   WKD P TVLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSI+AL
Sbjct  337  SSFKWVTCSEEVSSGWKDSPNTVLDVYRELIKSGLRIWVFSGDTDAVIPVTSTRYSINAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAGTSM
Sbjct  397  KLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGTSM  456

Query  141  PGLQRISDS  115
            P L+ ISDS
Sbjct  457  PSLELISDS  465



>ref|XP_006343604.1| PREDICTED: serine carboxypeptidase II-2-like [Solanum tuberosum]
Length=465

 Score =   310 bits (794),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 164/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP CT  FSI++ +L R+   +G LRR YDPCTE+HS IYFNLPEVQ ALHVH  N
Sbjct  278  YSIFTPACTAKFSILNHLL-RKSNSIGHLRRSYDPCTEQHSKIYFNLPEVQNALHVHKRN  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            SSF+WVTCS+EV   WKD P +VLDVY+ELI +GLRIWVFSGDTDAVIPVTSTRYSIDAL
Sbjct  337  SSFKWVTCSEEVSSGWKDSPMSVLDVYRELIKSGLRIWVFSGDTDAVIPVTSTRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PWR WYD+GQVGGWTQEY+GLTFV VRGAGH+VALHRPK ALTLV+SFLAGTSM
Sbjct  397  KLPTVAPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVALHRPKQALTLVKSFLAGTSM  456

Query  141  PGLQRISDS  115
            P L+ ISDS
Sbjct  457  PSLELISDS  465



>gb|EYU34325.1| hypothetical protein MIMGU_mgv1a005646mg [Erythranthe guttata]
Length=476

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 163/189 (86%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP CT + + +SR L R+  KVGLLRR YDPCTE HST+YFNLPEVQKALHVHT N
Sbjct  289  YSIFTPACTANSTSLSR-LSRKKSKVGLLRRAYDPCTEEHSTVYFNLPEVQKALHVHTRN  347

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            SS +W TCS+ V + W+D P +VL+VY+ELI +GLR+W+FSGDTDAVIPVTSTRY+IDAL
Sbjct  348  SSLKWETCSNTVNENWQDSPKSVLNVYRELIHSGLRVWIFSGDTDAVIPVTSTRYNIDAL  407

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+GQVGGWTQEY+GLTFV VRGAGH+V LHRPK ALTLV+SFL+G SM
Sbjct  408  KLPTVSPWRAWYDDGQVGGWTQEYKGLTFVTVRGAGHEVPLHRPKQALTLVKSFLSGISM  467

Query  141  PGLQRISDS  115
            P L+ +SDS
Sbjct  468  PKLELVSDS  476



>emb|CDP02851.1| unnamed protein product [Coffea canephora]
Length=472

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 165/189 (87%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP CT +FS+M++ LKRR+ KVG LRR YDPCTE+HST+YFNLP+VQ ALHV+  +
Sbjct  285  YSVFTPACTANFSVMNQFLKRRN-KVGHLRRAYDPCTEQHSTVYFNLPKVQHALHVYNRS  343

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +SF+W TCSD+VY+ WKD P +VL++Y EL+ AG+RIWVFSGDTDAV+PVTSTRYS+DAL
Sbjct  344  NSFKWATCSDDVYNNWKDSPRSVLNIYHELLNAGIRIWVFSGDTDAVLPVTSTRYSLDAL  403

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL TV PWRPWYD+GQVGGWTQ+YEGL FV VRGAGH+V LHRPK ALTL +SF++G S+
Sbjct  404  KLRTVGPWRPWYDDGQVGGWTQQYEGLNFVTVRGAGHEVPLHRPKQALTLFKSFISGNSL  463

Query  141  PGLQRISDS  115
            P L++ISDS
Sbjct  464  PQLEQISDS  472



>ref|XP_011079368.1| PREDICTED: serine carboxypeptidase II-2 [Sesamum indicum]
Length=474

 Score =   292 bits (747),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 138/189 (73%), Positives = 162/189 (86%), Gaps = 2/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP CT +FS +S   KR +RKVGLLRR YDPCTERHST+YFNLPEVQ A+HVH+ N
Sbjct  286  YSIFTPPCTANFSRLSHPWKR-NRKVGLLRRAYDPCTERHSTVYFNLPEVQNAIHVHSKN  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            S  +W TCSD V + WKD P +VL+VY+EL+ +G+RIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  345  SPLKWETCSDAVNENWKDSPRSVLNVYRELLHSGIRIWIFSGDTDAVIPVTSTRYSIDAL  404

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTVSPWR WY D+GQVGGWTQEYEGLTFV VRGAGH+V LH+PK ALTL++S+L+G S
Sbjct  405  KLPTVSPWRAWYDDDGQVGGWTQEYEGLTFVTVRGAGHEVPLHKPKQALTLIKSYLSGNS  464

Query  144  MPGLQRISD  118
            MP L+ +SD
Sbjct  465  MPKLELVSD  473



>ref|XP_002275081.1| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
 emb|CBI36573.3| unnamed protein product [Vitis vinifera]
Length=469

 Score =   278 bits (712),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+      ++++KR  R VG +   YDPCTE+HS +Y+NLPEVQ+ALHV+T N
Sbjct  282  YSIFTPPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVVYYNLPEVQQALHVYTDN  340

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGDTDA+IPVTSTRYS+DAL
Sbjct  341  APSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAIIPVTSTRYSVDAL  400

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWR WYD+GQVGGW+QEY GLTFV VRGAGH+V LH+PK ALTL+ +FL GTSM
Sbjct  401  KLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQALTLINAFLKGTSM  460

Query  141  PGLQRISDS  115
            P L++++DS
Sbjct  461  PSLEQLADS  469



>emb|CAN75200.1| hypothetical protein VITISV_014887 [Vitis vinifera]
Length=524

 Score =   279 bits (713),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+      ++++KR  R VG +   YDPCTE+HS +Y+NLPEVQ+ALHV+T N
Sbjct  337  YSIFTPPCSVKVGFSNQLMKRLIR-VGRISERYDPCTEQHSVVYYNLPEVQQALHVYTDN  395

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSDEV   WKD P TVLDVY+ELI AGLRIW+FSGDTDA+IPVTSTRYS+DAL
Sbjct  396  APSKWATCSDEVSATWKDSPKTVLDVYRELIHAGLRIWIFSGDTDAIIPVTSTRYSVDAL  455

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWR WYD+GQVGGW+QEY GLTFV VRGAGH+V LH+PK ALTL+ +FL GTSM
Sbjct  456  KLPTVGPWRAWYDDGQVGGWSQEYAGLTFVTVRGAGHEVPLHKPKQALTLINAFLKGTSM  515

Query  141  PGLQRISDS  115
            P L++++DS
Sbjct  516  PSLEQLADS  524



>ref|XP_007013884.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
 gb|EOY31503.1| Serine carboxypeptidase-like 29 [Theobroma cacao]
Length=476

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/189 (71%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+ + S    +LKRR R VG +   YDPCTE+HS +YFNLPEVQKALHV    
Sbjct  289  YSIFTPPCSANVSQSKWLLKRRLR-VGQVSDKYDPCTEKHSEVYFNLPEVQKALHVLPEV  347

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGD DAVIPVTSTRYSIDAL
Sbjct  348  APSKWETCSDIVSTNWKDSPRTMLDVYRELIHVGLRIWIFSGDADAVIPVTSTRYSIDAL  407

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWR WYD+GQVGGWTQEY GL FV+VRGAGH+V LHRPKLALTLV++FL+GTSM
Sbjct  408  KLPTVKPWRAWYDDGQVGGWTQEYAGLNFVSVRGAGHEVPLHRPKLALTLVKAFLSGTSM  467

Query  141  PGLQRISDS  115
            PGL+++SDS
Sbjct  468  PGLEQVSDS  476



>ref|XP_010273729.1| PREDICTED: serine carboxypeptidase II-2 [Nelumbo nucifera]
Length=485

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTCT + S+  R++KR   + G +   YDPCTE+HST+YFNLPEVQKALHVH   
Sbjct  299  YSIFTPTCTSNSSLSHRLMKRL--RAGRISEKYDPCTEKHSTVYFNLPEVQKALHVHPEV  356

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD P TVLD+Y ELI AGLRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  357  APTKWETCSDVVNENWKDSPKTVLDIYHELIGAGLRIWIFSGDTDAVIPVTSTRYSIDAL  416

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+ PWR WYD GQVGGWTQ+Y GL FV+VRGAGH+V LH+PKLAL+L+++FL+G  M
Sbjct  417  KLPTIGPWRAWYDEGQVGGWTQQYVGLNFVSVRGAGHEVPLHKPKLALSLIKAFLSGRQM  476

Query  141  PGLQRISDS  115
            P L   SDS
Sbjct  477  PTLTEYSDS  485



>ref|XP_007202013.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
 gb|EMJ03212.1| hypothetical protein PRUPE_ppa005192mg [Prunus persica]
Length=473

 Score =   275 bits (704),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 155/189 (82%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  + S  +R+LKR   KVG +   YDPCTE HS +YFNLPEVQKALHV+  +
Sbjct  286  YSIYTLACPANVSQSNRLLKRM-HKVGRISEKYDPCTEAHSVVYFNLPEVQKALHVNPNH  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGDTD+VIPVTSTRYSIDAL
Sbjct  345  APSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSVIPVTSTRYSIDAL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWRPWYD+GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL+++FL+G+SM
Sbjct  405  KLPTVKPWRPWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKAFLSGSSM  464

Query  141  PGLQRISDS  115
            P  + +SDS
Sbjct  465  PSSELVSDS  473



>ref|XP_004287151.1| PREDICTED: serine carboxypeptidase II-2 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   275 bits (702),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 154/189 (81%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP+C  + S  +R+LKR     G +   YDPCTE+H+ +YFNLPEVQKALHV   +
Sbjct  283  YSIYTPSCPANVSQSNRLLKRM-HVAGRINEKYDPCTEKHTVVYFNLPEVQKALHVDRHH  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD VY  WKD P TVLDVY+ELI +GLRIW+FSGDTDAVIPVTSTRYSID+L
Sbjct  342  APSKWETCSDVVYTTWKDSPRTVLDVYRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDSL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWR WYD GQVGGWTQEY GLTFV+VRGAGH+V LH+PKLAL L+++FL+G+SM
Sbjct  402  KLPTVKPWRAWYDEGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKLALALIKNFLSGSSM  461

Query  141  PGLQRISDS  115
            P LQ +SDS
Sbjct  462  PSLQLVSDS  470



>ref|XP_008243035.1| PREDICTED: serine carboxypeptidase II-2 [Prunus mume]
Length=473

 Score =   275 bits (702),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/189 (67%), Positives = 156/189 (83%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S  +R L+++  KVG +   YDPCTE HS +YFNLPEVQKALHV+  +
Sbjct  286  YSIYTPACPANVSQSNR-LQKQMHKVGRISEKYDPCTEAHSVVYFNLPEVQKALHVNPNH  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD VY  W+D P TVLDVY+ELI +GLRIW+FSGDTD+VIPVTSTRYSIDAL
Sbjct  345  APSKWATCSDVVYTTWQDSPRTVLDVYKELIHSGLRIWMFSGDTDSVIPVTSTRYSIDAL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWRPWY++GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL+++FL+G+SM
Sbjct  405  KLPTVKPWRPWYEDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKAFLSGSSM  464

Query  141  PGLQRISDS  115
            P  + +SDS
Sbjct  465  PSSELVSDS  473



>ref|XP_011018073.1| PREDICTED: serine carboxypeptidase II-2-like [Populus euphratica]
Length=371

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C+ + S  S +L +R  +VG +   YDPCTE HST+YFNLPEVQKALHV    
Sbjct  184  YSIFTPSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTVYFNLPEVQKALHVSPEF  242

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDAL
Sbjct  243  APARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVIPVTSTRYSIDAL  302

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGH+V LH+PK ALTLV++FL+GT M
Sbjct  303  KLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPM  362

Query  141  PGLQRISDS  115
            P LQ +SDS
Sbjct  363  PTLQLVSDS  371



>ref|XP_010111113.1| Serine carboxypeptidase-like 29 [Morus notabilis]
 gb|EXC30159.1| Serine carboxypeptidase-like 29 [Morus notabilis]
Length=495

 Score =   270 bits (691),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S  +++LKR    VG + + YDPCTE+HST+YFN PEVQ+ALHV   +
Sbjct  308  YSIYTPPCHANDSQSNQLLKRM-HMVGRISQKYDPCTEKHSTVYFNQPEVQRALHVDPDH  366

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD VY  WKD PTTVLD+Y ELI + LRIWVFSGDTDAVIP+TSTRYSIDAL
Sbjct  367  APSKWDTCSDLVYSTWKDSPTTVLDIYHELIHSSLRIWVFSGDTDAVIPITSTRYSIDAL  426

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWR WYD+G+VGGWTQEYEGLTFV+VRGAGH+V LH+PK ALTL++SFL+G  M
Sbjct  427  KLPTVCPWRAWYDDGEVGGWTQEYEGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSGLPM  486

Query  141  PGLQRISDS  115
            P L  +SDS
Sbjct  487  PNLNLVSDS  495



>ref|XP_011018071.1| PREDICTED: serine carboxypeptidase II-2-like isoform X1 [Populus 
euphratica]
Length=478

 Score =   268 bits (685),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/189 (68%), Positives = 150/189 (79%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C+ + S  S +L +R  +VG +   YDPCTE HST+YFNLPEVQKALHV    
Sbjct  291  YSIFTPSCSANVS-QSNLLPKRKHRVGRVSEKYDPCTETHSTVYFNLPEVQKALHVSPEF  349

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDAL
Sbjct  350  APARWETCSEVVNINWKDSPRTVLDIYKELIRSGLHLWVFSGDTDAVIPVTSTRYSIDAL  409

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGH+V LH+PK ALTLV++FL+GT M
Sbjct  410  KLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPM  469

Query  141  PGLQRISDS  115
            P LQ +SDS
Sbjct  470  PTLQLVSDS  478



>emb|CBI36578.3| unnamed protein product [Vitis vinifera]
Length=470

 Score =   266 bits (680),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+      ++++K+     G+ R+ YDPCTE+HS +Y+NLPEVQ+ALHV+  N
Sbjct  283  YSIFTPPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAVYYNLPEVQQALHVYVDN  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            ++F+W TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  342  ATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAVIPVTSTRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+GQVGGWTQ+Y GLTFV VRGAGH+V LH+PK A TL ++FL+G  M
Sbjct  402  KLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQAFTLFKAFLSGAPM  461

Query  141  PGLQRISDS  115
            P ++++S S
Sbjct  462  PYMEQVSYS  470



>ref|XP_002273324.2| PREDICTED: serine carboxypeptidase II-2 [Vitis vinifera]
Length=510

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 153/189 (81%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+      ++++K+     G+ R+ YDPCTE+HS +Y+NLPEVQ+ALHV+  N
Sbjct  323  YSIFTPPCSVKIGFSNQLMKKLIMASGISRK-YDPCTEQHSAVYYNLPEVQQALHVYVDN  381

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            ++F+W TCSDEV   WKD P +VL++Y+ELI A LRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  382  ATFKWATCSDEVSTTWKDSPRSVLNIYRELIHARLRIWIFSGDTDAVIPVTSTRYSIDAL  441

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+GQVGGWTQ+Y GLTFV VRGAGH+V LH+PK A TL ++FL+G  M
Sbjct  442  KLPTVSPWRAWYDDGQVGGWTQDYAGLTFVTVRGAGHEVPLHKPKQAFTLFKAFLSGAPM  501

Query  141  PGLQRISDS  115
            P ++++S S
Sbjct  502  PYMEQVSYS  510



>ref|XP_009358402.1| PREDICTED: serine carboxypeptidase II-2 [Pyrus x bretschneideri]
Length=482

 Score =   266 bits (679),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 150/186 (81%), Gaps = 1/186 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP+C  + S  S  L++R   VG + + YDPCTE HS +YFNLPEVQKALHV   +
Sbjct  286  YSIYTPSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKALHVDPDH  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD DAVIP+TSTRYSIDAL
Sbjct  345  APSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITSTRYSIDAL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWR WYD+GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL++SFL+G+SM
Sbjct  405  KLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSGSSM  464

Query  141  PGLQRI  124
            P  +++
Sbjct  465  PASEQL  470



>ref|XP_006453577.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66817.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=474

 Score =   265 bits (678),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    
Sbjct  285  YSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQPEVQKALHVIPAV  343

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  344  APAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDAL  403

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV PWR WYD+GQVGGWTQEY GLTFV VRGAGH+V LHRPK ALTL++SFL+G SM
Sbjct  404  NLPTVKPWRAWYDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHRPKPALTLIKSFLSGRSM  463

Query  141  PGLQRISDS  115
            P L+R+S S
Sbjct  464  PCLERVSHS  472



>gb|EPS71160.1| hypothetical protein M569_03591, partial [Genlisea aurea]
Length=441

 Score =   264 bits (675),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 151/185 (82%), Gaps = 2/185 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C  +FS  +R+ +++  + G+LRR YDPCTE HST YFNLPEVQ ALH+ + N
Sbjct  259  YSIFTPPCRTNFSRPNRLDRKKVCRFGILRRQYDPCTEEHSTAYFNLPEVQDALHIRSKN  318

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            S  +W TCSD V + WKD P++VL+VY++L  AGLRIW FSGDTD+VIPV STRYSI+AL
Sbjct  319  S--QWETCSDLVNENWKDSPSSVLNVYRKLFPAGLRIWFFSGDTDSVIPVASTRYSINAL  376

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            +LPTVSPWR WY++GQVGGWT+EYEGLT V VRGAGH+VALH+PKL+LTLV+SFL G  M
Sbjct  377  RLPTVSPWRAWYNDGQVGGWTEEYEGLTLVTVRGAGHEVALHKPKLSLTLVDSFLRGNPM  436

Query  141  PGLQR  127
            P L+ 
Sbjct  437  PKLEE  441



>gb|KDP38717.1| hypothetical protein JCGZ_04070 [Jatropha curcas]
Length=478

 Score =   265 bits (677),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP CT + S  +R+LK+R R VG + + YDPCTE HST+YFNLPEVQKALHV    
Sbjct  291  YSIFTPPCTTNSSGSNRLLKKRHR-VGHVSKKYDPCTEAHSTVYFNLPEVQKALHVSPEF  349

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCSD V + WKD P TVL++Y ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  350  LPSKWETCSDLVNENWKDSPRTVLNIYHELIHSGLRIWMFSGDTDAVIPVTSTRYSIDAL  409

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT  PW  WYD+GQVGGWTQEY GL FV VRGAGH+V LHRPKLAL L+++FL+G SM
Sbjct  410  KLPTTKPWHAWYDDGQVGGWTQEYAGLNFVVVRGAGHEVPLHRPKLALALIKTFLSGVSM  469

Query  141  PGLQRISDS  115
            P  + +S S
Sbjct  470  PTHELVSAS  478



>gb|AFK34001.1| unknown [Medicago truncatula]
Length=239

 Score =   256 bits (655),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C     +    L +R    G LR +YDPCTE+HS IYFN PEVQ+ALHV   +
Sbjct  52   YSIFTPPC----HVNDNQLDKRKHSFGRLRSVYDPCTEKHSIIYFNRPEVQRALHVDPDH  107

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCSD V   WKD PT+VL++Y+ELI  GLRIW+FSG+TDAVIPV STRYSI+AL
Sbjct  108  KPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGNTDAVIPVASTRYSINAL  167

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FL GTSM
Sbjct  168  KLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLEGTSM  227

Query  141  PGLQ  130
            P L+
Sbjct  228  PTLE  231



>ref|XP_006474032.1| PREDICTED: serine carboxypeptidase-like 29-like [Citrus sinensis]
Length=474

 Score =   264 bits (675),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    
Sbjct  285  YSIFTPSCTASVSQSNRLLKRM-HVVGHPSEKYDPCTEKHSVVYFNQPEVQKALHVIPAV  343

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  V + W D P TVLD+Y+ELI +GLRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  344  APAKWETCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGDTDAVIPVTSTRYSIDAL  403

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV PWR WYD GQVGGWTQEY GLTFV VRGAGH+V LHRPK ALTL++SFL+G SM
Sbjct  404  NLPTVKPWRAWYDEGQVGGWTQEYSGLTFVTVRGAGHEVPLHRPKPALTLIKSFLSGRSM  463

Query  141  PGLQRISDS  115
            P L+R+S S
Sbjct  464  PCLKRVSHS  472



>ref|XP_008394291.1| PREDICTED: serine carboxypeptidase II-2 [Malus domestica]
Length=482

 Score =   263 bits (673),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 149/186 (80%), Gaps = 1/186 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP+C  + S  S  L++R   VG + + YDPCTE HS +YFNLPEVQKALH    +
Sbjct  286  YSIYTPSCPANVS-QSNGLRKRRNTVGHISQKYDPCTEAHSVVYFNLPEVQKALHXDPGH  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   WKD P TVLDVY+ELI +GLRIW+FSGD DAVIP+TSTRYSIDAL
Sbjct  345  APSKWATCSDVVSMTWKDSPRTVLDVYKELIHSGLRIWMFSGDNDAVIPITSTRYSIDAL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PWR WYD+GQVGGWTQEY GLTFV+VRGAGH+V LH+PK ALTL++SFL+G+SM
Sbjct  405  KLPTVKPWRAWYDDGQVGGWTQEYAGLTFVSVRGAGHEVPLHKPKQALTLIKSFLSGSSM  464

Query  141  PGLQRI  124
            P  +++
Sbjct  465  PASEQL  470



>ref|XP_007138291.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
 gb|ESW10285.1| hypothetical protein PHAVU_009G196000g [Phaseolus vulgaris]
Length=472

 Score =   263 bits (672),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 151/191 (79%), Gaps = 3/191 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR--KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHT  508
            YS+FTP C  + S +SR+++R++R  ++GL    YDPCTERHS +YFN PEVQ ALHV  
Sbjct  283  YSLFTPPCHANVSQLSRLVRRKNRIGRLGLSTE-YDPCTERHSIVYFNRPEVQTALHVDL  341

Query  507  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
             +    W TCSD VY  WKD P +VLD+Y ELI  GL+IWVFSG+TD VIPVTSTRYSI 
Sbjct  342  DHKPATWETCSDVVYTNWKDSPRSVLDIYHELIGMGLKIWVFSGNTDVVIPVTSTRYSIS  401

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
            ALKLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LH+PKLALTLV++FLAGT
Sbjct  402  ALKLPTLSPWRAWYDDGEVGGWTQEYAGLTFVIVRGAGHEVPLHKPKLALTLVQTFLAGT  461

Query  147  SMPGLQRISDS  115
            SMP L  +S S
Sbjct  462  SMPNLDLLSTS  472



>ref|XP_002528403.1| serine carboxypeptidase, putative [Ricinus communis]
 gb|EEF33996.1| serine carboxypeptidase, putative [Ricinus communis]
Length=480

 Score =   262 bits (670),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 128/189 (68%), Positives = 148/189 (78%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP CT + S  +R+LK    KVG +   YDPCTE HST+YFNLPEVQKALHV    
Sbjct  293  YSIYTPPCTANVSGSNRLLKTM-HKVGRVYEKYDPCTEAHSTVYFNLPEVQKALHVSKEF  351

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD P TVLD+Y ELI +G+RIWVFSGDTDAVIPVTSTRYSIDAL
Sbjct  352  APSKWETCSDLVNNNWKDSPRTVLDIYHELIHSGIRIWVFSGDTDAVIPVTSTRYSIDAL  411

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T  PW  WYD+ QVGGWTQEY GL FV VRGAGH+V LHRPKLALTL+++FL+GTSM
Sbjct  412  KLRTTKPWHAWYDDRQVGGWTQEYAGLAFVVVRGAGHEVPLHRPKLALTLIKAFLSGTSM  471

Query  141  PGLQRISDS  115
            P L+ +S S
Sbjct  472  PTLEPVSSS  480



>ref|XP_010687643.1| PREDICTED: serine carboxypeptidase II-2 [Beta vulgaris subsp. 
vulgaris]
Length=475

 Score =   262 bits (669),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/189 (65%), Positives = 152/189 (80%), Gaps = 3/189 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP+CT + S+ +++LKR    +G L   YDPC+E+HS +YFN PEVQ+ALHV+   
Sbjct  290  YSIYTPSCTTNSSLPNKLLKRL---IGHLNEAYDPCSEKHSVVYFNQPEVQQALHVNPQF  346

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  V   W+D   +VLD+Y EL+ AGLRIW+FSGDTDAVIPVTSTRY+IDAL
Sbjct  347  APVKWETCSGLVNSNWQDSSRSVLDIYHELMDAGLRIWMFSGDTDAVIPVTSTRYNIDAL  406

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+ PW  WYD+GQVGGWTQEY+GLTFV VRGAGH+V LHR KL+LTLV+SFLAG SM
Sbjct  407  KLPTIKPWHAWYDDGQVGGWTQEYKGLTFVVVRGAGHEVPLHRAKLSLTLVKSFLAGESM  466

Query  141  PGLQRISDS  115
            P L+++SDS
Sbjct  467  PTLEQVSDS  475



>gb|KEH38195.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=441

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C  +    ++ +KR++  VG LR +YDPCTE+HSTIYFN PEVQ+ LHV    
Sbjct  256  YSIFTPPCHAN---DNQQIKRKN-SVGRLRGVYDPCTEKHSTIYFNRPEVQRILHVDPDY  311

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS  V   WKD P TVLD+Y+ELI  GLRIW+FSG+TDAVIPVTSTRY+I+AL
Sbjct  312  KPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGNTDAVIPVTSTRYTINAL  371

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FLAGTSM
Sbjct  372  KLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLAGTSM  431

Query  141  PGLQRIS  121
            P L+ ++
Sbjct  432  PTLEPLT  438



>ref|XP_003595890.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|ACJ85268.1| unknown [Medicago truncatula]
 gb|AES66141.1| serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AFK36219.1| unknown [Medicago truncatula]
Length=473

 Score =   258 bits (660),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C     +    L +R    G LR +YDPCTE+HS IYFN PEVQ+ALHV   +
Sbjct  286  YSIFTPPC----HVNDNQLDKRKHSFGRLRSVYDPCTEKHSIIYFNRPEVQRALHVDPDH  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCSD V   WKD PT+VL++Y+ELI  GLRIW+FSG+TDAVIPV STRYSI+AL
Sbjct  342  KPDKWQTCSDVVGTNWKDSPTSVLNIYRELIPTGLRIWIFSGNTDAVIPVASTRYSINAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+SPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FL GTSM
Sbjct  402  KLPTLSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLEGTSM  461

Query  141  PGLQ  130
            P L+
Sbjct  462  PTLE  465



>ref|XP_009410194.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=473

 Score =   258 bits (660),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 146/189 (77%), Gaps = 0/189 (0%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C  S +     L +R   VG +   YDPCTE+HST+YFNLPEVQKALH++   
Sbjct  285  YSIFTPSCPGSVTFSKNKLLKRRHSVGSIGEKYDPCTEQHSTVYFNLPEVQKALHINPAF  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD   +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRY+ID+L
Sbjct  345  APSKWETCSDVVNENWKDSARSVLHIYHELIGYGLRIWMFSGDTDAVIPVTSTRYNIDSL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PW PWYD+GQVGGWTQ Y+GLTFV VRGAGH+V LH+PKLAL L +SFL+G+SM
Sbjct  405  KLPTVTPWHPWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHQPKLALVLFKSFLSGSSM  464

Query  141  PGLQRISDS  115
            P    + DS
Sbjct  465  PTFTGLDDS  473



>ref|XP_003595892.1| Serine carboxypeptidase II-2 [Medicago truncatula]
 gb|AES66143.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=472

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/187 (67%), Positives = 150/187 (80%), Gaps = 4/187 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C  +    ++ +KR++  VG LR +YDPCTE+HSTIYFN PEVQ+ LHV    
Sbjct  287  YSIFTPPCHAN---DNQQIKRKN-SVGRLRGVYDPCTEKHSTIYFNRPEVQRILHVDPDY  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS  V   WKD P TVLD+Y+ELI  GLRIW+FSG+TDAVIPVTSTRY+I+AL
Sbjct  343  KPAKWETCSTVVNTNWKDSPRTVLDIYRELIPTGLRIWIFSGNTDAVIPVTSTRYTINAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FLAGTSM
Sbjct  403  KLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLAGTSM  462

Query  141  PGLQRIS  121
            P L+ ++
Sbjct  463  PTLEPLT  469



>ref|XP_008790132.1| PREDICTED: serine carboxypeptidase II-2 isoform X1 [Phoenix dactylifera]
Length=473

 Score =   258 bits (659),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/189 (64%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C  S +     L +R    G     YDPCTE+HST+YFNLPEVQKALHV+   
Sbjct  285  YSIFTPSCPGSVTFSKNKLLKRLHSFGRAGEKYDPCTEKHSTVYFNLPEVQKALHVNPAV  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKDCP +VL +Y ELI  GLRIW+FSGDTDAVIPV STRYS+D+L
Sbjct  345  APSKWETCSDIVNENWKDCPRSVLHIYHELIQYGLRIWMFSGDTDAVIPVASTRYSVDSL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGH+V LHRPK AL L +SFL+G+ M
Sbjct  405  KLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQALVLFKSFLSGSPM  464

Query  141  PGLQRISDS  115
            P L    DS
Sbjct  465  PTLSEFDDS  473



>gb|KHG11306.1| Serine carboxypeptidase-like 29 [Gossypium arboreum]
Length=487

 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 144/182 (79%), Gaps = 1/182 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C+ + S    +LKRR   V  L   YDPCTE+HS +YFNLPEVQK+LHV    
Sbjct  289  YSIFTPSCSANASQTKWLLKRR-LMVSQLSEKYDPCTEKHSEVYFNLPEVQKSLHVLPEA  347

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   WKD P T+LDVY+ELI  GLRIW+FSGDTDAVIP+TSTRYSIDAL
Sbjct  348  APSKWETCSDIVNTNWKDSPITMLDVYRELIHEGLRIWIFSGDTDAVIPITSTRYSIDAL  407

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T+ PWR WYD+GQVGGWTQEYEGL FV+VRGAGH+V LHRPK ALTL ++FL+GTSM
Sbjct  408  KLATMKPWRAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQALTLFKAFLSGTSM  467

Query  141  PG  136
            P 
Sbjct  468  PA  469



>ref|XP_003595891.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES66142.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=473

 Score =   258 bits (658),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 144/184 (78%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            +SIFTP C E+         RR    G LR +YDPCTE HS IYFN PEVQ+ALHV+  +
Sbjct  286  FSIFTPPCHEN----DNQPDRRKHSFGRLRGVYDPCTENHSNIYFNRPEVQRALHVNPDH  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCSD V   WKD P +VL++Y+ELI  GLRIW+FSG+TDA+IPVTSTRYSI+AL
Sbjct  342  KPDKWQTCSDVVGTNWKDSPRSVLNIYRELIPTGLRIWIFSGNTDAIIPVTSTRYSINAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LHRPKLALTL+++FL GTSM
Sbjct  402  KLPTVSPWRAWYDDGEVGGWTQEYAGLTFVNVRGAGHEVPLHRPKLALTLIKAFLEGTSM  461

Query  141  PGLQ  130
            P L+
Sbjct  462  PTLE  465



>ref|XP_004964646.1| PREDICTED: serine carboxypeptidase II-2-like [Setaria italica]
Length=474

 Score =   256 bits (654),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 141/182 (77%), Gaps = 1/182 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  +F+     + +R R VG +   YDPCTE+HST+YFNL EVQKALHV+   
Sbjct  284  YSIFTPTCHATFASSKNKVMKRLRSVGKMGEQYDPCTEKHSTVYFNLAEVQKALHVNPVI  343

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS  V + W DC  +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYSIDAL
Sbjct  344  GKSKWETCSGVVNNHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSIDAL  403

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTV+PW  WY DNG+VGGW+Q YEGLTFV VRGAGH+V LHRPK ALTL++SFLAGT 
Sbjct  404  KLPTVTPWHAWYDDNGEVGGWSQGYEGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGTP  463

Query  144  MP  139
            MP
Sbjct  464  MP  465



>ref|XP_010040844.1| PREDICTED: serine carboxypeptidase II-2-like [Eucalyptus grandis]
 gb|KCW44872.1| hypothetical protein EUGRSUZ_L01547 [Eucalyptus grandis]
Length=473

 Score =   256 bits (654),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S  +R L++R + +G +   YDPCTE HS  YFN  EVQ ALHV+   
Sbjct  286  YSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVKYFNRAEVQTALHVNKAF  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGDTDAVIPVTSTRY+ID+L
Sbjct  345  APAKWDTCSDLVNENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAVIPVTSTRYTIDSL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGH+V LHRPKLAL L+++FLAGTSM
Sbjct  405  KLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLALALIKAFLAGTSM  464

Query  141  PGLQRISDS  115
            P LQ +SDS
Sbjct  465  PSLQLVSDS  473



>ref|XP_010048771.1| PREDICTED: serine carboxypeptidase II-2 [Eucalyptus grandis]
 gb|KCW81143.1| hypothetical protein EUGRSUZ_C02514 [Eucalyptus grandis]
Length=473

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/189 (65%), Positives = 149/189 (79%), Gaps = 1/189 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S  +R L++R + +G +   YDPCTE HS  YFN  EVQ ALHV+   
Sbjct  286  YSIYTPLCPVNGSQSNR-LRKRMKVIGHVNEKYDPCTEEHSVKYFNRAEVQTALHVNKAF  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD P TVLD+Y+EL+  GLRIW+FSGDTDAVIPVTSTRY+ID+L
Sbjct  345  APAKWDTCSDLVSENWKDAPRTVLDIYRELMREGLRIWMFSGDTDAVIPVTSTRYTIDSL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV P+R WYD+G VGGWTQEY GLTFV+VRGAGH+V LHRPKLAL L+++FLAGTSM
Sbjct  405  KLPTVKPFRAWYDDGTVGGWTQEYAGLTFVSVRGAGHEVPLHRPKLALALIKAFLAGTSM  464

Query  141  PGLQRISDS  115
            P LQ +SDS
Sbjct  465  PSLQLVSDS  473



>gb|KHN02055.1| Serine carboxypeptidase II-2 [Glycine soja]
Length=469

 Score =   256 bits (653),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = -3

Query  681  YSIFTPTCTES-FSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YS+FTP C  +  S +SR+++R+ R +G L   YDPCTE+HS +YFN P+VQ  LHV   
Sbjct  281  YSLFTPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSIVYFNRPDVQTVLHVDPD  339

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
            +    W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG+TD VIPVTSTRYSI A
Sbjct  340  HKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVVIPVTSTRYSIKA  399

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L LPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LH PKLALTL ++FLAGTS
Sbjct  400  LDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLALTLFKAFLAGTS  459

Query  144  MPGLQRISDS  115
            MP L+ +  S
Sbjct  460  MPNLELVGAS  469



>gb|ACF84647.1| unknown [Zea mays]
Length=257

 Score =   249 bits (635),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R    G +   YDPCTE+HST+YFNL EVQKALHV+T  
Sbjct  67   YSIFTPTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHSTVYFNLAEVQKALHVNTVI  126

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS+ V   W DC  +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYSIDAL
Sbjct  127  GKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSIDAL  186

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPT++PW  WY D+G+VGGWTQ Y GL FV VRGAGH+V LHRPK ALTL++SFL G+ 
Sbjct  187  KLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQALTLIKSFLTGSP  246

Query  144  MP  139
            MP
Sbjct  247  MP  248



>ref|XP_002324616.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
 gb|EEF03181.2| hypothetical protein POPTR_0018s11210g [Populus trichocarpa]
Length=466

 Score =   255 bits (651),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 144/189 (76%), Gaps = 13/189 (7%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C+ +             +VG +   YDPCTE H+T+YFNLPEVQKALHV    
Sbjct  291  YSIFTPSCSAN-------------RVGRVSEKYDPCTETHTTVYFNLPEVQKALHVSPEF  337

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +   W TCS+ V   WKD P TVLD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYSIDAL
Sbjct  338  APARWETCSEVVNINWKDSPRTVLDIYKELIHSGLHVWVFSGDTDAVIPVTSTRYSIDAL  397

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGH+V LH+PK ALTLV++FL+GT M
Sbjct  398  KLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLSGTPM  457

Query  141  PGLQRISDS  115
            P LQ +SDS
Sbjct  458  PTLQLVSDS  466



>ref|XP_003522937.2| PREDICTED: serine carboxypeptidase II-2-like [Glycine max]
Length=483

 Score =   255 bits (652),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 146/190 (77%), Gaps = 2/190 (1%)
 Frame = -3

Query  681  YSIFTPTCTES-FSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YS+FTP C  +  S +SR+++R+ R +G L   YDPCTE+HS +YFN P+VQ  LHV   
Sbjct  295  YSLFTPPCQHANVSQLSRLVRRKHR-IGRLSAEYDPCTEKHSIVYFNRPDVQTVLHVDPD  353

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
            +    W TCSDEV+  WKD P TVL++Y ELI  GLRIWVFSG+TD VIPVTSTRYSI A
Sbjct  354  HKPATWETCSDEVFTNWKDSPRTVLNIYHELIQMGLRIWVFSGNTDVVIPVTSTRYSIKA  413

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L LPTVSPWR WYD+G+VGGWTQEY GLTFV VRGAGH+V LH PKLALTL ++FLAGTS
Sbjct  414  LDLPTVSPWRAWYDDGEVGGWTQEYAGLTFVVVRGAGHEVPLHSPKLALTLFKAFLAGTS  473

Query  144  MPGLQRISDS  115
            MP L+ +  S
Sbjct  474  MPNLELVGAS  483



>ref|XP_006453578.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
 gb|ESR66818.1| hypothetical protein CICLE_v10008112mg [Citrus clementina]
Length=491

 Score =   254 bits (649),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/206 (63%), Positives = 149/206 (72%), Gaps = 18/206 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    
Sbjct  285  YSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQPEVQKALHVIPAV  343

Query  501  SSFEWVTC-----------------SDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  373
            +  +W TC                 S  V + W D P TVLD+Y+ELI +GLRIW+FSGD
Sbjct  344  APAKWETCRWHQQYTLVISLFLLLCSGVVNNNWLDSPRTVLDIYRELIHSGLRIWMFSGD  403

Query  372  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHR  193
            TDAVIPVTSTRYSIDAL LPTV PWR WYD+GQVGGWTQEY GLTFV VRGAGH+V LHR
Sbjct  404  TDAVIPVTSTRYSIDALNLPTVKPWRAWYDDGQVGGWTQEYAGLTFVTVRGAGHEVPLHR  463

Query  192  PKLALTLVESFLAGTSMPGLQRISDS  115
            PK ALTL++SFL+G SMP L+R+S S
Sbjct  464  PKPALTLIKSFLSGRSMPCLERVSHS  489



>ref|XP_010905043.1| PREDICTED: serine carboxypeptidase II-2 [Elaeis guineensis]
Length=471

 Score =   253 bits (647),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 142/189 (75%), Gaps = 0/189 (0%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI TP+C  + +     L +R    G +   YDPCTE+HSTIYFNLPEVQKALHV+   
Sbjct  283  YSILTPSCPGTVTFSKNKLLKRLHSFGRVGEKYDPCTEKHSTIYFNLPEVQKALHVNPVV  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  EW TCSD V + WKD P +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRY++D+L
Sbjct  343  APSEWETCSDVVNENWKDSPRSVLHIYHELIHYGLRIWMFSGDTDAVIPVTSTRYNVDSL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGH+V LHRPK AL L +SFL+G+ M
Sbjct  403  KLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQALVLFKSFLSGSPM  462

Query  141  PGLQRISDS  115
            P L    DS
Sbjct  463  PTLSEFVDS  471



>gb|EMT26558.1| putative Serine carboxypeptidase II-2 [Aegilops tauschii]
Length=389

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 141/187 (75%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R R  G +   YDPCTE+HS +YFNL EVQKALHV+   
Sbjct  199  YSIFTPTCHSSFASSRNKVVKRLRSAGKMGEQYDPCTEQHSIVYFNLHEVQKALHVNPVI  258

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  259  GKSKWETCSEVINTNWKDCDRSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSIDAL  318

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG+ 
Sbjct  319  KLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGSP  378

Query  144  MPGLQRI  124
            MP L  +
Sbjct  379  MPVLSDL  385



>ref|NP_001057009.1| Os06g0186400 [Oryza sativa Japonica Group]
 dbj|BAD72445.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAD72446.1| putative serine carboxylase II-2 [Oryza sativa Japonica Group]
 dbj|BAF18923.1| Os06g0186400 [Oryza sativa Japonica Group]
 gb|EAZ36073.1| hypothetical protein OsJ_20382 [Oryza sativa Japonica Group]
 dbj|BAG90330.1| unnamed protein product [Oryza sativa Japonica Group]
Length=484

 Score =   250 bits (639),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 141/185 (76%), Gaps = 1/185 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R   VG +   YDPCTE+HST+YFNL EVQKALHV    
Sbjct  294  YSIFTPTCHASFASSRNKVMKRLHSVGKMGERYDPCTEKHSTVYFNLAEVQKALHVSPII  353

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   WKDC  +VL +Y ELI  GLRIWVFSGDTDAV+PVTSTRYSI+AL
Sbjct  354  NKSKWETCSDVVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAVLPVTSTRYSINAL  413

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK AL L++SFLAG+ 
Sbjct  414  KLPTVTPWNAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALILIKSFLAGSP  473

Query  144  MPGLQ  130
            MP +Q
Sbjct  474  MPSVQ  478



>ref|XP_004144720.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   249 bits (636),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 3/189 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+E+    S  L++R   +G +   YDPCTE+HS  YFNLPEVQ+ALHV    
Sbjct  283  YSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVAYFNLPEVQQALHVDPKF  339

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DAL
Sbjct  340  APSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDAL  399

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L++SFLAG S+
Sbjct  400  KLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLIKSFLAGNSL  459

Query  141  PGLQRISDS  115
              LQ  SD+
Sbjct  460  SPLQLHSDT  468



>sp|P55748.1|CBP22_HORVU RecName: Full=Serine carboxypeptidase II-2; AltName: Full=CP-MII.2; 
Contains: RecName: Full=Serine carboxypeptidase II-2 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-2 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31590.1| CP-MII.2=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 436 aa]
 emb|CAB59202.1| serine carboxylase II-2 [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   248 bits (633),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 141/187 (75%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+   
Sbjct  246  YSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEKHSIVYFNLHEVQKALHVNPVI  305

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  306  GKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSIDAL  365

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG  
Sbjct  366  KLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGRP  425

Query  144  MPGLQRI  124
            MP L  +
Sbjct  426  MPVLSDL  432



>dbj|BAJ99024.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   249 bits (635),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 142/187 (76%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+   
Sbjct  279  YSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSIVYFNLHEVQKALHVNPVI  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS+ +   WKDC  +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  339  GKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSIDAL  398

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG+ 
Sbjct  399  KLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGSP  458

Query  144  MPGLQRI  124
            MP L  +
Sbjct  459  MPVLSDL  465



>ref|NP_001146398.1| Serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39493.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACL53886.1| unknown [Zea mays]
 gb|AFW85536.1| Serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   249 bits (635),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 137/182 (75%), Gaps = 1/182 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R    G +   YDPCTE+HST+YFNL EVQKALHV+T  
Sbjct  284  YSIFTPTCHASFASSKNKVMKRLHSAGKMGEQYDPCTEKHSTVYFNLAEVQKALHVNTVI  343

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS+ V   W DC  +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYSIDAL
Sbjct  344  GKSKWETCSEAVNTHWGDCERSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSIDAL  403

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPT++PW  WY D+G+VGGWTQ Y GL FV VRGAGH+V LHRPK ALTL++SFL G+ 
Sbjct  404  KLPTITPWHAWYDDDGEVGGWTQGYRGLNFVTVRGAGHEVPLHRPKQALTLIKSFLTGSP  463

Query  144  MP  139
            MP
Sbjct  464  MP  465



>ref|XP_008452541.1| PREDICTED: serine carboxypeptidase II-2 [Cucumis melo]
Length=468

 Score =   248 bits (634),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 143/189 (76%), Gaps = 3/189 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+E   + S  L++R   VG +   YDPCTE+HS  YFNLPEVQ+ALHV    
Sbjct  283  YSIFTPPCSE---VSSNRLRKRMHMVGRIGERYDPCTEQHSVAYFNLPEVQQALHVDPKF  339

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DAL
Sbjct  340  APSKWETCSYVINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDAL  399

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLP + PWR WYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L ++FLAG S+
Sbjct  400  KLPVIGPWRAWYDEGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLFKAFLAGNSL  459

Query  141  PGLQRISDS  115
              LQ  SD+
Sbjct  460  SPLQLHSDT  468



>gb|KGN61064.1| hypothetical protein Csa_2G036620 [Cucumis sativus]
Length=542

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 144/189 (76%), Gaps = 3/189 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+E+    S  L++R   +G +   YDPCTE+HS  YFNLPEVQ+ALHV    
Sbjct  357  YSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDPCTEKHSVAYFNLPEVQQALHVDPKF  413

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DAL
Sbjct  414  APSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDAL  473

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L++SFLAG S+
Sbjct  474  KLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLIKSFLAGNSL  533

Query  141  PGLQRISDS  115
              LQ  SD+
Sbjct  534  SPLQLHSDT  542



>gb|ABK24285.1| unknown [Picea sitchensis]
Length=450

 Score =   247 bits (631),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 141/192 (73%), Gaps = 7/192 (4%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHVH  511
            YSI+TP C  S    +   +++ RK    R +   YDPCTE+HS IYFNLPEVQKALH +
Sbjct  262  YSIYTPPCLNS----TGTYRKQHRKRYPWRHLFGEYDPCTEKHSEIYFNLPEVQKALHAN  317

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T   + W TCSD V D W D P ++L +YQELI AGLRIW+FSGDTDAVIPVTSTRYSI
Sbjct  318  VTGIPYRWTTCSDAVADHWGDSPRSMLPIYQELIKAGLRIWMFSGDTDAVIPVTSTRYSI  377

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
            +ALKLPTV+ W PWYDNGQVGGWTQ YEGLTFV VRGAGH+V LH P+ A T+ ESFL G
Sbjct  378  NALKLPTVTQWHPWYDNGQVGGWTQVYEGLTFVTVRGAGHEVPLHEPRKAFTVFESFLEG  437

Query  150  TSMPGLQRISDS  115
              MP   ++ D+
Sbjct  438  KPMPVSPKLVDT  449



>ref|XP_009395827.1| PREDICTED: serine carboxypeptidase II-2-like [Musa acuminata 
subsp. malaccensis]
Length=476

 Score =   247 bits (630),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 146/190 (77%), Gaps = 1/190 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+CT SF++    L +R    G + + YDPCTE+HS +YFNLPEVQK LHV+   
Sbjct  287  YSIFTPSCTGSFTLSKNKLLKRLHSAGRIGKKYDPCTEKHSMVYFNLPEVQKVLHVNPAF  346

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +WVTCSD V   +KD   +VL +Y+ELI+ GLRIW+FSGDTDAVIPV STRY+IDAL
Sbjct  347  APSKWVTCSDFVDKNYKDSSRSVLPIYRELISHGLRIWMFSGDTDAVIPVASTRYNIDAL  406

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGH+++L RPK AL L+++FL+G  M
Sbjct  407  KLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEISLLRPKSALVLIKAFLSGNPM  466

Query  141  P-GLQRISDS  115
            P  L  + DS
Sbjct  467  PTTLPELDDS  476



>dbj|BAK02147.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=469

 Score =   247 bits (630),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 141/187 (75%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+   
Sbjct  279  YSIFTPTCHSSFASSRNKVVKRLRSVGKMGEQYDPCTEQHSIVYFNLHEVQKALHVNPVI  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS+ +   WKDC  +VL +Y ELI  GL IW+FSGDTDAVIPVTSTRYSIDAL
Sbjct  339  GKSKWETCSEVINTNWKDCERSVLHIYHELIQYGLHIWMFSGDTDAVIPVTSTRYSIDAL  398

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTV+PW  WY D+G+VGGWTQ Y+GL FV VRGAGH+V LHRPK ALTL++SFLAG+ 
Sbjct  399  KLPTVTPWHAWYDDDGEVGGWTQGYKGLNFVTVRGAGHEVPLHRPKQALTLIKSFLAGSP  458

Query  144  MPGLQRI  124
            MP L  +
Sbjct  459  MPVLSDL  465



>ref|XP_003596536.1| Serine carboxypeptidase [Medicago truncatula]
Length=562

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            Y+IFT  C  +       L +R  +VG LR +YDPCT +HST YFNLPEVQ+ LHVH  +
Sbjct  375  YNIFTTPCHAN----DNQLVKRKHRVGNLRTVYDPCTSKHSTTYFNLPEVQRILHVHPDH  430

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS  V   WKD P TVL++Y+ELI  GLRIW+FSG+TDAV+PVTSTRYSIDAL
Sbjct  431  RPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGNTDAVLPVTSTRYSIDAL  490

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+G+V GWTQEY GLTFV VRGAGH+V LHRPKLAL L +SFLAGTSM
Sbjct  491  KLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHRPKLALALFKSFLAGTSM  550

Query  141  PGLQ  130
              L+
Sbjct  551  QTLE  554



>gb|KJB76659.1| hypothetical protein B456_012G098600 [Gossypium raimondii]
Length=487

 Score =   247 bits (630),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 139/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C+ + S    +LKRR   V  L   YDPCTE+HS +YFNLPEVQK+LHV    
Sbjct  289  YSIFTPSCSANASQTKWLLKRR-HMVSQLSEKYDPCTEKHSEVYFNLPEVQKSLHVLPEA  347

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   WKD P T+LDVY+EL   GLRI +FSGDTDAVIP+TSTRYSIDAL
Sbjct  348  APSKWETCSDIVNTNWKDSPITMLDVYRELTREGLRICIFSGDTDAVIPITSTRYSIDAL  407

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL TV PW  WYD+GQVGGWTQEYEGL FV+VRGAGH+V LHRPK AL L ++FL+GTSM
Sbjct  408  KLATVKPWHAWYDDGQVGGWTQEYEGLKFVSVRGAGHEVPLHRPKQALALFKAFLSGTSM  467



>ref|XP_003564183.1| PREDICTED: serine carboxypeptidase II-2 [Brachypodium distachyon]
Length=474

 Score =   246 bits (627),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 118/187 (63%), Positives = 141/187 (75%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R R VG +   YDPCTE+HS +YFNL EVQKALHV+   
Sbjct  284  YSIFTPTCHSSFASSRNKVMKRLRSVGKMGEQYDPCTEKHSIVYFNLAEVQKALHVNPVI  343

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS  + + W D   +VL +Y ELI  GLRIW+FSGDTDAVIPVTSTRYSI+AL
Sbjct  344  GKSKWETCSGVINNNWGDSERSVLHIYHELIQYGLRIWMFSGDTDAVIPVTSTRYSINAL  403

Query  321  KLPTVSPWRPWY-DNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KLPTV+PW  WY D+G+VGGWTQ Y+GLTFV VRGAGH+V LHRPK ALTL++SFLAG+ 
Sbjct  404  KLPTVAPWHAWYDDDGEVGGWTQGYQGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGSP  463

Query  144  MPGLQRI  124
            MP L  +
Sbjct  464  MPVLSDL  470



>ref|XP_004162685.1| PREDICTED: serine carboxypeptidase-like 29-like [Cucumis sativus]
Length=468

 Score =   246 bits (627),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 143/189 (76%), Gaps = 3/189 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP C+E+    S  L++R   +G +   YD CTE+HS  YFNLPEVQ+ALHV    
Sbjct  283  YSIFTPPCSEA---SSNRLRKRMHMIGRVGERYDLCTEKHSVAYFNLPEVQQALHVDPKF  339

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  +   WKD   +VLD+Y+ELI AGLRIWVFSGDTDAV+P+TSTRYS+DAL
Sbjct  340  APSKWETCSYLINGNWKDSAGSVLDIYRELIQAGLRIWVFSGDTDAVLPITSTRYSVDAL  399

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLP +  WRPWYD GQVGGW QEYEG+T V+VRGAGH+V LH+PKLAL L++SFLAG S+
Sbjct  400  KLPVIGSWRPWYDGGQVGGWIQEYEGVTLVSVRGAGHEVPLHQPKLALQLIKSFLAGNSL  459

Query  141  PGLQRISDS  115
              LQ  SD+
Sbjct  460  SPLQLHSDT  468



>ref|XP_004488608.1| PREDICTED: serine carboxypeptidase II-2-like [Cicer arietinum]
Length=485

 Score =   246 bits (628),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 141/186 (76%), Gaps = 4/186 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  +         +R   +G LR  YDPCTE+HS  YFN PEVQ+ LHV   +
Sbjct  299  YSIYTPPCHGN----DNHKVKRKHSIGRLRATYDPCTEKHSIKYFNQPEVQRILHVDPHH  354

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCSD V   WKD P TVLD+Y+ELI  GLRIW+FSG+TD+VIPVTSTRY+IDAL
Sbjct  355  KPEKWETCSDLVNINWKDSPRTVLDIYRELIPTGLRIWMFSGNTDSVIPVTSTRYTIDAL  414

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+G+VGGW QEY GLTFV +RGAGH+V LH+PKLALTL ++FLAGTSM
Sbjct  415  KLPTVSPWRAWYDDGEVGGWIQEYAGLTFVTIRGAGHEVPLHKPKLALTLFKAFLAGTSM  474

Query  141  PGLQRI  124
            P L+ +
Sbjct  475  PTLEPL  480



>gb|AES66787.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=474

 Score =   245 bits (626),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIF   C  + + M +   R    VG LR +YDPCT +HST YFNLPEVQ+ LHVH  +
Sbjct  287  YSIFATPCHANDNQMVKGKHR----VGNLRTVYDPCTSKHSTTYFNLPEVQRILHVHPDH  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
               +W TCS  V   WKD P TVL++Y+ELI  GLRIW+FSG+TDAV+PVTSTRYSIDAL
Sbjct  343  RPAKWQTCSVVVAINWKDSPRTVLNIYRELIPTGLRIWMFSGNTDAVLPVTSTRYSIDAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTVSPWR WYD+G+V GWTQEY GLTFV VRGAGH+V LHRPKLAL L +SFLAGTSM
Sbjct  403  KLPTVSPWRAWYDDGEVAGWTQEYAGLTFVNVRGAGHEVPLHRPKLALALFKSFLAGTSM  462

Query  141  PGLQ  130
              L+
Sbjct  463  QTLE  466



>ref|XP_006655861.1| PREDICTED: serine carboxypeptidase II-2-like [Oryza brachyantha]
Length=484

 Score =   245 bits (625),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/182 (65%), Positives = 138/182 (76%), Gaps = 1/182 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC  SF+     + +R   VG +   YDPCTE+HST+YFNL EVQKALH     
Sbjct  294  YSIFTPTCHSSFAASRNKVMKRLHSVGKMGERYDPCTEKHSTVYFNLAEVQKALHASPII  353

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   WKDC  +VL +Y ELI  GLRIWVFSGDTDAV+PVTSTRYSIDAL
Sbjct  354  NKSKWETCSDIVNTNWKDCERSVLHIYHELIQYGLRIWVFSGDTDAVLPVTSTRYSIDAL  413

Query  321  KLPTVSPWRPWYD-NGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            KL TV+PW  WYD +G+VGGWTQ Y+GL FV+VRGAGH+V LHRPK AL L++SFLAG +
Sbjct  414  KLLTVTPWSAWYDEDGEVGGWTQGYKGLNFVSVRGAGHEVPLHRPKQALILIKSFLAGRA  473

Query  144  MP  139
            MP
Sbjct  474  MP  475



>gb|AIN39846.1| hypothetical protein [Zoysia matrella]
Length=172

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = -3

Query  621  RRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNSSFEWVTCSDEVYDFWKDCP  442
            +R   VG +   YDPCTE+HS +YFNLPEVQKALHV    S  +W TCS+ V   W DC 
Sbjct  2    KRLHSVGKMGEQYDPCTEKHSIVYFNLPEVQKALHVSPVISKSKWETCSEVVNTHWGDCE  61

Query  441  TTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYD-NGQVGG  265
             +VL +Y ELI  GLRIWVFSGDTDAVIPVTSTRYS+DALKLPTV+PW  WYD +G+VGG
Sbjct  62   RSVLHIYHELIQYGLRIWVFSGDTDAVIPVTSTRYSVDALKLPTVTPWHAWYDEDGEVGG  121

Query  264  WTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  139
            WT+ YEGLTFV VRGAGH+V LHRPK ALTL++SFLAG+ MP
Sbjct  122  WTEGYEGLTFVTVRGAGHEVPLHRPKQALTLIKSFLAGSPMP  163



>ref|XP_006845388.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
 gb|ERN07063.1| hypothetical protein AMTR_s00019p00053910 [Amborella trichopoda]
Length=473

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 142/186 (76%), Gaps = 1/186 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FT TC +  S +S  L+ +    G +   YDPCTE+HST+YFN PEVQKALHV+   
Sbjct  284  YSVFTITC-QGNSTLSNKLRSKSNSFGRIGEQYDPCTEKHSTVYFNQPEVQKALHVNPAF  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V   W+D   ++L +Y ELI  GLRIW+FSGDTDA+IPVTSTRY+IDAL
Sbjct  343  APSKWKTCSDVVGVNWRDSVKSILPIYHELIHEGLRIWMFSGDTDAIIPVTSTRYNIDAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            +LPTV+PW  WYDNGQVGGWTQ Y+GLTFV VRGAGH+VALH+P+LAL L+++FL G+ M
Sbjct  403  RLPTVTPWHAWYDNGQVGGWTQVYKGLTFVTVRGAGHEVALHKPRLALRLIKAFLVGSPM  462

Query  141  PGLQRI  124
            P L  +
Sbjct  463  PTLASL  468



>ref|XP_002324520.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF03085.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=470

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 139/193 (72%), Gaps = 17/193 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C+ +             +VG +   YDPCTE H+T+YFNLPEVQKALHV    
Sbjct  291  YSIFTPSCSAN-------------RVGRVSEKYDPCTETHTTVYFNLPEVQKALHVSPEF  337

Query  501  SSFEWVTCSDEV----YDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYS  334
            +   W TC             D P TVLD+Y+ELI +GL +WVFSGDTDAVIPVTSTRYS
Sbjct  338  APARWETCRGATCPHHLTLIFDSPRTVLDIYKELIHSGLHVWVFSGDTDAVIPVTSTRYS  397

Query  333  IDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLA  154
            IDALKLPTV PW  WYD+GQVGGWTQEY GLTFV VRGAGH+V LH+PK ALTLV++FL+
Sbjct  398  IDALKLPTVKPWGAWYDDGQVGGWTQEYAGLTFVVVRGAGHEVPLHKPKQALTLVKAFLS  457

Query  153  GTSMPGLQRISDS  115
            GT MP LQ +SDS
Sbjct  458  GTPMPTLQLVSDS  470



>ref|XP_009137969.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=476

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 138/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S    +LK+R R  G +   YDPCT +HS +YFNLPEVQ+ALHV    
Sbjct  280  YSVFTPACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKVYFNLPEVQEALHVPPGL  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W  CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  339  APSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  398

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGH+V LHRPK AL L ++F++GTS+
Sbjct  399  KLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEALALFQAFISGTSL  458



>emb|CDY13387.1| BnaA03g51050D [Brassica napus]
Length=476

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S    +LK+R R  G +   YDPCT +HS +YFNLPEVQ+ALHV    
Sbjct  280  YSVFTPACVANASQAKMLLKKR-RVGGRVSEQYDPCTMKHSKVYFNLPEVQEALHVPPGL  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W  CSD+V   WKD P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  339  APSKWDVCSDDVSRNWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  398

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGH+V LHRPK AL L ++F+ GTS+
Sbjct  399  KLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEALALFQAFITGTSL  458



>ref|XP_009127491.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=480

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  S +L ++   V  L R+YDPCT++HS +YFNLP+VQKALHV    
Sbjct  296  YSVFTPACVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSKVYFNLPKVQKALHVPPKV  355

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA++PVTSTRYSI+AL
Sbjct  356  APSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIVPVTSTRYSINAL  415

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+GH+VALHRPK AL L ++F++GT +
Sbjct  416  NLSTISPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEALALFKAFISGTPL  475



>emb|CDX68696.1| BnaC01g07570D [Brassica napus]
Length=504

 Score =   238 bits (608),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  S +L ++   V  L R+YDPCT++HS +YFNLP+VQKALHV    
Sbjct  320  YSVFTPACVTNSSQSSMLLNKKGPFVSDLSRVYDPCTKKHSKVYFNLPKVQKALHVPPQV  379

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA++PVTSTRYSI+AL
Sbjct  380  APSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIVPVTSTRYSINAL  439

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T+SP+ PWY +GQVGGW+Q+Y GL FV VRG+GH+VALHRPK AL L ++F++GT +
Sbjct  440  NLSTLSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEALALFKAFISGTPL  499



>emb|CDX72270.1| BnaC07g42920D [Brassica napus]
Length=667

 Score =   241 bits (616),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 139/181 (77%), Gaps = 1/181 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTPTC  + S    +LK+R    G +   YDPCT +HS +YFNLPEVQ+ALHV    
Sbjct  280  YSVFTPTCVANASQAKMLLKKRAVG-GRVSEQYDPCTMKHSKVYFNLPEVQEALHVPPGL  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W  CSD V + WKD P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  339  APSKWDVCSDVVSENWKDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  398

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL  VSP+ PWY +GQVGGWTQEY+GL FV VRGAGH+V LHRPK AL L ++F++GTS+
Sbjct  399  KLHPVSPYGPWYIDGQVGGWTQEYDGLNFVTVRGAGHEVPLHRPKEALALFQAFISGTSL  458

Query  141  P  139
            P
Sbjct  459  P  459



>ref|XP_010526302.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=489

 Score =   236 bits (603),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 137/181 (76%), Gaps = 1/181 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTPTC  + +    +LK+R   +G +   YDPCTE+HS +YFNLPEVQ ALHV    
Sbjct  287  YSVFTPTCPGNVTQTKFLLKKRP-ILGRVSENYDPCTEKHSIMYFNLPEVQTALHVPPEL  345

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD P +VL++Y ELI AGL IWVFSGD DAV+PVTSTRYSIDAL
Sbjct  346  APSKWETCSDTVGNHWKDSPRSVLNIYHELIAAGLHIWVFSGDADAVVPVTSTRYSIDAL  405

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  ++PWRPWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++G S+
Sbjct  406  NLRPLNPWRPWYIDGQVGGWTQQYVGLNFVTVRGAGHEVPLHRPKQALALFKAFVSGNSL  465

Query  141  P  139
            P
Sbjct  466  P  466



>emb|CDY28217.1| BnaA01g06320D [Brassica napus]
Length=468

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 138/181 (76%), Gaps = 1/181 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRK-VGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YS+FTP C  + S  S +L  + R  V  L R+YDPCT++HS +YFNLP+VQKALHV   
Sbjct  283  YSVFTPACVVTNSSQSSMLLNKKRPFVSDLSRVYDPCTKKHSKVYFNLPKVQKALHVPPK  342

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
             +  +W TCS  V + WKD P++VLD+Y ELI AGLRIWVFSGD DA++PVTSTRYSI+A
Sbjct  343  VAPSKWDTCSKVVGEHWKDSPSSVLDIYHELIAAGLRIWVFSGDADAIVPVTSTRYSINA  402

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L L T SP+ PWY +GQVGGW+Q+Y GL FV VRG+GH+VALHRPK AL L ++F++GT 
Sbjct  403  LNLSTTSPYGPWYIDGQVGGWSQQYAGLNFVIVRGSGHEVALHRPKEALALFKAFISGTP  462

Query  144  M  142
            +
Sbjct  463  L  463



>ref|XP_006470942.1| PREDICTED: serine carboxypeptidase II-2-like [Citrus sinensis]
Length=315

 Score =   229 bits (585),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 141/217 (65%), Gaps = 29/217 (13%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+CT S S  +R+LKR    VG     YDPCTE+HS +YFN PEVQKALHV    
Sbjct  98   YSIFTPSCTASVSQSNRLLKRM-HVVGHASEKYDPCTEKHSVVYFNQPEVQKALHVIPAV  156

Query  501  SSFEWVTCS------------------DEVYDFWKDCPTTVLDVYQELITAGLRIWVFSG  376
            +  +W TC                     V + W D P  VLD+Y ELI +GLRIW+FSG
Sbjct  157  ALAKWETCRWHQQHALMIFFIFTALQWGVVNNNWLDSPRIVLDIYHELIHSGLRIWMFSG  216

Query  375  DTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGG----------WTQEYEGLTFVAV  226
            DTDAVIPVTSTRYSIDAL LPTV PWR WYD GQV            WTQEY GLT V V
Sbjct  217  DTDAVIPVTSTRYSIDALNLPTVKPWRAWYDEGQVNYTTKPFITYILWTQEYAGLTLVTV  276

Query  225  RGAGHKVALHRPKLALTLVESFLAGTSMPGLQRISDS  115
            RGA H+V LHRPK ALTL++SFL+G SMP L+R+S S
Sbjct  277  RGADHEVPLHRPKPALTLIKSFLSGRSMPCLERVSLS  313



>emb|CDY55623.1| BnaC03g77560D [Brassica napus]
Length=477

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S    +LK+R R    +   YDPCTE+HS +YFNLPEVQ+ALHV    
Sbjct  281  YSVFTPACIANASQSKMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLPEVQEALHVPPGL  339

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL
Sbjct  340  APSKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDAL  399

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  400  NLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  459



>gb|ACG38162.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG38177.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=463

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQ+ALH + T 
Sbjct  277  YSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQRALHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  334  IPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGH+V LHRP+  L L E FL G  M
Sbjct  394  FLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEHFLRGEPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>ref|XP_008654560.1| PREDICTED: uncharacterized protein LOC100273202 isoform X1 [Zea 
mays]
 gb|ACF86547.1| unknown [Zea mays]
 gb|AFW80078.1| serine carboxypeptidase K10B2.2 [Zea mays]
Length=463

 Score =   233 bits (594),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQ+ALH + T 
Sbjct  277  YSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQRALHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  334  IPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGH+V LHRP+  L L E FL G  M
Sbjct  394  FLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEHFLRGEPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>gb|ACF79757.1| unknown [Zea mays]
Length=463

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 136/181 (75%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQ+ALH + T 
Sbjct  277  YSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQRALHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WVTCSD VYDFWKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  334  IPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT++ W PWYD+ +VGGW Q YEGLT V VRGAGH+V LHRP+  L L E FL G  M
Sbjct  394  FLPTITNWYPWYDDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLFEHFLRGEPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>dbj|BAH20278.1| AT4G30810 [Arabidopsis thaliana]
Length=373

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R      +   YDPCTE+H+T+YFNLPEVQKALHV    
Sbjct  177  YSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNLPEVQKALHVPPGL  235

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  236  APSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  295

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  296  NLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  355



>emb|CDY23258.1| BnaA08g12880D [Brassica napus]
Length=478

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R R    +   YDPCTE+HS +YFNLPEVQ+ALHV    
Sbjct  282  YSVFTPACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLPEVQEALHVPPGL  340

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL
Sbjct  341  APSKWDTCSDVVNEHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDAL  400

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  401  NLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTQL  460



>emb|CDY28216.1| BnaA01g06330D [Brassica napus]
Length=481

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  S S    +LKRR     +  + YDPCTE+HS +YFNLPEVQ+ALHV    
Sbjct  284  YSVFTPACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKVYFNLPEVQRALHVPPEV  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  343  APSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVVPVTSTRYSIDAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  403  NLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|XP_010525795.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=277

 Score =   226 bits (575),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 135/187 (72%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTPTC  + S    +LK+R    G +   YDPCTE+HS +YFNLPEVQKALHV    
Sbjct  75   YSVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNLPEVQKALHVPPEF  133

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W  CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSI+AL
Sbjct  134  APSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIEAL  193

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGH+V LHRPK +L L ++F++G  +
Sbjct  194  NLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSGNPL  253

Query  141  PGLQRIS  121
            P  ++ S
Sbjct  254  PTSEKNS  260



>ref|XP_002457307.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
 gb|EES02427.1| hypothetical protein SORBIDRAFT_03g005360 [Sorghum bicolor]
Length=463

 Score =   231 bits (588),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 135/181 (75%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R+++ R      L R YDPCTE++ST Y+NLPEVQKALH + T 
Sbjct  277  YSIYTPTCKKTSLHKRRLIRGR---TPWLPRGYDPCTEKYSTKYYNLPEVQKALHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WVTCSD VYDFWKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  334  IPYPWVTCSDPVYDFWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD+ +VGGW Q Y+GLT V +RGAGH+V LHRP+  L L E FL    M
Sbjct  394  FLPTVTNWYPWYDDEEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRQGLKLFEHFLRDEPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>gb|KFK29659.1| hypothetical protein AALP_AA7G162000 [Arabis alpina]
Length=478

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S    +LK+R      +   YDPCTE+HS +YFNLPEV+ ALHV +  
Sbjct  280  YSVFTPACLANASQTKMLLKKRPM-TSRVSEQYDPCTEKHSKVYFNLPEVKTALHVPSRL  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +S +W TCSD V + WKDC ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  339  ASAKWDTCSDVVNEHWKDCSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  398

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  399  NLRPLSTYGPWYMDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTQL  458



>ref|XP_010253608.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 132/181 (73%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + S+   +          + R YDPCTER+ST+YFN PEVQK+LH + T 
Sbjct  281  YSIFTRPCNNTASLRHNLRGHYP----WMTRAYDPCTERYSTMYFNQPEVQKSLHANVTG  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V D+W D P ++L +YQELI AGLRIWVFSGDTDAV+PVT+TRYSIDAL
Sbjct  337  ISYPWKTCSDIVGDYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVVPVTATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV  W PWYDNG+VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L +SFL    M
Sbjct  397  KLPTVINWYPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPREAFILFKSFLENKPM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_009127511.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=481

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  S S    +LKRR     +  + YDPCTE+HS +YFNLPEVQ+ALHV    
Sbjct  284  YSVFTPACVASASQSRMLLKRRPVNSRVSEQ-YDPCTEKHSKVYFNLPEVQRALHVPPEV  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  343  APSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVVPVTSTRYSIDAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L + SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  403  NLSSTSPYGPWYTDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>emb|CDX68695.1| BnaC01g07580D [Brassica napus]
Length=481

 Score =   230 bits (587),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  S S  SR+L  R      +   YDPCTE+HS +YFNLPEVQ+ALHV    
Sbjct  284  YSVFTPACVASAS-QSRMLLNRRPVNSRVSEQYDPCTEQHSKVYFNLPEVQRALHVPPEV  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TC+  V + W DC ++VLD+Y ELI AG+RIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  343  APSKWDTCNYVVNENWNDCASSVLDIYHELIAAGIRIWVFSGDADAVVPVTSTRYSIDAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  403  NLSTTSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|XP_010669644.1| PREDICTED: serine carboxypeptidase-like 27 [Beta vulgaris subsp. 
vulgaris]
Length=456

 Score =   229 bits (585),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  + S M R L  R      + R YDPCTER+ST YFN P+VQ ALH ++T 
Sbjct  276  YSIYTRPCKSTAS-MKRSLNGR---YPWMSRAYDPCTERYSTEYFNRPDVQLALHANSTK  331

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V ++W + P T+L +YQELI AGLRIWV+SGDTDAV+P+T+TRYSIDAL
Sbjct  332  ISYPWSTCSDIVGNYWSESPLTMLPIYQELIAAGLRIWVYSGDTDAVVPITATRYSIDAL  391

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+ W PWYDNG+VGGW+Q YEGLTFV ++GAGH+V LHRP+ A  L   FL   SM
Sbjct  392  KLPTVTNWYPWYDNGRVGGWSQVYEGLTFVTIKGAGHEVPLHRPRQAFILFNHFLKNKSM  451

Query  141  P  139
            P
Sbjct  452  P  452



>ref|NP_567854.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
 sp|Q949Q7.1|SCP29_ARATH RecName: Full=Serine carboxypeptidase-like 29; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK93635.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM91708.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AEE85811.1| serine carboxypeptidase-like 29 [Arabidopsis thaliana]
Length=479

 Score =   230 bits (586),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R      +   YDPCTE+H+T+YFNLPEVQKALHV    
Sbjct  283  YSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNLPEVQKALHVPPGL  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  342  APSKWDTCSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  402  NLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  461



>ref|XP_004968265.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=523

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 133/180 (74%), Gaps = 3/180 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R ++ R      L R YDPCTE++S  Y+NLPEVQKALH + T 
Sbjct  337  YSIYTPTCKKTSLHKRRQIRGR---TPWLPRGYDPCTEKYSEKYYNLPEVQKALHANVTG  393

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WV CSD +YD+WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  394  IPYAWVACSDPIYDYWKDSPKSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDAL  453

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYDNG+VGGW Q Y+GLT V VRGAGH+VALHRP+  L L E FL    M
Sbjct  454  SLPTVTNWYPWYDNGEVGGWCQVYKGLTLVTVRGAGHEVALHRPRQGLKLFEHFLRDEPM  513



>ref|XP_010527107.1| PREDICTED: serine carboxypeptidase-like 29, partial [Tarenaya 
hassleriana]
Length=207

 Score =   221 bits (564),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 133/187 (71%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            Y +FTPTC  + S    +LK+R    G +   YDPCTE+HS +YFN PEVQKALHV    
Sbjct  5    YIVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNPPEVQKALHVPPEF  63

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W  CSD V + W D P +VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSI+AL
Sbjct  64   APSKWDICSDTVSEHWIDSPPSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIEAL  123

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGH+V LHRPK +L L ++F++G  +
Sbjct  124  NLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSGNPL  183

Query  141  PGLQRIS  121
            P  ++ S
Sbjct  184  PTSEKNS  190



>emb|CDO99730.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 133/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+TP C  S S     L+RR R     + R YDPCTERHST+YFNLPEVQ+A H +TT
Sbjct  283  YSIYTPPCNASSS-----LRRRFRVHFPWMPRAYDPCTERHSTVYFNLPEVQEAFHANTT  337

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               + W TCSD V  +W D P +VL +YQ L+ AGL+IWVFSGDTD+V+P+T+TRYSIDA
Sbjct  338  GIPYPWKTCSDTVGIYWTDAPLSVLPIYQGLMAAGLKIWVFSGDTDSVVPITATRYSIDA  397

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PWYDN +VGGW+Q Y+GL FV V GAGH+V LHRP+LA  L  SFL    
Sbjct  398  LKLPTITNWYPWYDNKRVGGWSQVYKGLIFVTVTGAGHEVPLHRPRLAYILFRSFLENEP  457

Query  144  MP  139
            MP
Sbjct  458  MP  459



>ref|XP_009108967.1| PREDICTED: serine carboxypeptidase-like 29 [Brassica rapa]
Length=477

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R R    +   YDPCTE+HS +YFNLPEVQ+ALHV    
Sbjct  281  YSVFTPACIANASQSNMLLKKRPR-TSRVSEQYDPCTEKHSKVYFNLPEVQEALHVPPGL  339

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL
Sbjct  340  APSKWDTCSDVVNENWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDAL  399

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +SP+ PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK  L L ++F++GT +
Sbjct  400  NLRPLSPYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEGLALFKAFISGTPL  459



>ref|XP_003556225.1| PREDICTED: serine carboxypeptidase-like 27-like isoform 1 [Glycine 
max]
 gb|KHN00830.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=460

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 133/181 (73%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++T  C  + S + R LK R      + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  281  YSVYTQPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDLYFNRPEVQKALHANVTG  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V ++W D P ++L +YQELI+AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  337  IPYAWKACSDIVGNYWTDSPLSMLPIYQELISAGLRIWVYSGDTDAVVPVTATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGH+V LHRP+ A  L  SFL   SM
Sbjct  397  KLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAFILFRSFLENKSM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_002312024.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEE89391.1| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 131/182 (72%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + ++   +          + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  280  YSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSKVYFNHPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V D+W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  336  IPYPWKTCSDIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYDNG+VGGW+Q Y+GL+FV V GAGH+V LHRP+ A  L  SFL   SM
Sbjct  396  KLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLHRPRQAFILFRSFLKNKSM  455

Query  141  PG  136
            PG
Sbjct  456  PG  457



>ref|XP_010264739.1| PREDICTED: serine carboxypeptidase-like 27 [Nelumbo nucifera]
Length=458

 Score =   228 bits (580),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 112/182 (62%), Positives = 134/182 (74%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C+ + S     L+R  R     + R YDPCTER+S IYFN PEVQKALH + T
Sbjct  281  YSIFTRPCSSAIS-----LRRNLRGHYPWMPRAYDPCTERYSIIYFNRPEVQKALHANLT  335

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V D+W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSIDA
Sbjct  336  AISYPWKTCSDIVGDYWADSPLSMLPIYEELIAAGLRIWVFSGDTDAVVPLTATRYSIDA  395

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPTV  W PWYD+G+VGGW+Q Y+GLTFV VRGAGH+V LHRP+  L L + FL    
Sbjct  396  LKLPTVMNWYPWYDHGKVGGWSQVYKGLTFVTVRGAGHEVPLHRPRQVLILFKYFLENKP  455

Query  144  MP  139
            MP
Sbjct  456  MP  457



>ref|XP_002869361.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45620.1| hypothetical protein ARALYDRAFT_491673 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R      +   YDPCTE+H+T+YFNLPEVQKALHV    
Sbjct  283  YSVFTPACVANASQSNMLLKKRPM-TSRVSEQYDPCTEKHTTVYFNLPEVQKALHVPAGL  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  342  APSKWDTCSDVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK A  L ++F++GT +
Sbjct  402  NLRPLSVYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQAFALFKAFISGTPL  461



>ref|XP_011076996.1| PREDICTED: serine carboxypeptidase-like 27 [Sesamum indicum]
Length=461

 Score =   228 bits (580),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 111/182 (61%), Positives = 132/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C  + S     L+RR R     + R YDPCTER+S IYFNLPEVQ ALH + T
Sbjct  284  YSIYTRPCNSASS-----LRRRLRGHYPWMSRAYDPCTERYSEIYFNLPEVQNALHANVT  338

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W +CSD V ++W D P +VL +YQELI AG RIWVFSGDTDAV+PVT+TRYSIDA
Sbjct  339  RISYPWQSCSDIVGNYWADTPLSVLPIYQELIAAGHRIWVFSGDTDAVVPVTATRYSIDA  398

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PWYDNG+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    
Sbjct  399  LKLPTITKWYPWYDNGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKP  458

Query  144  MP  139
            MP
Sbjct  459  MP  460



>dbj|BAO04184.1| hypothetical protein [Delphinium grandiflorum]
Length=456

 Score =   227 bits (579),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTPTC+ + S    + K R R    +   YDPCTE+HST+YFNLPEVQKALH + T 
Sbjct  279  YSIFTPTCSATISQRRNLRKIRPR----ISVPYDPCTEKHSTVYFNLPEVQKALHANVTG  334

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TC+D + D WKD P ++L +Y+ELI AG+RIWVFSGDTD+V+PVT+TRYS+D L
Sbjct  335  IPYPWATCNDIIGDNWKDSPRSMLPIYRELIAAGIRIWVFSGDTDSVVPVTATRYSLDTL  394

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            +LPT+  W PWYDNGQ+GGW++ Y+GL+ + VRGAGH+V LH P+ A  + +SFL    M
Sbjct  395  ELPTLVKWHPWYDNGQMGGWSEVYDGLSLIVVRGAGHEVPLHAPRKAYIMFKSFLENKPM  454

Query  141  P  139
            P
Sbjct  455  P  455



>gb|KDP25725.1| hypothetical protein JCGZ_23946 [Jatropha curcas]
Length=456

 Score =   227 bits (578),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + S+   +          + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  279  YSIFTRPCNNTASLRHNLRGHYP----WMSRAYDPCTERYSKLYFNRPEVQKALHANATG  334

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  335  ISYPWKTCSDIVGNYWADAPLSMLPIYKELIAAGLKIWVYSGDTDAVVPVTATRYSIDAL  394

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT++ W PWYDNG+VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L +SFL    M
Sbjct  395  KLPTITNWSPWYDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAFILFKSFLENKPM  454

Query  141  P  139
            P
Sbjct  455  P  455



>ref|XP_006850617.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
 gb|ERN12198.1| hypothetical protein AMTR_s00034p00161680 [Amborella trichopoda]
Length=461

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 133/182 (73%), Gaps = 8/182 (4%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI++P C  S       LK + R     + R YDPCTERHS +YFNLPEVQKALH + T
Sbjct  283  YSIYSPPCNAS-----ATLKNKPRGHYPWMSRAYDPCTERHSKVYFNLPEVQKALHANVT  337

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               + W TCSD V + W+D P ++L +YQELI AG RIWVFSGDTD+V+PVT+TRYS+DA
Sbjct  338  GIPYPWATCSDVVGNNWQDSPKSMLPIYQELIAAGFRIWVFSGDTDSVVPVTATRYSLDA  397

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PWYDNG+VGGW+Q Y GLTFV + GAGH+V LHRP+ A  L +SFL   +
Sbjct  398  LKLPTLTNWYPWYDNGKVGGWSQVYRGLTFVTITGAGHEVPLHRPRQAFILFKSFL--QN  455

Query  144  MP  139
            MP
Sbjct  456  MP  457



>ref|XP_006412667.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
 gb|ESQ54120.1| hypothetical protein EUTSA_v10025076mg [Eutrema salsugineum]
Length=480

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  S++L  + R    +   YDPCTE+HS +YFNLPEV++ALHV    
Sbjct  284  YSVFTPACVANAS-QSKMLLNKRRMTSRVSEQYDPCTEKHSKVYFNLPEVKEALHVPPGL  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +S +W TCS+ V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVT+TRYSIDAL
Sbjct  343  ASSKWDTCSNVVNEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTATRYSIDAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGWTQ+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  403  NLRPLSTYGPWYIDGQVGGWTQQYAGLNFVTVRGAGHEVPLHRPKEALALFKAFISGTPL  462



>ref|XP_009378094.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 136/182 (75%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C  + S     LKR  R     + R YDPCTER+S +YFN P+VQKALH + T
Sbjct  278  YSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHANVT  332

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT+TRYSIDA
Sbjct  333  RVSYPWKTCSDIVGNYWADSPLSILPIYRELIAAGLRIWVFSGDTDSVVPVTATRYSIDA  392

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PW +NG+VGGW+Q Y+GLTFV V GAGH+V LHRP+LA+ L  SFLA  +
Sbjct  393  LKLPTITNWYPWNNNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRLAVILFRSFLASKA  452

Query  144  MP  139
            MP
Sbjct  453  MP  454



>ref|XP_011031767.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 132/182 (73%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + ++   +          + R YDPCT+R+S +YFN PEVQKALH + T 
Sbjct  280  YSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTDRYSKVYFNHPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              ++W TCSD V D+W D P ++L +Y+EL+ AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  336  IPYQWKTCSDIVGDYWADSPLSMLPIYKELMAAGLRIWVYSGDTDAVVPVTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYDNG+VGGW+Q Y+GL+FV V GAGH+V LHRP+ A  L  SFL   SM
Sbjct  396  KLPTIINWYPWYDNGKVGGWSQVYKGLSFVTVTGAGHEVPLHRPRQAFILFRSFLENKSM  455

Query  141  PG  136
            PG
Sbjct  456  PG  457



>ref|XP_006645520.1| PREDICTED: serine carboxypeptidase II-1-like [Oryza brachyantha]
Length=412

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++  +  R++K     +  L R YDPCTE++ST Y+NLPEVQKA H + T 
Sbjct  226  YSIYTPTCKKTSFLKRRLIKG---NMPWLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTG  282

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  283  IPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDAL  342

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  343  HLPTVTNWYPWYDDDEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDNPM  402

Query  141  P  139
            P
Sbjct  403  P  403



>ref|XP_008368824.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 134/182 (74%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C  + S     LKR  R     + R YDPCTER+S +YFN P+VQKALH + T
Sbjct  278  YSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHANVT  332

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT+TRYSIDA
Sbjct  333  RVSYPWKTCSDIVGNYWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPVTATRYSIDA  392

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PW DNG+VGGW+Q Y+GLTFV V GAGH+V LHRP+LA  L  SFL   +
Sbjct  393  LKLPTITNWYPWNDNGKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRLAFILFRSFLGSKA  452

Query  144  MP  139
            MP
Sbjct  453  MP  454



>gb|KJB78938.1| hypothetical protein B456_013G026200 [Gossypium raimondii]
Length=470

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 133/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C ++ S     L+R  R     + R +DPCTER+S  YFN PEVQKALH + T
Sbjct  279  YSIFTQPCADTTS-----LRRNLRGHYPWMSRAFDPCTERYSKEYFNRPEVQKALHANVT  333

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               ++W TCSD V   W D P ++L +YQELI AG+RIWV+SGDTDAV+PVT+TRYSIDA
Sbjct  334  GIPYQWETCSDVVGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTDAVVPVTATRYSIDA  393

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PWYDNG+VGGW+QEY+GLTFV V GAGH+V LHRP+ A  L  SFL   S
Sbjct  394  LKLPTINKWHPWYDNGKVGGWSQEYKGLTFVTVTGAGHEVPLHRPRQAFILFRSFLENKS  453

Query  144  MP  139
            MP
Sbjct  454  MP  455



>gb|AFK43035.1| unknown [Medicago truncatula]
Length=459

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 131/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T 
Sbjct  280  YSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNCPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  336  IPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGH+V LH+P+ A  L  SFL    M
Sbjct  396  KLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLENKDM  455

Query  141  P  139
            P
Sbjct  456  P  456



>ref|XP_003591950.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62201.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=459

 Score =   226 bits (575),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 131/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T 
Sbjct  280  YSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNRPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  336  IPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLT V +RGAGH+V LH+P+ A  L  SFL    M
Sbjct  396  KLPTIINWYPWYDSGKVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLENKDM  455

Query  141  P  139
            P
Sbjct  456  P  456



>ref|XP_010447670.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=479

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R    G +   YDPCTE+H+ +YFNLPEVQKALHV    
Sbjct  283  YSVFTPACVANASQSNMLLKKRPM-TGRVSEQYDPCTEKHTKVYFNLPEVQKALHVPPGL  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  342  APSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  402  NLRPLSAYGPWYLDGQVGGWSQQYAGLKFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  461



>ref|XP_006286217.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
 gb|EOA19115.1| hypothetical protein CARUB_v10007783mg [Capsella rubella]
Length=479

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 135/186 (73%), Gaps = 1/186 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R      +R  YDPCTE+H+ +YFNLPEVQ+ALHV    
Sbjct  283  YSVFTPACLSNASQSNMLLKKRTM-TSRVREQYDPCTEKHTKVYFNLPEVQRALHVPPGL  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCSD V + W D  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  342  APSKWDTCSDVVNEHWNDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++G  +
Sbjct  402  NLRPLSAYGPWYSDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALELFKAFISGAPL  461

Query  141  PGLQRI  124
               + I
Sbjct  462  STHENI  467



>dbj|BAK06862.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=228

 Score =   218 bits (556),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 130/187 (70%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS++T  C  S S+          K+GL      L R YDPCTER+S IY+NLPEVQ AL
Sbjct  50   YSLYTKPCNSSASL----------KLGLGGRYPWLSRAYDPCTERYSNIYYNLPEVQTAL  99

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +Y ELI AG+RIWVFSGDTDAV+P+T+TR
Sbjct  100  HANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSGDTDAVVPITATR  159

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ AL L   F
Sbjct  160  YSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQALILFRHF  219

Query  159  LAGTSMP  139
            L  T MP
Sbjct  220  LKDTPMP  226



>ref|XP_003560871.1| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=482

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/190 (57%), Positives = 135/190 (71%), Gaps = 8/190 (4%)
 Frame = -3

Query  681  YSIFTPTCTESFSIM---SRVLKRRDRKVG----LLRRIYDPCTERHSTIYFNLPEVQKA  523
            YSI+TPTC  + S +   S V+ RR    G    +    YDPCTER+ST Y+N PEVQKA
Sbjct  285  YSIYTPTCNTNASALPTPSSVVSRRQHPKGRYPWMTGGSYDPCTERYSTAYYNRPEVQKA  344

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            LH + T  ++ W  CSD +   W D P ++L +Y+E+I AGLRIWVFSGDTD+V+P T+T
Sbjct  345  LHANVTGINYAWAACSDTINGNWSDSPRSMLSIYKEIIQAGLRIWVFSGDTDSVVPSTAT  404

Query  342  RYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVE  166
            RYSIDAL LPT + W PWYD+ Q VGGW+Q YEGLT V VRGAGH+VALHRP+ AL L +
Sbjct  405  RYSIDALVLPTTTDWYPWYDDNQEVGGWSQVYEGLTLVTVRGAGHEVALHRPRQALILFQ  464

Query  165  SFLAGTSMPG  136
            +FL G  MPG
Sbjct  465  NFLQGKPMPG  474



>ref|XP_010438130.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=498

 Score =   225 bits (574),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S  + +LK+R    G +   YDPCTE+H+ +YFNLPEVQKALHV    
Sbjct  302  YSVFTPACVANASQSNMLLKKRPI-TGRVSEQYDPCTEKHTKVYFNLPEVQKALHVPPGL  360

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  361  APSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  420

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  421  NLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  480



>ref|XP_009592854.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana tomentosiformis]
Length=456

 Score =   224 bits (571),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 132/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C  + S     L+R  R     + R YDPCTER+S IYFNLPEVQKA H + T
Sbjct  279  YSIYTRPCASTSS-----LRRNLRGHYPWMSRAYDPCTERYSEIYFNLPEVQKAFHANVT  333

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCSD V ++W D P ++L +YQELI AGLRIWVFSGDTD+V+PVT+TRYSIDA
Sbjct  334  KVAYPWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVFSGDTDSVVPVTATRYSIDA  393

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PWYDN +VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L+ SFL    
Sbjct  394  LKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFILLRSFLENKP  453

Query  144  MP  139
            MP
Sbjct  454  MP  455



>gb|KHG25905.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=470

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/182 (59%), Positives = 133/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C ++ S     L+R  R     + R +DPCTER+S  YFN PEVQKALH + T
Sbjct  279  YSIFTQPCADTTS-----LRRNLRGHYPWMSRAFDPCTERYSKEYFNRPEVQKALHANVT  333

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               ++W TCSD +   W D P ++L +YQELI AG+RIWV+SGDTDAV+PVT+TRYSIDA
Sbjct  334  GIPYQWETCSDVIGYNWTDSPLSMLPIYQELIAAGIRIWVYSGDTDAVVPVTATRYSIDA  393

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PWY+NG+VGGW+QEY+GLTFV V GAGH+V LHRP+ A  L  SFL   S
Sbjct  394  LKLPTINKWHPWYENGKVGGWSQEYKGLTFVTVTGAGHEVPLHRPRQAFILFRSFLENKS  453

Query  144  MP  139
            MP
Sbjct  454  MP  455



>ref|XP_009802382.1| PREDICTED: serine carboxypeptidase-like 27 [Nicotiana sylvestris]
Length=456

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 133/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C  + S     L+R  R     + R YDPCTER+S +YFNLPEVQKA H + T
Sbjct  279  YSIYTRPCASTSS-----LRRNLRGHYPWMSRAYDPCTERYSEVYFNLPEVQKAFHANVT  333

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCSD V ++W D P ++L +YQELI+AGLRIWVFSGDTD+V+PVT+TRYSIDA
Sbjct  334  KVAYPWKTCSDIVGNYWADSPLSMLPIYQELISAGLRIWVFSGDTDSVVPVTATRYSIDA  393

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PWYDN +VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L+ SFL    
Sbjct  394  LKLPTITNWYPWYDNKKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFILLRSFLENKP  453

Query  144  MP  139
            MP
Sbjct  454  MP  455



>ref|XP_011040963.1| PREDICTED: serine carboxypeptidase-like 27 [Populus euphratica]
Length=460

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 130/182 (71%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + ++   +          + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  280  YSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSKVYFNRPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCS+ V D+W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  336  IPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y GLTFV V GAGH+V LHRP+ A  L  SFL   SM
Sbjct  396  KLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLHRPRQAFILFMSFLGNKSM  455

Query  141  PG  136
            PG
Sbjct  456  PG  457



>ref|NP_001042076.1| Os01g0158200 [Oryza sativa Japonica Group]
 dbj|BAD61439.1| putative carboxypeptidase D [Oryza sativa Japonica Group]
 dbj|BAF03990.1| Os01g0158200 [Oryza sativa Japonica Group]
 gb|EAZ10621.1| hypothetical protein OsJ_00453 [Oryza sativa Japonica Group]
 dbj|BAG92359.1| unnamed protein product [Oryza sativa Japonica Group]
Length=471

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++ S + R L R +     L R YDPCTE++ST Y+NLPEVQKA H + T 
Sbjct  285  YSIYTPTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTG  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  342  IPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  402  YLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPM  461

Query  141  P  139
            P
Sbjct  462  P  462



>gb|KHN17121.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=459

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++T  C  + S + R LK R      + R YDPCTER+S +YFN PEVQKA H + T 
Sbjct  280  YSVYTRPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDLYFNRPEVQKAFHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V ++W D P ++L +Y+ELI+AGLRIWV+SGDTDAV+P+T+TRYSIDAL
Sbjct  336  IPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSGDTDAVVPMTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGH+V LHRP+ A  L  SFL   SM
Sbjct  396  KLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAFILFRSFLENKSM  455

Query  141  P  139
            P
Sbjct  456  P  456



>ref|XP_006589433.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=460

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++T  C  + S + R LK R      + R YDPCTER+S +YFN PEVQKA H + T 
Sbjct  281  YSVYTRPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDLYFNRPEVQKAFHANVTG  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V ++W D P ++L +Y+ELI+AGLRIWV+SGDTDAV+P+T+TRYSIDAL
Sbjct  337  IPYAWKACSDIVGNYWTDSPLSMLPIYRELISAGLRIWVYSGDTDAVVPMTATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYDNG+VGGW+Q Y+GLT V VRGAGH+V LHRP+ A  L  SFL   SM
Sbjct  397  KLPTIINWYPWYDNGKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAFILFRSFLENKSM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_004496292.1| PREDICTED: serine carboxypeptidase-like 27-like isoform X1 [Cicer 
arietinum]
Length=462

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C ++ S + R L  R      + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  282  YSIYTPPCNDTAS-LRRGLNGR---YPWMSRAYDPCTERYSDLYFNRPEVQKALHANVTG  337

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V ++W D P ++L +YQELI A LRIWV+SGDTDAV+P+T+TR+SIDAL
Sbjct  338  ISYPWKTCSDIVGNYWTDSPLSMLPIYQELINASLRIWVYSGDTDAVVPLTATRHSIDAL  397

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLTFV VRGAGH+V LHRP+ +  L  SFL    M
Sbjct  398  KLPTIINWYPWYDSGKVGGWSQVYKGLTFVTVRGAGHEVPLHRPRESFILFRSFLENKYM  457

Query  141  P  139
            P
Sbjct  458  P  458



>ref|XP_010541227.1| PREDICTED: serine carboxypeptidase-like 29 [Tarenaya hassleriana]
Length=346

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 132/187 (71%), Gaps = 1/187 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            Y +FTPTC  + S    +LK+R    G +   YDPCTE+HS +YFN PEVQKALHV    
Sbjct  144  YIVFTPTCPANVSQSKLLLKKRP-IFGRVSEEYDPCTEKHSRVYFNPPEVQKALHVPPEF  202

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W  CSD V + W D P +VL++Y ELI  GLRIWVFSGD DAV+PVT+TRYSI+AL
Sbjct  203  APSKWDICSDTVSEHWNDSPPSVLNIYHELIAVGLRIWVFSGDADAVVPVTATRYSIEAL  262

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +SPW  WY +GQV GWTQ+Y GL FV VRGAGH+V LHRPK +L L ++F++G  +
Sbjct  263  NLRPLSPWYSWYMDGQVAGWTQQYAGLNFVTVRGAGHEVPLHRPKQSLELFKAFVSGNPL  322

Query  141  PGLQRIS  121
            P  ++ S
Sbjct  323  PTSEKNS  329



>gb|KJB76568.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=304

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C ++    S +          + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  127  YSIFTQPCKDT----STLRHNMRGHYPWMSRAYDPCTERYSKVYFNRLEVQKALHANVTA  182

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  183  LSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  242

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  243  KLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLM  302

Query  141  P  139
            P
Sbjct  303  P  303



>dbj|BAB08188.1| unnamed protein product [Oryza sativa Japonica Group]
Length=490

 Score =   224 bits (570),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 114/225 (51%), Positives = 146/225 (65%), Gaps = 19/225 (8%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++ S + R L R +     L R YDPCTE++ST Y+NLPEVQKA H + T 
Sbjct  285  YSIYTPTCKKT-SFLKRRLIRGNSP--WLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTG  341

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  342  IPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDAL  401

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  402  YLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPM  461

Query  141  PGLQRISDS*LFSPHGEERE*NG*QLLCYDV*CSCRKLVLDCCRH  7
            P  +  ++             N     CY   C C  L LD   H
Sbjct  462  PQPEYTAE-------------NLTNESCY---CYCLVLALDQPEH  490



>ref|XP_007219592.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
 gb|EMJ20791.1| hypothetical protein PRUPE_ppa023509mg, partial [Prunus persica]
Length=397

 Score =   221 bits (563),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 129/180 (72%), Gaps = 4/180 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + S+   +          + R YDPCTER+S +YFN PEVQ+A H + T 
Sbjct  220  YSIFTRPCNSTESLKHNLRGHYP----WMSRAYDPCTERYSEVYFNHPEVQRAFHANVTG  275

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V  +W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  276  ISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  335

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT++ W PWYDNG+VGGW Q Y+GLTFV V GAGH+V LHRP+ A  + +SFL G  M
Sbjct  336  KLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLHRPRQAFIVFKSFLEGKPM  395



>ref|XP_002457308.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
 gb|EES02428.1| hypothetical protein SORBIDRAFT_03g005370 [Sorghum bicolor]
Length=467

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 135/181 (75%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++TPTC ++  +  R ++ R   +  L R YDPCTE + T Y+NLPEVQ+A H + T 
Sbjct  281  YSLYTPTCKKTSLLKRRQIRGR---MPWLPRGYDPCTELYFTKYYNLPEVQEAFHANVTG  337

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W+ CSD VY++W+D P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  338  IPYAWIGCSDPVYEYWQDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDAL  397

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT++ W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP+  L L+E FL G  M
Sbjct  398  SLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPRQGLKLLEHFLQGEPM  457

Query  141  P  139
            P
Sbjct  458  P  458



>tpg|DAA53383.1| TPA: hypothetical protein ZEAMMB73_784297 [Zea mays]
Length=340

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 131/181 (72%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R+++ R   +  L R YDPCTE + T Y NLPEVQ A H + T 
Sbjct  154  YSIYTPTCKKTSLQKRRLIRGR---MPWLPRGYDPCTELYITKYCNLPEVQDAFHANVTG  210

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  211  IPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDAL  270

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT++ W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP   L L E FL G  M
Sbjct  271  SLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGLKLFEHFLRGEPM  330

Query  141  P  139
            P
Sbjct  331  P  331



>ref|XP_006410747.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
 gb|ESQ52200.1| hypothetical protein EUTSA_v10016650mg [Eutrema salsugineum]
Length=449

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 134/181 (74%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S+ YFN PEVQKA+H +TT
Sbjct  272  YSIYTITCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSSTYFNSPEVQKAMHANTT  328

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              +++W TCSD V + W D P ++L +Y+ELI AG+RIWVFSGDTD+V+PVT TRYSI A
Sbjct  329  GLAYQWKTCSDIVGEKWSDSPLSMLPIYKELIAAGIRIWVFSGDTDSVVPVTGTRYSIRA  388

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLP VS W PWYDNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFLA   
Sbjct  389  LKLPPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFKSFLANKP  448

Query  144  M  142
            M
Sbjct  449  M  449



>ref|XP_007143689.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
 gb|ESW15683.1| hypothetical protein PHAVU_007G093300g [Phaseolus vulgaris]
Length=459

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/181 (59%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++T  C  + S + R LK R      + R YDPCTER+S  YFN PEVQKA H + T 
Sbjct  281  YSVYTQPCNNTAS-LRRGLKGR---YPWMSRAYDPCTERYSDSYFNRPEVQKAFHANVTG  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              +EW  CSD V ++W D P ++L +YQELI AG RIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  337  IPYEWKACSDIVGNYWTDSPLSMLPIYQELIRAGYRIWVYSGDTDAVVPVTATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLT V VRGAGH+V LHRP+ A  L  SFL   SM
Sbjct  397  KLPTIINWYPWYDSGKVGGWSQVYKGLTMVTVRGAGHEVPLHRPREAFILFSSFLQNKSM  456

Query  141  P  139
            P
Sbjct  457  P  457



>gb|EEC69980.1| hypothetical protein OsI_00486 [Oryza sativa Indica Group]
Length=474

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 134/181 (74%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++ S + R L R +  +  L R YDPCTE++S  Y+NLPEVQKA H + T 
Sbjct  288  YSIYTPTCKKT-SFLKRRLIRGN--LPWLPRGYDPCTEKYSMKYYNLPEVQKAFHANVTG  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD+++ +WKD P ++L +Y+ELI AGLRIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  345  IPYAWTTCSDDLFYYWKDSPRSMLPIYRELIAAGLRIWVFSGDADSVVPLTATRYSIDAL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD+ +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  405  YLPTVTNWYPWYDDEEVAGWCQVYQGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPM  464

Query  141  P  139
            P
Sbjct  465  P  465



>emb|CAN74854.1| hypothetical protein VITISV_028701 [Vitis vinifera]
Length=452

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 132/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C ++ S     L+R+ R     + R YDPCTER+S +YFNLPEVQ ALH + T
Sbjct  275  YSIFTRPCNDTSS-----LRRKLRGHYPWMSRAYDPCTERYSEVYFNLPEVQTALHANVT  329

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCS+ V  +W D P ++L +YQELI AGLRIWVFSGDTDAV+PVT+TRYSIDA
Sbjct  330  QVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVVPVTATRYSIDA  389

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W  WYDN +VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L  SFL    
Sbjct  390  LKLPTITNWYXWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAYILFRSFLENKP  449

Query  144  MP  139
            MP
Sbjct  450  MP  451



>ref|XP_006350225.1| PREDICTED: serine carboxypeptidase-like 27-like [Solanum tuberosum]
Length=456

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 131/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  S + + R L+        + R YDPCTER+S +YFNLPEVQKA H + T 
Sbjct  279  YSIYTRPCA-STNALHRNLRGH---YPWMSRAYDPCTERYSDVYFNLPEVQKAFHANVTK  334

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             ++ W TCSD V D+W D P ++L +YQELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  335  IAYPWKTCSDIVGDYWDDSPLSMLPIYQELIAAGLRIWVFSGDTDSVVPLTATRYSIDAL  394

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT++ W PWYDN +VGGW+Q Y+GLT V + GAGH+V LHRP+ A  L  SFL    M
Sbjct  395  KLPTITNWYPWYDNKKVGGWSQLYKGLTLVTITGAGHEVPLHRPRQAFILFRSFLENKPM  454

Query  141  P  139
            P
Sbjct  455  P  455



>ref|XP_004968264.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=463

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 129/181 (71%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R+++ R      L R YDPCT ++ST Y+NLPEVQKALH + T 
Sbjct  277  YSIYTPTCKKTSLHRHRLIRGR---TPWLPRGYDPCTTQYSTKYYNLPEVQKALHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WV CSD +Y +WKD P ++L +Y+ELI AG RIWVFSGD DAV+P+  TRYSIDAL
Sbjct  334  IPYAWVACSDPIYKYWKDSPRSMLPIYRELIAAGKRIWVFSGDADAVVPLPGTRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT+S W  WYD G+VGGW Q Y+GLT V +RGAGH+V LHRP+L L L E FL    M
Sbjct  394  FLPTISNWYAWYDQGEVGGWCQVYKGLTLVTIRGAGHEVPLHRPRLGLKLFEHFLRDEPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>ref|XP_003564543.1| PREDICTED: serine carboxypeptidase-like 27 [Brachypodium distachyon]
Length=451

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 131/187 (70%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS++T  C  S S+          K+GL      L R YDPCTER++ +Y+NLPEVQ AL
Sbjct  273  YSLYTKPCNNSASL----------KLGLGGRYPWLSRAYDPCTERYANVYYNLPEVQMAL  322

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TR
Sbjct  323  HANTTGIQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVVPVTATR  382

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ AL L   F
Sbjct  383  YSIKALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQALILFRHF  442

Query  159  LAGTSMP  139
            L  T MP
Sbjct  443  LKDTPMP  449



>gb|AAV43957.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
Length=483

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 133/184 (72%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERHSTIYFNLPEVQKALHVH  511
            YS++TPTC E+ S  S   ++R  K G    +   YDPCTER+ST Y+N PEVQ+ALH +
Sbjct  291  YSLYTPTCNET-STSSAAARQRRLKQGHYPWMTGSYDPCTERYSTEYYNRPEVQRALHAN  349

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T  ++ W TCSD + D W+D P +VL +Y ELI AGLRIWVFSGDTDAV+P+T+TRYSI
Sbjct  350  VTGINYTWATCSDILNDNWRDSPRSVLPIYHELIAAGLRIWVFSGDTDAVVPLTATRYSI  409

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
            DAL LPT   W PWYD  +VGGW+Q Y+GL+ V VRGAGH+V LHRP+ AL L + FL G
Sbjct  410  DALGLPTTVSWYPWYDAMKVGGWSQVYKGLSLVTVRGAGHEVPLHRPRQALILFKHFLQG  469

Query  150  TSMP  139
              MP
Sbjct  470  KPMP  473



>ref|XP_002274723.1| PREDICTED: serine carboxypeptidase-like 27 [Vitis vinifera]
 emb|CBI31485.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 131/182 (72%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C ++ S     L+R  R     + R YDPCTER+S +YFNLPEVQ ALH + T
Sbjct  279  YSIFTRPCNDTSS-----LRRNLRGHYPWMSRAYDPCTERYSEVYFNLPEVQTALHANVT  333

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCS+ V  +W D P ++L +YQELI AGLRIWVFSGDTDAV+PVT+TRYSIDA
Sbjct  334  QVSYPWRTCSNIVGIYWADSPLSMLPIYQELIAAGLRIWVFSGDTDAVVPVTATRYSIDA  393

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W  WYDN +VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L  SFL    
Sbjct  394  LKLPTITNWYAWYDNHKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAYILFRSFLENKP  453

Query  144  MP  139
            MP
Sbjct  454  MP  455



>gb|EAY76388.1| hypothetical protein OsI_04319 [Oryza sativa Indica Group]
Length=454

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS++T  C  + S+          K+GL      L R YDPCTER+S+IY+N PEVQ A+
Sbjct  276  YSLYTKPCNNTASL----------KLGLGGRYPWLSRAYDPCTERYSSIYYNRPEVQIAM  325

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TR
Sbjct  326  HANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVVPVTATR  385

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGH+V LHRP+ AL L   F
Sbjct  386  YSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPREALILFRHF  445

Query  159  LAGTSMP  139
            L  T MP
Sbjct  446  LQNTPMP  452



>ref|XP_008805039.1| PREDICTED: serine carboxypeptidase-like 27 [Phoenix dactylifera]
Length=461

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 133/181 (73%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C +S S + R L+ R      + R YDPCT+R++ +Y+N PEVQ+ALH + T 
Sbjct  284  YSIYTSPCNDS-SALKRNLRGR---YPWMSRAYDPCTDRYAKVYYNRPEVQRALHANVTG  339

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TRYSIDAL
Sbjct  340  IHYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAVVPVTATRYSIDAL  399

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLTFV + GAGH+V LHRP+ AL L   FL    M
Sbjct  400  KLPTLLRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQALILFRHFLQNKPM  459

Query  141  P  139
            P
Sbjct  460  P  460



>ref|NP_001044713.1| Os01g0833500 [Oryza sativa Japonica Group]
 dbj|BAD73778.1| putative serine carboxypeptidase II [Oryza sativa Japonica Group]
 dbj|BAF06627.1| Os01g0833500 [Oryza sativa Japonica Group]
 gb|EAZ14049.1| hypothetical protein OsJ_03974 [Oryza sativa Japonica Group]
 dbj|BAG93392.1| unnamed protein product [Oryza sativa Japonica Group]
Length=454

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/187 (57%), Positives = 132/187 (71%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS++T  C  + S+          K+GL      L R YDPCTER+S+IY+N PEVQ A+
Sbjct  276  YSLYTKPCNNTASL----------KLGLGGRYPWLSRAYDPCTERYSSIYYNRPEVQIAM  325

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TR
Sbjct  326  HANTTGIQYSWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVVPVTATR  385

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGH+V LHRP+ AL L   F
Sbjct  386  YSIDALKLPTMVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPREALILFRHF  445

Query  159  LAGTSMP  139
            L  T MP
Sbjct  446  LQNTPMP  452



>ref|XP_003591949.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 ref|XP_003638560.1| Serine carboxypeptidase-like protein [Medicago truncatula]
Length=461

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 131/183 (72%), Gaps = 6/183 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T 
Sbjct  280  YSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNRPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  336  IPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQ--VGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
            KLPT+  W PWYD+G+  VGGW+Q Y+GLT V +RGAGH+V LH+P+ A  L  SFL   
Sbjct  396  KLPTIINWYPWYDSGKVGVGGWSQVYKGLTLVTIRGAGHEVPLHKPREAFILFRSFLENK  455

Query  147  SMP  139
             MP
Sbjct  456  DMP  458



>ref|XP_002315292.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
 gb|EEF01463.2| serine carboxypeptidase S10 family protein [Populus trichocarpa]
Length=460

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 129/182 (71%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + ++   +          + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  280  YSIFTQPCNNTAALRHNLRGHYP----WMSRAYDPCTERYSKVYFNRPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCS+ V D+W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  336  IPYPWETCSNIVGDYWADSPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y GLTFV V GAGH+V L RP+ A  L  SFL   SM
Sbjct  396  KLPTIINWYPWYDSGKVGGWSQVYTGLTFVTVTGAGHEVPLRRPRQAFILFMSFLGNKSM  455

Query  141  PG  136
            PG
Sbjct  456  PG  457



>ref|XP_008233341.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
 ref|XP_008233342.1| PREDICTED: serine carboxypeptidase-like 27 [Prunus mume]
Length=455

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 128/180 (71%), Gaps = 4/180 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + S+   +          + R YDPCTER+S +YFN PEVQ+A H + T 
Sbjct  278  YSIFTRPCNSTESLKHNLRGHYP----WMSRAYDPCTERYSEVYFNHPEVQRAFHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V  +W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  334  ISYPWQTCSDIVGTYWADSPLSMLPIYRELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT++ W PWYDNG+VGGW Q Y+GLTFV V GAGH+V LHRP+ A  +  SFL G  M
Sbjct  394  KLPTITNWSPWYDNGKVGGWNQIYKGLTFVTVTGAGHEVPLHRPRQAFIVFRSFLEGKPM  453



>ref|XP_003591947.1| Serine carboxypeptidase-like protein [Medicago truncatula]
 gb|AES62198.1| serine carboxypeptidase-like protein [Medicago truncatula]
Length=458

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI TP C  + S+ S +  R       + R YDPC ER+S +YFN PEVQKALH + T 
Sbjct  280  YSINTPPCNNTASLRSGLHDRYP----WMYRAYDPCAERYSDVYFNRPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W  CS  V+D+W D P ++L +YQELI A LRIWV+SGDTDAVIP+T+TRYSI AL
Sbjct  336  ISYAWKACSGTVWDYWTDSPLSMLPIYQELINADLRIWVYSGDTDAVIPLTATRYSIGAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYDNG+V GW+Q Y+GLT V VRGAGH+V LHRP+ A  L  SFL   +M
Sbjct  396  KLPTIMNWYPWYDNGKVCGWSQVYKGLTLVTVRGAGHEVPLHRPREAFILFRSFLENKNM  455

Query  141  P  139
            P
Sbjct  456  P  456



>gb|ABK21145.1| unknown [Picea sitchensis]
Length=343

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRD-RKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+TP+C  S S   ++      R  G     YDPCTE +S +YFN PEVQKA H + T
Sbjct  158  YSIYTPSCNISGSQRHKLRSHHPWRSYG-----YDPCTESYSALYFNRPEVQKAFHANVT  212

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
            + S+ W TCSD +  +W+D P ++L +YQEL+ AG+RIWVFSGDTDAV+PVT+TRYSIDA
Sbjct  213  SISYSWTTCSDILEKYWQDSPRSMLPIYQELLRAGIRIWVFSGDTDAVVPVTATRYSIDA  272

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L+L T+  W PWYDN +VGGWTQ Y+GLT V +RGAGH+V LH+P+ A  L ++FL G  
Sbjct  273  LRLRTIVNWYPWYDNQEVGGWTQIYKGLTLVTIRGAGHEVPLHQPRKAFILFKAFLKGKP  332

Query  144  MP  139
            MP
Sbjct  333  MP  334



>ref|XP_006655142.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 2-like 
[Oryza brachyantha]
Length=469

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 131/192 (68%), Gaps = 3/192 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVG---LLRRIYDPCTERHSTIYFNLPEVQKALHVH  511
            YS++TPTC E+ S  +R  ++R  K G    +   YDPCTE +ST Y+N PEVQ ALH +
Sbjct  273  YSLYTPTCNETSSPAARARQQRRLKRGHYPWMTGSYDPCTEIYSTAYYNRPEVQTALHAN  332

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T  ++ W TCSD + + W+D P TVL +Y ELI AGLRIWVFSGDTDAV+P+T TRYSI
Sbjct  333  VTGINYTWATCSDILNNNWRDSPRTVLPIYHELIAAGLRIWVFSGDTDAVVPLTGTRYSI  392

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
            DAL LPT   W PWYD  +VGGW+Q Y+GLT V VRGAGH+V LHRP+ A  L   FL G
Sbjct  393  DALGLPTTINWYPWYDAIKVGGWSQVYKGLTLVTVRGAGHEVPLHRPRQAFILFNHFLKG  452

Query  150  TSMPGLQRISDS  115
              MP    I  +
Sbjct  453  KPMPNAPTIKSA  464



>ref|XP_010908844.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=462

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 133/181 (73%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C +S S + R LK R      + R YDPCT+R++ +Y+N PEVQ+ALH + T 
Sbjct  285  YSIYTRPCNDS-SALKRNLKGR---YPWMSRAYDPCTDRYAKVYYNRPEVQRALHANVTG  340

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TRYSIDAL
Sbjct  341  IRYAWDTCSDIVGNYWADSPRSMLPIYQELIAAGVRIWVFSGDTDAVVPVTATRYSIDAL  400

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            +LPT+  W PWYD+G+VGGW+Q Y+GLTFV + GAGH+V LHRP+ AL L   FL    M
Sbjct  401  ELPTLRRWYPWYDHGKVGGWSQVYKGLTFVTITGAGHEVPLHRPRQALILFRHFLQNKPM  460

Query  141  P  139
            P
Sbjct  461  P  461



>dbj|BAJ99174.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=444

 Score =   219 bits (559),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++T  C  S S+   +  R       L R YDPCTER+S IY+NLPEVQ ALH +TT 
Sbjct  266  YSLYTKPCNSSASLKLGLGGRYP----WLSRAYDPCTERYSNIYYNLPEVQTALHANTTG  321

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V  +W D P ++L +Y ELI AG+RIWVFSGDTDAV+P+T+TRYSI AL
Sbjct  322  IKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIRIWVFSGDTDAVVPITATRYSISAL  381

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ AL L   FL  T M
Sbjct  382  KLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQALILFRHFLKDTPM  441

Query  141  P  139
            P
Sbjct  442  P  442



>gb|KDO48447.1| hypothetical protein CISIN_1g012819mg [Citrus sinensis]
Length=456

 Score =   220 bits (560),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 130/182 (71%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C  + S     L+R  R     + R YDPCTER+S +YFN PEVQKALH + T
Sbjct  279  YSIFTRPCNGTAS-----LRRNLRGHYPWMSRAYDPCTERYSEVYFNHPEVQKALHANVT  333

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCS+ V D W D P ++L +Y+ELI AGL+IWVFSGDTDAV+PVT+TRYSIDA
Sbjct  334  GISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFSGDTDAVVPVTATRYSIDA  393

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPTV  W PWYDN +VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L  SFL    
Sbjct  394  LKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAFILFRSFLENKP  453

Query  144  MP  139
            MP
Sbjct  454  MP  455



>ref|XP_010432944.1| PREDICTED: serine carboxypeptidase-like 29 [Camelina sativa]
Length=480

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C    S  + +LK+R    G +   YDPCTE+H+ +YFNLPEVQKALHV    
Sbjct  284  YSVFTPACVAKASQSNMLLKKRPI-TGRVSEQYDPCTEKHTKVYFNLPEVQKALHVPPGL  342

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS+ V   WKD  ++VL++Y ELI AGLRIWVFSGD DAV+PVTSTR+SIDAL
Sbjct  343  APSKWDTCSNVVNGHWKDSSSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRHSIDAL  402

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY + QVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  403  NLHPLSVYGPWYLDEQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  462



>ref|XP_008381976.1| PREDICTED: serine carboxypeptidase-like 27 [Malus domestica]
Length=455

 Score =   219 bits (558),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 132/182 (73%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C  + S     LKR  R     + R YDPCTER+S +YFN P+VQKALH + T
Sbjct  278  YSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHANVT  332

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTD+V+PVT+TRYSIDA
Sbjct  333  KVSYPWQTCSDXVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDSVVPVTATRYSIDA  392

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PW DNG+VGG +Q Y+GLTFV V GAGH+V LHRP+LA  L  SFL    
Sbjct  393  LKLPTITNWFPWNDNGKVGGRSQIYKGLTFVTVTGAGHEVPLHRPRLAFILFRSFLESKP  452

Query  144  MP  139
            MP
Sbjct  453  MP  454



>ref|XP_004236634.1| PREDICTED: serine carboxypeptidase-like 27 [Solanum lycopersicum]
Length=456

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  S + + R L+        + R YDPCTER+S +YFNLPEVQKA H + T 
Sbjct  279  YSIYTRPCA-STNALHRNLRGH---YPWMSRAYDPCTERYSDVYFNLPEVQKAFHANVTK  334

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             ++ W TCSD V D+W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  335  IAYPWKTCSDIVGDYWDDSPLSMLPIYHELIAAGLRIWVFSGDTDSVVPLTATRYSIDAL  394

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT++ W PWYDN +VGGW+Q Y+GLT V + GAGH+V LHRP+ A  L  SFL    M
Sbjct  395  KLPTITNWYPWYDNKKVGGWSQIYKGLTLVTITGAGHEVPLHRPRQAFILFRSFLENKPM  454

Query  141  P  139
            P
Sbjct  455  P  455



>ref|XP_004307401.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469671.1| PREDICTED: serine carboxypeptidase-like 27 [Fragaria vesca subsp. 
vesca]
Length=458

 Score =   219 bits (558),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C+ +       LKR  R     + R YDPCTER+S  YFN PEVQKALH + T
Sbjct  281  YSIFTRPCSSA-----AALKRNLRGHYPWMSRAYDPCTERYSEKYFNHPEVQKALHANVT  335

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V ++W D P ++L +YQELI AGL+IWV+SGDTDAV+PVT+TRYSIDA
Sbjct  336  GLSYPWKTCSDFVGNYWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAVVPVTATRYSIDA  395

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PW D+G+VGGW+Q Y+GLT V + GAGH+V LHRP+ A  L +SFL    
Sbjct  396  LKLPTINNWSPWSDSGKVGGWSQIYKGLTLVTITGAGHEVPLHRPREAFILFKSFLENKP  455

Query  144  MP  139
            MP
Sbjct  456  MP  457



>tpg|DAA53384.1| TPA: serine carboxypeptidase K10B2.2 [Zea mays]
Length=474

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++ S+  R L R   ++  L R YDPCTE + T Y NLPEVQ A H + T 
Sbjct  288  YSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLPEVQDAFHANVTG  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  345  IPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDAL  404

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT++ W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP   L L E FL G  M
Sbjct  405  SLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGLKLFEHFLRGEPM  464

Query  141  P  139
            P
Sbjct  465  P  465



>gb|KJB76569.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=451

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C ++ ++   +          + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  274  YSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSKVYFNRLEVQKALHANVTA  329

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  330  LSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  389

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  390  KLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLM  449

Query  141  P  139
            P
Sbjct  450  P  450



>gb|KJB76563.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=452

 Score =   219 bits (557),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C ++ ++   +          + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  275  YSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSKVYFNRLEVQKALHANVTA  330

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  331  LSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  390

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV  W PWYDNG+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  391  KLPTVINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLM  450

Query  141  P  139
            P
Sbjct  451  P  451



>ref|NP_001150676.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
 gb|ACG39970.1| serine carboxypeptidase K10B2.2 precursor [Zea mays]
Length=484

 Score =   219 bits (559),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++ S+  R L R   ++  L R YDPCTE + T Y NLPEVQ A H + T 
Sbjct  298  YSIYTPTCKKT-SLQKRRLIRG--RMPWLPRGYDPCTELYITKYCNLPEVQDAFHANVTG  354

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + WV CSD +Y++WKD P ++L +Y+ELI+AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  355  IPYAWVGCSDPIYEYWKDSPRSMLPIYRELISAGLRIWVFSGDTDSVVPLTATRYSIDAL  414

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT++ W PWY + +VGGW Q YEGLT V VRGAGH+V LHRP   L L E FL G  M
Sbjct  415  SLPTITKWYPWYYDEEVGGWCQVYEGLTLVTVRGAGHEVPLHRPPQGLKLFEHFLRGEPM  474

Query  141  P  139
            P
Sbjct  475  P  475



>gb|EMS47606.1| Serine carboxypeptidase-like 27 [Triticum urartu]
Length=470

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 130/187 (70%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS++T  C  S S+          K+GL      L R YDPCTER+S IY+NLPEVQ AL
Sbjct  292  YSLYTKPCNSSASL----------KLGLGGRYPWLSRAYDPCTERYSNIYYNLPEVQAAL  341

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +Y ELI AG++IWVFSGDTDAV+PVT+TR
Sbjct  342  HANTTGIKYPWKTCSDIVGSYWADSPRSMLPIYHELIAAGIKIWVFSGDTDAVVPVTATR  401

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSI ALKLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ AL L   F
Sbjct  402  YSISALKLPTLMNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQALILFRHF  461

Query  159  LAGTSMP  139
            L  T MP
Sbjct  462  LKDTPMP  468



>gb|KHG08205.1| Serine carboxypeptidase-like 27 [Gossypium arboreum]
Length=452

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C ++ ++   +          + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  275  YSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSKVYFNRLEVQKALHANVTA  330

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W TCSD V ++W D P ++L +Y+ELI AGLRIWV+SGDTDAV+PVT+TRYSIDAL
Sbjct  331  LSYPWQTCSDIVGNYWTDAPLSMLPIYKELIAAGLRIWVYSGDTDAVVPVTATRYSIDAL  390

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYDNG+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  391  KLPTIINWYPWYDNGKVGGWSQAYKGLTLVTVTGAGHEVPLHRPRQAFILFRSFLENKLM  450

Query  141  P  139
            P
Sbjct  451  P  451



>ref|XP_006644961.1| PREDICTED: serine carboxypeptidase-like 27-like [Oryza brachyantha]
Length=455

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/181 (57%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++T  C  + S+   +  R       L R YDPCTER+S IY+N PEVQ A+H +TT 
Sbjct  277  YSLYTKPCNNTASLKLGLGGRYP----WLSRAYDPCTERYSNIYYNRPEVQIAMHANTTG  332

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V  +W D P ++L +YQELI AG+RIWVFSGDTDAV+PVT+TRYSIDAL
Sbjct  333  IQYPWKTCSDIVGSYWADSPKSMLPIYQELIAAGIRIWVFSGDTDAVVPVTATRYSIDAL  392

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ AL L   FL    M
Sbjct  393  KLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPREALILFRHFLQNIPM  452

Query  141  P  139
            P
Sbjct  453  P  453



>ref|XP_006436271.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
 ref|XP_006485878.1| PREDICTED: serine carboxypeptidase-like 27-like [Citrus sinensis]
 gb|ESR49511.1| hypothetical protein CICLE_v10031497mg [Citrus clementina]
Length=456

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 130/182 (71%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C  + S     L+R  R     + R YDPCTER+S +YFN PEVQKALH + T
Sbjct  279  YSIFTRPCNGTAS-----LRRNLRGHYPWMSRAYDPCTERYSEVYFNHPEVQKALHANVT  333

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCS+ V D W D P ++L +Y+ELI AGL+IWVFSGDTDAV+PVT+TRYSIDA
Sbjct  334  WISYPWRTCSEIVGDNWTDSPLSMLPIYKELIAAGLKIWVFSGDTDAVVPVTATRYSIDA  393

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPTV  W PWYDN +VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L  SFL    
Sbjct  394  LKLPTVINWYPWYDNRKVGGWSQVYKGLTFVTVTGAGHEVPLHRPRQAFILFRSFLENKP  453

Query  144  MP  139
            MP
Sbjct  454  MP  455



>sp|P55747.1|CBP21_HORVU RecName: Full=Serine carboxypeptidase II-1; AltName: Full=CP-MII.1; 
Contains: RecName: Full=Serine carboxypeptidase II-1 
chain A; Contains: RecName: Full=Serine carboxypeptidase II-1 
chain B; Flags: Precursor, partial [Hordeum vulgare]
 gb|AAB31591.1| CP-MII.1=serine carboxypeptidase [Hordeum vulgare=barley, cv. 
Alexis, aleurone, Peptide, 324 aa]
 emb|CAB58992.1| serine carboxypeptidase II-1 [Hordeum vulgare subsp. vulgare]
Length=324

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R++K R      L R YDPCTE++ST Y+NLPEVQKA   + T 
Sbjct  138  YSIYTPTCKKTSLHRRRLIKGRR---PWLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTG  194

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  195  IPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDAL  254

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  255  YLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQALKLFEHFLQDKPM  314

Query  141  P  139
            P
Sbjct  315  P  315



>ref|XP_004962519.1| PREDICTED: serine carboxypeptidase 2-like [Setaria italica]
Length=490

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 129/182 (71%), Gaps = 1/182 (1%)
 Frame = -3

Query  681  YSIFTPTCTE-SFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+TPTC + S S  +R   R       +R  YDPCTE HST+Y+N PEVQ+ALH + T
Sbjct  303  YSIYTPTCNQTSSSTTARKNWRLKGHYPWMRGSYDPCTEMHSTVYYNRPEVQRALHANVT  362

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCS  +   W D P ++L +Y+ELI AGLRIWV+SGDTD+V+P+T+TRYSIDA
Sbjct  363  GINYTWTTCSGIINTNWGDSPRSMLPIYKELIAAGLRIWVYSGDTDSVVPLTATRYSIDA  422

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L LPTV  W PWYD  +VGGW+Q Y+GLT V +RGAGH+V LHRPK AL L   FL G  
Sbjct  423  LGLPTVVSWYPWYDKKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPKQALILFRHFLHGKP  482

Query  144  MP  139
            MP
Sbjct  483  MP  484



>ref|XP_008649461.1| PREDICTED: serine carboxypeptidase 2-like isoform X2 [Zea mays]
 gb|AFW77518.1| hypothetical protein ZEAMMB73_509500 [Zea mays]
Length=491

 Score =   218 bits (556),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/196 (56%), Positives = 133/196 (68%), Gaps = 15/196 (8%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIYFNLPEVQKALHV  514
            YSI+TPTC ++ +  S    RR R  G    +    YDPCTERHST+Y+N PEVQ+ALH 
Sbjct  289  YSIYTPTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTERHSTVYYNRPEVQRALHA  348

Query  513  HTTNSS-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVT  349
            + T  +     + W TCSD + + W D P +VL +Y+ELI AGLRIWVFSGDTDAV+P+T
Sbjct  349  NVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWVFSGDTDAVVPLT  408

Query  348  STRYSIDALKLPTVSPWRPWYD------NGQVGGWTQEYEGLTFVAVRGAGHKVALHRPK  187
            +TRYSIDAL LPTV  W PWYD        +VGGW+Q YEGLT V VRGAGH+V LHRP+
Sbjct  409  ATRYSIDALNLPTVVSWYPWYDAKEQKQQQEVGGWSQVYEGLTLVTVRGAGHEVPLHRPR  468

Query  186  LALTLVESFLAGTSMP  139
             AL L   FL G  MP
Sbjct  469  QALILFRHFLRGKPMP  484



>ref|XP_009333715.1| PREDICTED: serine carboxypeptidase-like 27 [Pyrus x bretschneideri]
Length=455

 Score =   217 bits (553),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 131/182 (72%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C  + S     LKR  R     + R YDPCTER+S +YFN P+VQKALH + T
Sbjct  278  YSIYTRPCNSTAS-----LKRNLRGHYPWMSRAYDPCTERYSEVYFNRPDVQKALHANVT  332

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTD+V+PVT+TRYSIDA
Sbjct  333  KVSYPWQTCSDIVGNYWADSPLSMLPIYKELIAAGLKIWVFSGDTDSVVPVTATRYSIDA  392

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLPT++ W PW DNG+VGG  Q Y+GLTFV V GAGH+V LHRP+LA  L  SFL    
Sbjct  393  LKLPTITNWFPWNDNGKVGGRCQIYKGLTFVTVTGAGHEVPLHRPRLAFILFRSFLESKP  452

Query  144  MP  139
            MP
Sbjct  453  MP  454



>gb|KFK38250.1| hypothetical protein AALP_AA3G088900 [Arabis alpina]
Length=461

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +   + R LK R      + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  283  YSIFTKPCNNTVQ-LKRFLKGR---YPWMSRAYDPCTERYSNVYFNRVEVQKALHANVTR  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W +CSD V  +W D P ++L +Y+ELITAGL+IWVFSGDTDAV+PVT+TRYSIDAL
Sbjct  339  LPYPWKSCSDIVGSYWTDSPVSMLPIYRELITAGLKIWVFSGDTDAVVPVTATRYSIDAL  398

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  399  KLETITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLENKPM  458

Query  141  P  139
            P
Sbjct  459  P  459



>ref|XP_003566409.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
 ref|XP_003568700.1| PREDICTED: serine carboxypeptidase II-1 [Brachypodium distachyon]
Length=469

 Score =   217 bits (553),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 130/181 (72%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R++K R      L R YDPCTE++ST Y+NLPEVQKA H + T 
Sbjct  283  YSIYTPTCKKASLRKRRLIKGRRP---WLPRGYDPCTEKYSTKYYNLPEVQKAFHANVTG  339

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD++++ WKD P ++L +Y ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  340  MPYAWNPCSDDLFEHWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVVPLTATRYSIDAL  399

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWY+  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  400  YLPTVTNWYPWYEEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQALKLFEHFLQDKPM  459

Query  141  P  139
            P
Sbjct  460  P  460



>gb|ACU19747.1| unknown [Glycine max]
Length=282

 Score =   212 bits (539),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 126/181 (70%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C +  +I  R+  R       L R YDPCTER+ST+YFN PEVQKALH + T 
Sbjct  67   YSIYTPVCNDIAAIKRRLGGRYP----WLSRAYDPCTERYSTLYFNRPEVQKALHANVTG  122

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+V+PVT++RYSI AL
Sbjct  123  IPYSWAGCNDVIVENWGDSPLSMLSIYQELIEGGIRIWVFSGDTDSVVPVTASRYSIRAL  182

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T+  W  WYDN +VGGW+Q YEGLT V VRGAGH+V LH+P+    L ++FL   +M
Sbjct  183  NLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQGFILFKTFLEDKNM  242

Query  141  P  139
            P
Sbjct  243  P  243



>ref|XP_002459313.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
 gb|EER95834.1| hypothetical protein SORBIDRAFT_02g002260 [Sorghum bicolor]
Length=478

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 131/188 (70%), Gaps = 7/188 (4%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL-------LRRIYDPCTERHSTIYFNLPEVQKA  523
            YSI+TP C ++ S  ++   +    +G        +   YDPCTE HST+Y+N PEVQ+A
Sbjct  285  YSIYTPLCGQTSSSSTKRSSQSSPLIGRHYHHPWRMGGSYDPCTESHSTVYYNRPEVQRA  344

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            LH + T  ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAVIP+TST
Sbjct  345  LHANLTGINYPWATCSDLINTNWGDSPKSMLPIYKELIAAGLRIWVFSGDTDAVIPLTST  404

Query  342  RYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVES  163
            RYS+DAL LPT + W PWYD  QVGGW+Q YEGLT V VRGAGH+V LHRP+ AL L + 
Sbjct  405  RYSVDALGLPTTTSWYPWYDKKQVGGWSQVYEGLTLVTVRGAGHEVPLHRPRQALILFQQ  464

Query  162  FLAGTSMP  139
            FL G  MP
Sbjct  465  FLKGEPMP  472



>ref|XP_009141519.1| PREDICTED: serine carboxypeptidase-like 26 [Brassica rapa]
Length=447

 Score =   216 bits (551),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 131/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN PEVQKA+H +TT
Sbjct  270  YSIYTVTCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANTT  326

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI A
Sbjct  327  GLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVVPVTGTRYSIRA  386

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  VS W PWYDNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    
Sbjct  387  LKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLNNKP  446

Query  144  M  142
            M
Sbjct  447  M  447



>ref|XP_006407773.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
 gb|ESQ49226.1| hypothetical protein EUTSA_v10020705mg [Eutrema salsugineum]
Length=456

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +  + S +  R       + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  278  YSIFTKPCNNTVQLKSFLRGRYP----WMSRAYDPCTERYSNVYFNRVEVQKALHANVTR  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W +CSD V  +W+D P ++L +Y+ELITAGL+IWVFSGDTDAV+PVT+TRYSIDAL
Sbjct  334  LPYPWKSCSDIVGSYWRDSPVSMLPIYRELITAGLKIWVFSGDTDAVVPVTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  394  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLESKPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>emb|CDY35977.1| BnaA05g29730D [Brassica napus]
Length=459

 Score =   217 bits (552),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  281  YSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFNRVEVQKALHANVTR  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  337  LSYSWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVVPITATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  +  SFL    M
Sbjct  397  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFIIFRSFLENKPM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_008446902.1| PREDICTED: serine carboxypeptidase-like 27 [Cucumis melo]
Length=457

 Score =   216 bits (551),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  + S+   +          + R YDPCTER+S  YFN P+VQKA H + T 
Sbjct  280  YSIYTRPCNSTASLRHNLRGHYP----WMSRAYDPCTERYSVAYFNHPDVQKAFHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             ++ W TCSD V ++W D P ++L +YQELI +G+RIWVFSGDTD+V+PVT+TRYSIDAL
Sbjct  336  ITYPWSTCSDLVGNYWADSPLSMLPIYQELIVSGIRIWVFSGDTDSVVPVTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+S W PWYD+G+VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L  SFL    +
Sbjct  396  KLPTISNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLHRPREAFILFRSFLEDKPL  455

Query  141  P  139
            P
Sbjct  456  P  456



>emb|CDY32091.1| BnaC04g44750D [Brassica napus]
Length=447

 Score =   216 bits (550),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 131/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN PEVQKA+H +TT
Sbjct  270  YSIYTVTCKKEAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANTT  326

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI A
Sbjct  327  GLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVVPITGTRYSIRA  386

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  VS W PWYDNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    
Sbjct  387  LKLQPVSKWYPWYDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLNNKP  446

Query  144  M  142
            M
Sbjct  447  M  447



>ref|XP_010547376.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547377.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
 ref|XP_010547378.1| PREDICTED: serine carboxypeptidase-like 27 [Tarenaya hassleriana]
Length=457

 Score =   216 bits (551),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + ++   ++ R       + R YDPCTER+S  YFN P VQKALH + T 
Sbjct  279  YSIFTRPCNNTVTLKRFLMGRYP----WMSRAYDPCTERYSNSYFNRPNVQKALHANVTR  334

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V  +W D P ++L +Y+ELI AG++IWVFSGDTDAV+PVT+TRYSI+AL
Sbjct  335  LPYPWKACSDIVGSYWTDSPVSMLPIYKELIAAGVKIWVFSGDTDAVVPVTATRYSINAL  394

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT++ W PWYD G+VGGW+Q Y+GLTFV+V GAGH+V LHRP+ A  L  SFL    M
Sbjct  395  KLPTITNWYPWYDQGKVGGWSQVYKGLTFVSVAGAGHEVPLHRPRQAFILFRSFLEDKPM  454

Query  141  P  139
            P
Sbjct  455  P  455



>emb|CDY40438.1| BnaA04g20790D [Brassica napus]
Length=447

 Score =   216 bits (550),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN PEVQKA+H +TT
Sbjct  270  YSIYTVTCKREAAALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANTT  326

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI A
Sbjct  327  GLAYPWKTCSDIVGEKWADSPLSMLPIYKELIGAGLRIWVFSGDTDSVVPVTGTRYSIRA  386

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  VS W PWYDNGQVGGW+Q Y GLT V + GAGH+V LHRP+    L +SFL    
Sbjct  387  LKLQPVSKWYPWYDNGQVGGWSQVYNGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLNNKP  446

Query  144  M  142
            M
Sbjct  447  M  447



>gb|EMS66624.1| Serine carboxypeptidase II-1 [Triticum urartu]
Length=357

 Score =   213 bits (543),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R +K R      L R YDPCTE++ST Y+NLPEVQKA   + T 
Sbjct  171  YSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTG  227

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T TRYSIDAL
Sbjct  228  IPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTGTRYSIDAL  287

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  288  YLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPM  347

Query  141  P  139
            P
Sbjct  348  P  348



>ref|XP_010486379.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +   + R LK R      + R YDPC+ER+S +YFN  EVQKALH + T 
Sbjct  281  YSIFTKPCNNTVQ-LKRFLKGR---YPWMSRAYDPCSERYSNVYFNRVEVQKALHANVTR  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  337  LPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVVPITATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  397  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLENKPM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|NP_187456.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
 sp|Q9SFB5.1|SCP27_ARATH RecName: Full=Serine carboxypeptidase-like 27; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF21209.1|AC013483_33 putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAT71955.1| At3g07990 [Arabidopsis thaliana]
 gb|AAU95440.1| At3g07990 [Arabidopsis thaliana]
 gb|AEE74628.1| serine carboxypeptidase-like 27 [Arabidopsis thaliana]
Length=459

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + + + R LK R      + R YDPCTER+S +YFN  +VQKALH + T 
Sbjct  281  YSIFTKPCNSTVA-LKRFLKGR---YPWMSRAYDPCTERYSNVYFNRLDVQKALHANVTR  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W  CSD V  +W D P ++L +Y+ELITAGL+IWVFSGDTDAV+P+T+TRYS+DAL
Sbjct  337  LSYPWKACSDIVGSYWDDSPLSMLPIYKELITAGLKIWVFSGDTDAVVPITATRYSVDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  397  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLESKPM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_009147009.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Brassica 
rapa]
Length=459

 Score =   216 bits (550),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  281  YSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFNRVEVQKALHANVTR  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  337  LSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVVPITATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  +  SFL    M
Sbjct  397  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFIIFRSFLENKPM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_009147010.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Brassica 
rapa]
Length=450

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  272  YSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFNRVEVQKALHANVTR  327

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  328  LSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVVPITATRYSIDAL  387

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  +  SFL    M
Sbjct  388  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFIIFRSFLENKPM  447

Query  141  P  139
            P
Sbjct  448  P  448



>emb|CDY28004.1| BnaC05g44060D [Brassica napus]
Length=459

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +  + S  LK R      + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  281  YSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCTERYSNVYFNRVEVQKALHANVTR  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             S+ W +CSD V ++W D P ++L +Y+ELI AGL+IWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  337  LSYPWKSCSDIVGNYWTDSPVSMLPIYRELIAAGLKIWVFSGDTDAVVPITATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  +  SFL    M
Sbjct  397  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVTGAGHEVPLHRPRQAFIIFRSFLENKPM  456

Query  141  P  139
            P
Sbjct  457  P  457



>gb|EMT21139.1| putative Serine carboxypeptidase II-1 [Aegilops tauschii]
Length=419

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R +K R      L R YDPCTE++ST Y+NLPEVQKA   + T 
Sbjct  233  YSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTG  289

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W +CSD ++++WKD P ++L +Y ELI AG+RIWVFSGD D+V+P+T TRYSIDAL
Sbjct  290  IPYAWTSCSDVLFEYWKDSPRSMLPIYHELIAAGIRIWVFSGDADSVVPLTGTRYSIDAL  349

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  350  YLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPM  409

Query  141  P  139
            P
Sbjct  410  P  410



>ref|XP_008649460.1| PREDICTED: serine carboxypeptidase 2-like isoform X1 [Zea mays]
Length=492

 Score =   216 bits (550),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/197 (56%), Positives = 133/197 (68%), Gaps = 16/197 (8%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIYFNLPEVQKALHV  514
            YSI+TPTC ++ +  S    RR R  G    +    YDPCTERHST+Y+N PEVQ+ALH 
Sbjct  289  YSIYTPTCNQTSTSSSSSTPRRMRLKGRYPWMRGSSYDPCTERHSTVYYNRPEVQRALHA  348

Query  513  HTTNSS-----FEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVT  349
            + T  +     + W TCSD + + W D P +VL +Y+ELI AGLRIWVFSGDTDAV+P+T
Sbjct  349  NVTAGAGGAMNYTWATCSDTINNNWGDSPKSVLHIYKELIAAGLRIWVFSGDTDAVVPLT  408

Query  348  STRYSIDALKLPTVSPWRPWYD-------NGQVGGWTQEYEGLTFVAVRGAGHKVALHRP  190
            +TRYSIDAL LPTV  W PWYD         +VGGW+Q YEGLT V VRGAGH+V LHRP
Sbjct  409  ATRYSIDALNLPTVVSWYPWYDAKEQQKQQQEVGGWSQVYEGLTLVTVRGAGHEVPLHRP  468

Query  189  KLALTLVESFLAGTSMP  139
            + AL L   FL G  MP
Sbjct  469  RQALILFRHFLRGKPMP  485



>ref|XP_002458719.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
 gb|EES03839.1| hypothetical protein SORBIDRAFT_03g038940 [Sorghum bicolor]
Length=467

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/187 (55%), Positives = 131/187 (70%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS+ T  C ++ S+          K+GL      L R YDPCTER+++IY+N PEVQ A+
Sbjct  289  YSLNTKPCNDTASL----------KLGLGGRYPWLSRAYDPCTERYASIYYNRPEVQMAM  338

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV+PVT+TR
Sbjct  339  HANTTGLHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVVPVTATR  398

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSIDALKLPTV  W PWYD+G+VGGW+Q Y+GLT V + GAGH+V LHRP+ AL +   F
Sbjct  399  YSIDALKLPTVVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPRQALIMFRHF  458

Query  159  LAGTSMP  139
            L    MP
Sbjct  459  LQNKPMP  465



>ref|XP_010464446.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=459

 Score =   215 bits (547),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +  + S  LK R      + R YDPC+ER+S +YFN  EVQKALH + T 
Sbjct  281  YSIFTKPCNNTVQLKS-FLKGR---YPWMSRAYDPCSERYSNVYFNRVEVQKALHANVTR  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  337  LPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVVPITATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  397  KLTTITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLENKPM  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_006297635.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
 gb|EOA30533.1| hypothetical protein CARUB_v10013654mg [Capsella rubella]
Length=460

 Score =   215 bits (547),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + ++ +  LK R      + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  282  YSIFTKPCNNTVALKT-FLKGR---YPWMSRAYDPCTERYSNVYFNRVEVQKALHANVTR  337

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V  +W D P ++L +Y+ELITAGL+IWVFSGDTDAV+PVT+TRYS+DAL
Sbjct  338  LRYPWKACSDIVGSYWTDSPMSMLPIYRELITAGLKIWVFSGDTDAVVPVTATRYSVDAL  397

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L +SFL    M
Sbjct  398  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFKSFLENKPM  457

Query  141  P  139
            P
Sbjct  458  P  458



>ref|XP_004142401.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 ref|XP_004157517.1| PREDICTED: serine carboxypeptidase-like 27-like [Cucumis sativus]
 gb|KGN52285.1| hypothetical protein Csa_5G623490 [Cucumis sativus]
Length=455

 Score =   214 bits (546),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  + S+   +          + R YDPCTER+S  YFN P+VQ+A H + T 
Sbjct  278  YSIYTRPCNSTASLRHNLRGHYP----WMSRAYDPCTERYSVAYFNHPDVQEAFHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             ++ W TCSD V ++W D P ++L +YQELI +G+RIWVFSGDTD+V+PVT+TRYSIDAL
Sbjct  334  ITYPWSTCSDLVGNYWADSPLSMLPIYQELIGSGIRIWVFSGDTDSVVPVTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+S W PWYD+G+VGGW+Q Y+GLTFV V GAGH+V LHRP+ A  L  SFL    +
Sbjct  394  KLPTLSNWYPWYDHGKVGGWSQIYKGLTFVTVAGAGHEVPLHRPREAFILFRSFLENKPL  453

Query  141  P  139
            P
Sbjct  454  P  454



>ref|XP_008673013.1| PREDICTED: LOC100285510 isoform X1 [Zea mays]
 gb|ACR34277.1| unknown [Zea mays]
 tpg|DAA56985.1| TPA: virulence protein Nf314 [Zea mays]
Length=467

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 131/187 (70%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS+ T  C ++ S+          K+GL      L R YDPCTER+++IY+N PEVQ AL
Sbjct  289  YSLNTKPCNDTASL----------KLGLGGRYPWLSRAYDPCTERYASIYYNRPEVQMAL  338

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV+PVT+TR
Sbjct  339  HANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVVPVTATR  398

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + + GAGH+V LHRP+ AL +   F
Sbjct  399  YSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLHRPRQALIMFRHF  458

Query  159  LAGTSMP  139
            L    MP
Sbjct  459  LQNKPMP  465



>ref|NP_001151874.1| LOC100285510 precursor [Zea mays]
 gb|ACG44727.1| virulence-related protein Nf314 [Zea mays]
Length=467

 Score =   214 bits (546),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 131/187 (70%), Gaps = 16/187 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGL------LRRIYDPCTERHSTIYFNLPEVQKAL  520
            YS+ T  C ++ S+          K+GL      L R YDPCTER+++IY+N PEVQ AL
Sbjct  289  YSLNTKPCNDTASL----------KLGLGGRYPWLSRAYDPCTERYASIYYNRPEVQMAL  338

Query  519  HVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
            H +TT   + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV+PVT+TR
Sbjct  339  HANTTGIHYPWQTCSDIVGSYWADSPRSMLPIYQELIAAGIKIWVFSGDTDAVVPVTATR  398

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSIDALKLPT+  W PWYD+G+VGGW+Q Y+GLT + + GAGH+V LHRP+ AL +   F
Sbjct  399  YSIDALKLPTLVNWYPWYDHGKVGGWSQVYKGLTLITIAGAGHEVPLHRPRQALIMFRHF  458

Query  159  LAGTSMP  139
            L    MP
Sbjct  459  LQNKPMP  465



>ref|XP_008789080.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase-like 
27 [Phoenix dactylifera]
Length=473

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 128/182 (70%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C E+       LKR+ R     + R YDPCTE ++ +Y+N PEVQ ALH + T
Sbjct  294  YSIYTRACNET-----TTLKRKLRGHYPWMSRAYDPCTENYAEVYYNRPEVQMALHANVT  348

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               + W TCS+ V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT+TRYSIDA
Sbjct  349  GIPYPWNTCSNIVGNHWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVVPVTATRYSIDA  408

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L L TV  W PWYDNG+VGGWTQ YEGLTFV V GAGH+V LHRP+ AL L + FL    
Sbjct  409  LNLSTVISWYPWYDNGKVGGWTQVYEGLTFVTVXGAGHEVPLHRPRQALVLFKHFLQNRP  468

Query  144  MP  139
            MP
Sbjct  469  MP  470



>dbj|BAK02399.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92622.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=463

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R++K R      L R YDPCTE++ST Y+NLPEVQKA   + T 
Sbjct  277  YSIYTPTCKKTSLHRRRLIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD + D WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T+TRYSIDAL
Sbjct  334  IPYSWTACSDVLSDHWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTATRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  394  YLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPQQALKLFEHFLQDKPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>ref|XP_002882565.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58824.1| hypothetical protein ARALYDRAFT_478140 [Arabidopsis lyrata subsp. 
lyrata]
Length=456

 Score =   214 bits (545),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 130/181 (72%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + ++ S  LK R      + R YDPCTER+S +YFN  +VQKALH + T 
Sbjct  278  YSIFTKPCNSTVALKS-FLKGR---YPWMSRAYDPCTERYSNVYFNRADVQKALHANVTR  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V  +W+D P ++L +Y+ELITAGL+IW+FSGDTDAV+PVT+TRYS+DAL
Sbjct  334  LPYPWKACSDIVGSYWEDSPLSMLPIYRELITAGLKIWIFSGDTDAVVPVTATRYSVDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+VGGW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  394  KLATITNWYPWYDHGKVGGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLDSKPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>ref|XP_010920885.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=506

 Score =   215 bits (548),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 131/182 (72%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  CT++ S     LKR+ R     + R YDPCTE ++ +Y+N PEVQKALH + T
Sbjct  300  YSIYTSPCTDATS-----LKRKIRGHYPWMSRAYDPCTENYARVYYNHPEVQKALHANVT  354

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               + W TCS+ V  +W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T+TRYSIDA
Sbjct  355  GIPYPWDTCSNIVGIYWADSPRSMLPIYRELIAAGLRIWVFSGDTDSVVPLTATRYSIDA  414

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L L TV  W PWYD+G+VGGWTQ YEGLTFV VRGAGH+V LHRP+ AL L   FL    
Sbjct  415  LNLSTVISWYPWYDHGKVGGWTQVYEGLTFVTVRGAGHEVPLHRPRQALILFRHFLQDKL  474

Query  144  MP  139
            MP
Sbjct  475  MP  476



>emb|CDM82001.1| unnamed protein product [Triticum aestivum]
Length=463

 Score =   214 bits (545),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTC ++     R +K R      L R YDPCTE++ST Y+NLPEVQKA   + T 
Sbjct  277  YSIYTPTCKKTSLHRRRQIKGRRP---WLPRGYDPCTEQYSTKYYNLPEVQKAFRANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD ++++WKD P ++L +Y+ELI AG+RIWVFSGD D+V+P+T TRYSIDAL
Sbjct  334  IPYAWTGCSDVLFEYWKDSPRSMLPIYRELIAAGIRIWVFSGDADSVVPLTGTRYSIDAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV+ W PWYD  +V GW Q Y+GLT V +RGAGH+V LHRP+ AL L E FL    M
Sbjct  394  YLPTVTNWYPWYDEEEVAGWCQVYKGLTLVTIRGAGHEVPLHRPRQALKLFEHFLQDKPM  453

Query  141  P  139
            P
Sbjct  454  P  454



>ref|XP_003566533.2| PREDICTED: serine carboxypeptidase 2-like [Brachypodium distachyon]
Length=466

 Score =   214 bits (545),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 132/181 (73%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++TP C ++ S+ SR   R   +   +   YDPCTER+ST+Y+N PEVQ+ALH + T 
Sbjct  280  YSLYTPVCNQTASV-SRPRPRG--RYPWMSGSYDPCTERYSTVYYNRPEVQRALHANVTG  336

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
             ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  337  INYTWATCSDTINKNWGDAPRSMLPIYKELIQAGLRIWVFSGDTDAVVPLTATRYSIDAL  396

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPT   W PW D+ +VGGW+Q Y+GLT V +RGAGH+V LHRP+ AL + ++FL G  +
Sbjct  397  DLPTTIGWYPWSDSKEVGGWSQVYKGLTLVTIRGAGHEVPLHRPRQALIMFQNFLRGMPL  456

Query  141  P  139
            P
Sbjct  457  P  457



>ref|XP_004970465.1| PREDICTED: serine carboxypeptidase-like 27-like [Setaria italica]
Length=457

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 128/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+ T  C  + S+   +  R       L R YDPCTER+++IY+N PEVQ ALH +TT 
Sbjct  279  YSLNTKPCNYTASLKVSLGGRYP----WLSRAYDPCTERYASIYYNRPEVQMALHANTTG  334

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V  +W D P ++L +YQELI AG++IWVFSGDTDAV+PVT+TRYSIDAL
Sbjct  335  IHYPWQTCSDIVGTYWADSPRSMLPIYQELIAAGMKIWVFSGDTDAVVPVTATRYSIDAL  394

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPT+  W PWYD+G+VGGW+Q Y+GLT V + GAGH+V LHRP+ AL +   FL    M
Sbjct  395  KLPTLVNWYPWYDHGKVGGWSQVYKGLTLVTIAGAGHEVPLHRPRQALIMFRHFLKNKPM  454

Query  141  P  139
            P
Sbjct  455  P  455



>ref|XP_009410600.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=465

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 129/184 (70%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  S S+ S +    + +   + R YDPCT+R++ +Y+N PEVQ+ALH + T 
Sbjct  280  YSIYTQPCNSSRSLKSSL----NGRYPWMSRAYDPCTDRYAKVYYNRPEVQRALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +YQELI AGLRIW+FSGDTDAV+PVT+TRYSIDAL
Sbjct  336  IQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAVVPVTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T+  W PWYD G+VGGW+Q Y+GLTFV + GAGH+V LH P+ A+ L   FL    M
Sbjct  396  NLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQAMILFRQFLKNRPM  455

Query  141  PGLQ  130
            P  Q
Sbjct  456  PRCQ  459



>ref|XP_010460785.1| PREDICTED: serine carboxypeptidase-like 27 [Camelina sativa]
Length=457

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  +  + S  LK R      + R YDPC+ER+S +YFN  EVQKALH + T 
Sbjct  279  YSIFTKPCNNTVELKS-FLKGR---YPWMSRAYDPCSERYSNVYFNRVEVQKALHANVTR  334

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  CSD V ++W+D P ++L +Y+ELITAGL+IWVFSGDTDAV+P+T+TRYSIDAL
Sbjct  335  LPYPWKACSDIVGNYWEDSPLSMLPIYRELITAGLKIWVFSGDTDAVVPITATRYSIDAL  394

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL T++ W PWYD+G+V GW+Q Y+GLT V V GAGH+V LHRP+ A  L  SFL    M
Sbjct  395  KLATITNWYPWYDHGKVAGWSQVYKGLTLVTVAGAGHEVPLHRPRQAFILFRSFLENKPM  454

Query  141  P  139
            P
Sbjct  455  P  455



>ref|XP_009414289.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=472

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 129/182 (71%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C ++ S     L+R  R     + R YDPCTER+S +Y+N PEVQKALH + T
Sbjct  295  YSIYTLPCNDTGS-----LRRNLRGHYPWMSRAYDPCTERYSMVYYNRPEVQKALHANVT  349

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               + W TCSD + D W D P +VL +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDA
Sbjct  350  GIPYSWETCSDTIGDNWGDSPKSVLPIYHELIAAGLRIWVFSGDTDSVVPLTATRYSIDA  409

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL T+  W PWY +G+VGGW+Q YEGLTFV V GAGH+V LHRP+ AL L + FL    
Sbjct  410  LKLKTLKNWYPWYYDGKVGGWSQIYEGLTFVTVTGAGHEVPLHRPRQALILFKRFLKNKP  469

Query  144  MP  139
            MP
Sbjct  470  MP  471



>emb|CDP11023.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   214 bits (544),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 139/188 (74%), Gaps = 3/188 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS++TP CT S S  S +L +R   + L  + YDPCTE HS IYFNLPEVQ+ALHV    
Sbjct  302  YSVYTPKCTSSSSTTSNLLSKRWPTL-LRSQGYDPCTEAHSIIYFNLPEVQQALHVR--G  358

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            S  +W TC   V+  WKD   ++L+  +EL T+G+RIW++SG+TDAVIP+TSTRYS+ AL
Sbjct  359  SPVKWETCGLTVHYAWKDSARSLLNTIKELTTSGIRIWIYSGNTDAVIPITSTRYSLRAL  418

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             LPTV  + PWY++GQVGGWTQ+YEGLTFVAV  AGH+V LH+PK ALT+ ++FLAGT +
Sbjct  419  NLPTVGSYLPWYEDGQVGGWTQQYEGLTFVAVNAAGHEVPLHKPKQALTIFKAFLAGTPL  478

Query  141  PGLQRISD  118
               ++ SD
Sbjct  479  ATSKQFSD  486



>ref|XP_009410601.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=457

 Score =   213 bits (542),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+T  C  S S+ S +  R       + R YDPCT+R++ +Y+N PEVQ+ALH + T 
Sbjct  280  YSIYTQPCNSSRSLKSSLNGRYP----WMSRAYDPCTDRYAKVYYNRPEVQRALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +YQELI AGLRIW+FSGDTDAV+PVT+TRYSIDAL
Sbjct  336  IQYPWDTCSDIVGNYWADSPRSMLPIYQELIAAGLRIWMFSGDTDAVVPVTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T+  W PWYD G+VGGW+Q Y+GLTFV + GAGH+V LH P+ A+ L   FL    M
Sbjct  396  NLQTLISWYPWYDKGKVGGWSQVYKGLTFVTIMGAGHEVPLHHPRQAMILFRQFLKNRPM  455

Query  141  P  139
            P
Sbjct  456  P  456



>ref|XP_007009787.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
 gb|EOY18597.1| Serine carboxypeptidase-like 27 isoform 1 [Theobroma cacao]
Length=552

 Score =   215 bits (547),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 132/215 (61%), Gaps = 39/215 (18%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSIFT  C ++       LKR  R     + R YDPCTER+S +YFNLPEVQKALH + T
Sbjct  342  YSIFTQPCKDT-----ATLKRNMRGHYPWMSRAYDPCTERYSKVYFNLPEVQKALHANVT  396

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V ++W D P ++L +Y+ELI AG RIWV+SGDTDAV+PVT+TRYSIDA
Sbjct  397  GISYPWQTCSDLVGNYWADAPLSMLPIYKELIAAGFRIWVYSGDTDAVVPVTATRYSIDA  456

Query  324  LKLPTVSPWRPWYDNG---------------------------------QVGGWTQEYEG  244
            LKLPTV+ W PWYDNG                                 QVGGW+Q Y G
Sbjct  457  LKLPTVTNWYPWYDNGKVSTDNVIQFLELVSVEIGLHRCLSHQISHFLIQVGGWSQAYRG  516

Query  243  LTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  139
            LTFV V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  517  LTFVTVTGAGHEVPLHRPRQAFILFRSFLENKPMP  551



>emb|CAA18212.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
 emb|CAB79799.1| SERINE CARBOXYPEPTIDASE II-like protein [Arabidopsis thaliana]
Length=425

 Score =   211 bits (536),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 126/180 (70%), Gaps = 25/180 (14%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YS+FTP C  + S                   YDPCTE+H+T+YFNLPEVQKALH+    
Sbjct  253  YSVFTPACVANAS----------------HEQYDPCTEKHTTVYFNLPEVQKALHL----  292

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
                W+ CSD V + W D P++VL++Y ELI AGLRIWVFSGD DAV+PVTSTRYSIDAL
Sbjct  293  ----WL-CSDVVSEHWNDSPSSVLNIYHELIAAGLRIWVFSGDADAVVPVTSTRYSIDAL  347

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L  +S + PWY +GQVGGW+Q+Y GL FV VRGAGH+V LHRPK AL L ++F++GT +
Sbjct  348  NLRPLSAYGPWYLDGQVGGWSQQYAGLNFVTVRGAGHEVPLHRPKQALALFKAFISGTPL  407



>ref|XP_003548016.1| PREDICTED: serine carboxypeptidase-like 27-like [Glycine max]
Length=493

 Score =   212 bits (539),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C +    ++ + +R   +   L R YDPCTER+ST+YFN PEVQKALH + T 
Sbjct  278  YSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYSTLYFNRPEVQKALHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+V+PVT++RYSI AL
Sbjct  334  IPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSGDTDSVVPVTASRYSIRAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T+  W  WYDN +VGGW+Q YEGLT V VRGAGH+V LH+P+    L ++FL   +M
Sbjct  394  NLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQGFILFKTFLEDKNM  453

Query  141  P  139
            P
Sbjct  454  P  454



>gb|EMT12249.1| Serine carboxypeptidase 2 [Aegilops tauschii]
Length=468

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 133/184 (72%), Gaps = 4/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YS++TP C  + S  S + +RR R +   L   YDPCTER+ST Y+N  +VQ ALH + T
Sbjct  279  YSLYTPVCNITSS--SSLSQRRPRGRYPWLTGSYDPCTERYSTAYYNRRDVQMALHANVT  336

Query  504  NS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
             + ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSI 
Sbjct  337  GAMNYTWTTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIG  396

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
            AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGH+V LHRP+ AL L + FL G 
Sbjct  397  ALGLPTTTSWHPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYFLQGK  456

Query  147  SMPG  136
             MPG
Sbjct  457  PMPG  460



>gb|KHN13367.1| Serine carboxypeptidase-like 27 [Glycine soja]
Length=493

 Score =   212 bits (539),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 127/181 (70%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C +    ++ + +R   +   L R YDPCTER+ST+YFN PEVQKALH + T 
Sbjct  278  YSIYTPVCND----IAAIKRRLGGRYPWLSRAYDPCTERYSTLYFNRPEVQKALHANVTG  333

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W  C+D + + W D P ++L +YQELI  G+RIWVFSGDTD+V+PVT++RYSI AL
Sbjct  334  IPYSWAGCNDVIVENWGDSPLSMLPIYQELIEGGIRIWVFSGDTDSVVPVTASRYSIRAL  393

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T+  W  WYDN +VGGW+Q YEGLT V VRGAGH+V LH+P+    L ++FL   +M
Sbjct  394  NLSTIINWYAWYDNDEVGGWSQVYEGLTLVTVRGAGHEVPLHKPRQGFILFKTFLEDKNM  453

Query  141  P  139
            P
Sbjct  454  P  454



>gb|KCW65386.1| hypothetical protein EUGRSUZ_G02816 [Eucalyptus grandis]
Length=467

 Score =   211 bits (537),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + S+   +          + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  290  YSIFTRPCNSTSSLRHNLRGHYP----WMSRAYDPCTERYSEVYFNKPEVQKALHANVTG  345

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +YQELI AGLRIWV+SGDTDAV+PVT++RYSIDAL
Sbjct  346  LPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDAVVPVTASRYSIDAL  405

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL TV  W PW DNG+VGGW+Q Y+GLTFV V GAGH+V L RP+ A  L  SFL    M
Sbjct  406  KLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLLRPRQAFILFRSFLENKPM  465



>ref|XP_006294202.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
 gb|EOA27100.1| hypothetical protein CARUB_v10023198mg [Capsella rubella]
Length=451

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 129/182 (71%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TCT E+ ++ SR  + R      + R YDPCTER+S +YFN PEVQKA+H + T
Sbjct  272  YSIYTITCTKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANIT  328

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI A
Sbjct  329  GLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPVTGTRYSIRA  388

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  VS W PW DNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    
Sbjct  389  LKLQPVSKWYPWNDNGQVGGWSQVYQGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLDNKP  448

Query  144  MP  139
            +P
Sbjct  449  LP  450



>gb|ACA61621.1| hypothetical protein AP7_B10.1 [Arabidopsis lyrata subsp. petraea]
Length=450

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 131/182 (72%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR  + R      + R YDPCT+R+S +YFN PEVQKA+H + T
Sbjct  271  YSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTDRYSGMYFNSPEVQKAMHANIT  327

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI A
Sbjct  328  GLSYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRA  387

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLP +S W PW D+GQVGGW+Q Y+GLT V + GAGH+V LHRP+ A  L +SFL    
Sbjct  388  LKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRAYLLFQSFLDNKP  447

Query  144  MP  139
            +P
Sbjct  448  LP  449



>pdb|1BCR|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-ii, 
With The Microbial Peptide Aldehyde Inhibitor, Antipain, 
And Arginine At Room Temperature
 pdb|1BCS|B Chain B, Complex Of The Wheat Serine Carboxypeptidase, Cpdw-Ii, 
With The Microbial Peptide Aldehyde Inhibitor, Chymostatin, 
And Arginine At 100 Degrees Kelvin
 prf||1408164B CPase II B
Length=160

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  4    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  63

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  64   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  123

Query  228  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  124  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  154



>pdb|3SC2|B Chain B, Refined Atomic Model Of Wheat Serine Carboxypeptidase 
Ii At 2.2- Angstroms Resolution
Length=152

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  228  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>pdb|1WHS|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  228  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>pdb|1WHT|B Chain B, Structure Of The Complex Of L-Benzylsuccinate With Wheat 
Serine Carboxypeptidase Ii At 2.0 Angstroms Resolution
Length=153

 Score =   201 bits (510),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 116/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W TCSD +   W D P ++L +Y+ELI
Sbjct  2    YDPCTERYSTAYYNRRDVQMALHANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELI  61

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVA  229
             AGLRIWVFSGDTDAV+P+T+TRYSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+
Sbjct  62   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVS  121

Query  228  VRGAGHKVALHRPKLALTLVESFLAGTSMPG  136
            VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  122  VRGAGHEVPLHRPRQALVLFQYFLQGKPMPG  152



>ref|XP_010067290.1| PREDICTED: serine carboxypeptidase-like 27 [Eucalyptus grandis]
Length=528

 Score =   211 bits (537),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 125/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C  + S+   +          + R YDPCTER+S +YFN PEVQKALH + T 
Sbjct  351  YSIFTRPCNSTSSLRHNLRGHYP----WMSRAYDPCTERYSEVYFNKPEVQKALHANVTG  406

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +YQELI AGLRIWV+SGDTDAV+PVT++RYSIDAL
Sbjct  407  LPYAWKTCSDIVGNYWADSPLSMLPIYQELIAAGLRIWVYSGDTDAVVPVTASRYSIDAL  466

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KL TV  W PW DNG+VGGW+Q Y+GLTFV V GAGH+V L RP+ A  L  SFL    M
Sbjct  467  KLATVINWYPWTDNGKVGGWSQVYKGLTFVTVTGAGHEVPLLRPRQAFILFRSFLENKPM  526



>ref|XP_010937832.1| PREDICTED: serine carboxypeptidase-like 27 [Elaeis guineensis]
Length=470

 Score =   210 bits (534),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 127/182 (70%), Gaps = 6/182 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C ++       LKR+ R     + R YDPCTE ++ +Y+N PEVQKALH + T
Sbjct  291  YSIYTRPCNDA-----TTLKRKLRGHYPWMSRAYDPCTENYANVYYNRPEVQKALHANVT  345

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               + W TCS+ V  +W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T+TRYSIDA
Sbjct  346  GIPYPWDTCSNIVGKYWTDSPRSMLPIYRELIAAGLRIWVFSGDTDSVVPLTATRYSIDA  405

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L L TV  W  WYD G VGGWTQ Y+GLTFV VRGAGH+V LHRP+ AL L + FL    
Sbjct  406  LNLSTVISWYAWYDQGMVGGWTQVYKGLTFVTVRGAGHEVPLHRPRQALVLFKHFLQNRP  465

Query  144  MP  139
            MP
Sbjct  466  MP  467



>ref|XP_002881414.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57673.1| hypothetical protein ARALYDRAFT_482550 [Arabidopsis lyrata subsp. 
lyrata]
Length=450

 Score =   209 bits (532),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 130/182 (71%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR  + R      + R YDPCT+R+S +YFN PEVQKA+H + T
Sbjct  271  YSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTDRYSGMYFNSPEVQKAMHANIT  327

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI A
Sbjct  328  GLSYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRA  387

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKLP +S W PW D+GQVGGW+Q Y+GLT V + GAGH+V LHRP+ A  L +SFL    
Sbjct  388  LKLPPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRAFLLFQSFLDNKP  447

Query  144  MP  139
            +P
Sbjct  448  LP  449



>ref|XP_009386999.1| PREDICTED: serine carboxypeptidase-like 27 [Musa acuminata subsp. 
malaccensis]
Length=474

 Score =   209 bits (533),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 129/183 (70%), Gaps = 5/183 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDR-KVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T  C +      R LKR  R     + R YDPCTER+S IY+N  +VQ+A+H + T
Sbjct  294  YSIYTLPCNDH----PRSLKRNLRGHYPWMSRAYDPCTERYSRIYYNRADVQRAMHANVT  349

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
               + W TCSD + + W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TRYSIDA
Sbjct  350  GIPYGWDTCSDTISENWGDSPKSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATRYSIDA  409

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            L+L T+  W PWYD+G+VGGW+Q Y+GLT+V V GAGH+V LHRP+ AL L E FL    
Sbjct  410  LRLRTLEKWYPWYDHGKVGGWSQIYKGLTYVTVTGAGHEVPLHRPRQALMLFEHFLKNKP  469

Query  144  MPG  136
            MP 
Sbjct  470  MPA  472



>ref|XP_007154876.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
 gb|ESW26870.1| hypothetical protein PHAVU_003G155400g, partial [Phaseolus vulgaris]
Length=371

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 125/181 (69%), Gaps = 5/181 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTCT S ++     K      G     YDPCTE ++  Y+NLPEVQKA+H + TN
Sbjct  194  YSIYTPTCTTSQTVRHIRFKNLHMISG-----YDPCTENYAEKYYNLPEVQKAMHANLTN  248

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              ++W  CS+ +   WKD   +VL +Y+ELI AGL+IWVFSGDTD+V+PVT+TR+S++ L
Sbjct  249  IPYKWTACSEVLLKNWKDSEISVLPIYKELIAAGLKIWVFSGDTDSVVPVTATRFSLNHL  308

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L   + W PWY  GQVGGWT+ Y GLTF  VRGAGH+V L +PK A TL +SFLAG  +
Sbjct  309  NLSIKTRWYPWYSGGQVGGWTEVYNGLTFATVRGAGHEVPLFQPKRAYTLFKSFLAGKEL  368

Query  141  P  139
            P
Sbjct  369  P  369



>gb|AES62200.2| serine carboxypeptidase-like protein [Medicago truncatula]
Length=491

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 131/213 (62%), Gaps = 36/213 (17%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C  + S+ S +  R       + R YDPCTERHS +YFN PEVQKALH + T 
Sbjct  280  YSIYTPPCNNTASLRSGLNGRYP----WMSRAYDPCTERHSDVYFNRPEVQKALHANVTG  335

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              + W TCSD V ++W D P ++L +Y ELI AGLRIWVFSGDTD+V+P+T+TRYSIDAL
Sbjct  336  IPYIWKTCSDIVGNYWTDSPLSMLPIYHELINAGLRIWVFSGDTDSVVPLTATRYSIDAL  395

Query  321  KLPTVSPWRPWYDNG--------------------------------QVGGWTQEYEGLT  238
            KLPT+  W PWYD+G                                +VGGW+Q Y+GLT
Sbjct  396  KLPTIINWYPWYDSGKVGANFCKEKLFKFILIGMNSGKFDTKIYSSVKVGGWSQVYKGLT  455

Query  237  FVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  139
             V +RGAGH+V LH+P+ A  L  SFL    MP
Sbjct  456  LVTIRGAGHEVPLHKPREAFILFRSFLENKDMP  488



>ref|XP_010505098.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=453

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 128/182 (70%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S +YFN PEVQKA+H + T
Sbjct  274  YSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANIT  330

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI A
Sbjct  331  GLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRA  390

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  +S W PW DNGQVGGW Q Y+GLT V + GAGH+V LHRP+    L +SFL    
Sbjct  391  LKLQPLSKWYPWNDNGQVGGWIQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLDNKP  450

Query  144  MP  139
            +P
Sbjct  451  LP  452



>ref|XP_003519151.1| PREDICTED: serine carboxypeptidase 24-like isoform 1 [Glycine 
max]
Length=461

 Score =   207 bits (527),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQ A+H + TN
Sbjct  282  YSIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQIAMHANVTN  338

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S++ L
Sbjct  339  IPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSLNHL  398

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLAG  +
Sbjct  399  NLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKSFLAGNEL  458

Query  141  P  139
            P
Sbjct  459  P  459



>ref|XP_010509560.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=451

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 128/182 (70%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S +YFN PEVQKA+H + T
Sbjct  272  YSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANIT  328

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI A
Sbjct  329  GLAYSWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRA  388

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  +S W PW DNGQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    
Sbjct  389  LKLQPLSKWYPWNDNGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLDNKP  448

Query  144  MP  139
            +P
Sbjct  449  LP  450



>ref|XP_010516783.1| PREDICTED: serine carboxypeptidase-like 26 [Camelina sativa]
Length=454

 Score =   206 bits (525),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 129/182 (71%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR  + R      + R YDPCTER+S +YFN PEVQKA+H + T
Sbjct  275  YSIYTITCKKEAAALRSRFSRVRHP---WMWRAYDPCTERYSGMYFNSPEVQKAMHANIT  331

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W TCSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI A
Sbjct  332  GLAYPWKTCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRA  391

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  +S W PW D+GQVGGW+Q Y+GLT V + GAGH+V LHRP+    L +SFL    
Sbjct  392  LKLQPLSKWYPWNDSGQVGGWSQVYKGLTLVTIHGAGHEVPLHRPRRGFLLFQSFLDNKP  451

Query  144  MP  139
            +P
Sbjct  452  LP  453



>emb|CAI64396.1| serine carboxypeptidase II [Triticum aestivum]
Length=260

 Score =   201 bits (510),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = -3

Query  681  YSIFTPTCT-----ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALH  517
            YS++TP C       S S      +R   +   L   YDPCTER+ST Y+N  +VQ ALH
Sbjct  65   YSLYTPVCNITSSSSSSSSSLSQQRRSRGRYPWLTGSYDPCTERYSTAYYNRRDVQTALH  124

Query  516  VHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
             + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TR
Sbjct  125  ANVTGAMNYTWSTCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATR  184

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGH+V LHRP+ AL L + F
Sbjct  185  YSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYF  244

Query  159  LAGTSMPG  136
            L G  MPG
Sbjct  245  LQGKPMPG  252



>ref|XP_003549539.1| PREDICTED: serine carboxypeptidase 24-like [Glycine max]
 gb|KHN17498.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 127/181 (70%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TPTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQKA+H + TN
Sbjct  281  YSIYTPTCTASQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQKAMHANVTN  337

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              ++W  CSD +   WKD   +VL +Y+ELI AGL+IWVFSGDTD+V+PVT+TR+S++ L
Sbjct  338  IPYKWTACSDVLLKNWKDSAISVLPIYKELIAAGLKIWVFSGDTDSVVPVTATRFSLNHL  397

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L   + W PWY  GQVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLA   +
Sbjct  398  NLSIRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKSFLAAKEL  457

Query  141  P  139
            P
Sbjct  458  P  458



>ref|XP_011469672.1| PREDICTED: serine carboxypeptidase-like 27 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=455

 Score =   205 bits (522),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 124/180 (69%), Gaps = 7/180 (4%)
 Frame = -3

Query  678  SIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNS  499
            SIFT  C  + ++   +        G   R YDPC ER+S  YFN PEVQKALH + T  
Sbjct  282  SIFTRPCGSAAALKGNL-------SGHYSRAYDPCAERYSEKYFNHPEVQKALHANVTGL  334

Query  498  SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALK  319
            S+ W TCSD + + W D P ++L +YQELI AGL+IWV+SGDTDAV+PVT+TRYSIDALK
Sbjct  335  SYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAVVPVTATRYSIDALK  394

Query  318  LPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  139
            LPT++ W PWYD+G+VGG +Q Y+GLT V + GAGH V L RP+ A  L +SFL    MP
Sbjct  395  LPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLRPREAFILFKSFLENKPMP  454



>gb|KHN42831.1| Serine carboxypeptidase 24 [Glycine soja]
Length=460

 Score =   204 bits (520),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 127/181 (70%), Gaps = 3/181 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            Y I+TPTCT S +   R ++ ++     L   YDPCTE ++  Y+NLPEVQ A+H + TN
Sbjct  281  YIIYTPTCTTSQNNTVRHMRFKNLH---LISGYDPCTENYAEKYYNLPEVQIAMHANVTN  337

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S++ L
Sbjct  338  IPYKWTACSDVLLKNWKDSEISVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSLNHL  397

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L T + W PWY  GQVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLAG  +
Sbjct  398  NLRTRTRWYPWYSGGQVGGWTEVYDGLTFATVRGAGHEVPLFQPKRAYILFKSFLAGNEL  457

Query  141  P  139
            P
Sbjct  458  P  458



>ref|XP_004307399.1| PREDICTED: serine carboxypeptidase-like 27 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=458

 Score =   204 bits (519),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 124/180 (69%), Gaps = 4/180 (2%)
 Frame = -3

Query  678  SIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTNS  499
            SIFT  C  + ++   +      K     R YDPC ER+S  YFN PEVQKALH + T  
Sbjct  282  SIFTRPCGSAAALKGNLSGHYPWK----SRAYDPCAERYSEKYFNHPEVQKALHANVTGL  337

Query  498  SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDALK  319
            S+ W TCSD + + W D P ++L +YQELI AGL+IWV+SGDTDAV+PVT+TRYSIDALK
Sbjct  338  SYPWKTCSDIIGNNWSDSPRSMLPIYQELIAAGLKIWVYSGDTDAVVPVTATRYSIDALK  397

Query  318  LPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSMP  139
            LPT++ W PWYD+G+VGG +Q Y+GLT V + GAGH V L RP+ A  L +SFL    MP
Sbjct  398  LPTIANWSPWYDSGKVGGRSQIYKGLTLVTITGAGHLVPLLRPREAFILFKSFLENKPMP  457



>ref|XP_008352213.1| PREDICTED: serine carboxypeptidase 24-like, partial [Malus domestica]
Length=332

 Score =   200 bits (509),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 127/184 (69%), Gaps = 6/184 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHVH  511
            YSI+TP C    +   R L+ ++    LLRR    YDPCTE ++  Y+N P+VQKA+H +
Sbjct  149  YSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTENYAEKYYNRPDVQKAMHAN  205

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S+
Sbjct  206  VTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIWVFSGDTDSVVPVTATRFSL  265

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
            + L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L + +  LTL +SFLAG
Sbjct  266  NHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHEVPLIQAERGLTLFKSFLAG  325

Query  150  TSMP  139
              +P
Sbjct  326  KKLP  329



>gb|KDO59486.1| hypothetical protein CISIN_1g0120681mg, partial [Citrus sinensis]
Length=381

 Score =   201 bits (512),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 129/190 (68%), Gaps = 6/190 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHVH  511
            YSI+TP+C    ++ +  ++    K  LLRR    YDPCTE ++  Y+N  EVQKALH +
Sbjct  193  YSIYTPSC---IALPNSTVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHAN  249

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+PVT+TR+S+
Sbjct  250  VTGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSL  309

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
              L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L +P+ AL L  SFLAG
Sbjct  310  SHLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAG  369

Query  150  TSMPGLQRIS  121
              +P  + IS
Sbjct  370  KQLPKSRHIS  379



>ref|XP_007011905.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY29524.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=465

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 127/183 (69%), Gaps = 4/183 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHT  508
            YSI+TP+C    +  +R +  R +   L RR+  YDPCTE ++  Y+N P+VQKA+H +T
Sbjct  283  YSIYTPSCLALTNNSARHI--RLKNTLLHRRVSGYDPCTENYAEKYYNRPDVQKAMHANT  340

Query  507  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
            T   ++W  CSD +   WKD   +VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S+ 
Sbjct  341  TGIPYKWTACSDVLIKNWKDSENSVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSLS  400

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
             L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L +PK A  L +SFLAG 
Sbjct  401  HLNLHIKTPWYPWYSGNQVGGWTEVYQGLTFATVRGAGHEVPLFQPKRAFILYKSFLAGK  460

Query  147  SMP  139
             +P
Sbjct  461  ELP  463



>gb|KJB76567.1| hypothetical protein B456_012G094900 [Gossypium raimondii]
Length=482

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/211 (50%), Positives = 129/211 (61%), Gaps = 34/211 (16%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFT  C ++ ++   +          + R YDPCTER+S +YFN  EVQKALH + T 
Sbjct  275  YSIFTQPCKDTSTLRHNMRGHYP----WMSRAYDPCTERYSKVYFNRLEVQKALHANVTA  330

Query  501  SSFEWVTC------------------------------SDEVYDFWKDCPTTVLDVYQEL  412
             S+ W TC                              SD V ++W D P ++L +Y+EL
Sbjct  331  LSYPWQTCRYDHFLNTSRIFKIFVSNIYFIRICKSLFYSDIVGNYWTDAPLSMLPIYKEL  390

Query  411  ITAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFV  232
            I AGLRIWV+SGDTDAV+PVT+TRYSIDALKLPTV  W PWYDNG+VGGW+Q Y+GLT V
Sbjct  391  IAAGLRIWVYSGDTDAVVPVTATRYSIDALKLPTVINWYPWYDNGKVGGWSQAYKGLTLV  450

Query  231  AVRGAGHKVALHRPKLALTLVESFLAGTSMP  139
             V GAGH+V LHRP+ A  L  SFL    MP
Sbjct  451  TVTGAGHEVPLHRPRQAFILFRSFLENKLMP  481



>sp|P08819.2|CBP2_WHEAT RecName: Full=Serine carboxypeptidase 2; AltName: Full=CPDW-II; 
Short=CP-WII; AltName: Full=Carboxypeptidase D; AltName: 
Full=Serine carboxypeptidase II; Contains: RecName: Full=Serine 
carboxypeptidase 2 chain A; AltName: Full=Serine carboxypeptidase 
II chain A; Contains: RecName: Full=Serine carboxypeptidase 
2 chain B; AltName: Full=Serine carboxypeptidase II 
chain B; Flags: Precursor [Triticum aestivum]
Length=444

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 129/188 (69%), Gaps = 6/188 (3%)
 Frame = -3

Query  681  YSIFTPTCT-----ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALH  517
            YS++TP C       S S      +R   +   L   YDPCTER+ST Y+N  +VQ ALH
Sbjct  251  YSLYTPVCNITSSSSSSSSSLSQQRRSRGRYPWLTGSYDPCTERYSTAYYNRRDVQMALH  310

Query  516  VHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTR  340
             + T + ++ W TCSD +   W D P ++L +Y+ELI AGLRIWVFSGDTDAV+P+T+TR
Sbjct  311  ANVTGAMNYTWATCSDTINTHWHDAPRSMLPIYRELIAAGLRIWVFSGDTDAVVPLTATR  370

Query  339  YSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESF  160
            YSI AL LPT + W PWYD+ +VGGW+Q Y+GLT V+VRGAGH+V LHRP+ AL L + F
Sbjct  371  YSIGALGLPTTTSWYPWYDDQEVGGWSQVYKGLTLVSVRGAGHEVPLHRPRQALVLFQYF  430

Query  159  LAGTSMPG  136
            L G  MPG
Sbjct  431  LQGKPMPG  438



>ref|XP_006453596.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
 gb|ESR66836.1| hypothetical protein CICLE_v10008182mg [Citrus clementina]
Length=471

 Score =   202 bits (514),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHT  508
            YSI+TP+C    +  S V   R +   L RR+  YDPCTE ++  Y+N  EVQKALH + 
Sbjct  283  YSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANV  340

Query  507  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
            T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+PVT+TR+S+ 
Sbjct  341  TGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSVS  400

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
             L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L +P+ AL L  SFLAG 
Sbjct  401  HLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGK  460

Query  147  SMPGLQRISD  118
             +P  + IS 
Sbjct  461  QLPKSRHISQ  470



>gb|KFK36474.1| hypothetical protein AALP_AA4G129400 [Arabis alpina]
Length=449

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 126/181 (70%), Gaps = 4/181 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR L+ R      + R YDPCTER+S +YFN  EVQKA+H + T
Sbjct  272  YSIYTITCKKEAEALRSRFLRVRHP---WMWRAYDPCTERYSGMYFNSLEVQKAMHANRT  328

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              S+ W +CSD V   W D P ++L +Y+ELI AGLRIWVFSGDTD+V+PVT TRYSI +
Sbjct  329  GISYPWTSCSDIVGAKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPVTGTRYSIRS  388

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  +S W PWYDN QVGGW Q Y+GLT V + GAGH+V L RP+ A  L +SFL    
Sbjct  389  LKLQPISKWYPWYDNEQVGGWCQVYKGLTLVTIHGAGHEVPLFRPRRAFLLFKSFLENKP  448

Query  144  M  142
            M
Sbjct  449  M  449



>ref|NP_181121.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
 sp|Q9ZQQ0.1|SCP26_ARATH RecName: Full=Serine carboxypeptidase-like 26; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD21479.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM15111.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|AAM65590.1| putative serine carboxypeptidase II [Arabidopsis thaliana]
 gb|ABJ17113.1| At2g35780 [Arabidopsis thaliana]
 gb|AEC09160.1| serine carboxypeptidase-like 26 [Arabidopsis thaliana]
Length=452

 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/182 (54%), Positives = 128/182 (70%), Gaps = 4/182 (2%)
 Frame = -3

Query  681  YSIFTPTCT-ESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTT  505
            YSI+T TC  E+ ++ SR  + R      + R YDPCTE++S +YFN PEVQKA+H + T
Sbjct  273  YSIYTVTCKKEAAALRSRFSRVRHP---WMWRAYDPCTEKYSGMYFNSPEVQKAMHANIT  329

Query  504  NSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDA  325
              ++ W  CSD V + W D P ++L +Y+ELI AGLRIWVFSGDTD+V+P+T TRYSI A
Sbjct  330  GLAYPWKGCSDIVGEKWADSPLSMLPIYKELIAAGLRIWVFSGDTDSVVPITGTRYSIRA  389

Query  324  LKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTS  145
            LKL  +S W PW D+GQVGGW+Q Y+GLT V + GAGH+V L RP+ A  L +SFL    
Sbjct  390  LKLQPLSKWYPWNDDGQVGGWSQVYKGLTLVTIHGAGHEVPLFRPRRAFLLFQSFLDNKP  449

Query  144  MP  139
            +P
Sbjct  450  LP  451



>ref|XP_006474013.1| PREDICTED: serine carboxypeptidase 24-like [Citrus sinensis]
Length=471

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/190 (52%), Positives = 128/190 (67%), Gaps = 4/190 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHT  508
            YSI+TP+C    +  S V   R +   L RR+  YDPCTE ++  Y+N  EVQKALH + 
Sbjct  283  YSIYTPSCIALPN--STVRPMRLKNTLLRRRVSGYDPCTENYAEKYYNRQEVQKALHANV  340

Query  507  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
            T   ++W  CSD + + WKD   +VL  Y++LI AGL+IWVFSGDTD+V+PVT+TR+S+ 
Sbjct  341  TGIPYKWTACSDVLINNWKDSEDSVLPTYKQLIAAGLKIWVFSGDTDSVVPVTATRFSLS  400

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
             L LP  +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L +P+ AL L  SFLAG 
Sbjct  401  HLNLPIKTPWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFQPRRALILFRSFLAGK  460

Query  147  SMPGLQRISD  118
             +P  + IS 
Sbjct  461  QLPKSRHISQ  470



>prf||1408163B CPase II B
Length=159

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/152 (60%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  585  YDPCTERHSTIYFNLPEVQKALHVHTTNS-SFEWVTCSDEVYDFWKDCPTTVLDVYQELI  409
            YDPCTER+ST Y+N  +VQ ALH + T + ++ W  CSD +   W D P ++L +Y+ELI
Sbjct  4    YDPCTERYSTAYYNRRDVQTALHANVTGAMNYTWXZCSDTINTHWHDAPRSMLPIYRELI  63

Query  408  TAGLRIWVFSGDTDAVIPVTSTRYSIDALKLPTVSPWRPWYDNGQ-VGGWTQEYEGLTFV  232
             AGLRIWVFSGDTDAV+P+T+TRYSI AL L T + W PWYD+ Q VGGW+Q Y+GLT V
Sbjct  64   AAGLRIWVFSGDTDAVVPLTATRYSIGALGLATTTSWYPWYDDLQEVGGWSQVYKGLTLV  123

Query  231  AVRGAGHKVALHRPKLALTLVESFLAGTSMPG  136
            +VRGAGH+V LHRP+ AL L + FL G  MPG
Sbjct  124  SVRGAGHEVPLHRPRQALILFQQFLQGKPMPG  155



>gb|KDP38690.1| hypothetical protein JCGZ_04043 [Jatropha curcas]
Length=254

 Score =   196 bits (497),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 125/184 (68%), Gaps = 3/184 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLR-RI--YDPCTERHSTIYFNLPEVQKALHVH  511
            YSI+TP+C +  +  S +   R  K  LLR RI  YDPCTE ++  Y+N P+VQKA+H +
Sbjct  69   YSIYTPSCIQLQNNKSNLRPLRLFKNTLLRGRISGYDPCTENYAEKYYNRPDVQKAMHAN  128

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T   ++W  CSD +   W+D  ++VL +Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S+
Sbjct  129  VTGIPYKWTACSDVLIKNWRDSESSVLPIYKELIAAGLRIWVFSGDTDSVVPVTATRFSL  188

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
              L L   + W PWY   QVGGWT+ Y GLTF  VRGAGH+V L +P+ A  L  SF+AG
Sbjct  189  SHLNLTVKTRWYPWYSGNQVGGWTEAYNGLTFATVRGAGHEVPLFQPRRAFILFRSFVAG  248

Query  150  TSMP  139
              +P
Sbjct  249  KELP  252



>ref|XP_010656616.1| PREDICTED: serine carboxypeptidase 24 isoform X2 [Vitis vinifera]
Length=381

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHT  508
            YSI+TP+C  +    S +   R +   + RR+  YDPCTE ++  Y+N P+VQKA+H ++
Sbjct  195  YSIYTPSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTENYAEKYYNRPDVQKAMHANS  253

Query  507  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
            T   ++W  CS  +  +W D   ++L +Y+ELI AGLRIWVFSGDTDAV+PVT+TR+S++
Sbjct  254  TGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVVPVTATRFSLN  313

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
             L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGH+V L +P  A  L  SFL G 
Sbjct  314  HLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAFLLFRSFLGGK  373

Query  147  SMP  139
             +P
Sbjct  374  QLP  376



>ref|XP_008394313.1| PREDICTED: LOW QUALITY PROTEIN: serine carboxypeptidase 24-like 
[Malus domestica]
Length=472

 Score =   200 bits (509),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 127/184 (69%), Gaps = 6/184 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHVH  511
            YSI+TP C    +   R L+ ++    LLRR    YDPCTE ++  Y+N P+VQKA+H +
Sbjct  289  YSIYTPFCVTMLNNTKRHLRLKN---SLLRRRASGYDPCTENYAEKYYNRPDVQKAMHAN  345

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T   ++W  CSD +Y++W D   +VL  Y+ELI AGLRIWVFSGDTD+V+PVT+TR+S+
Sbjct  346  VTRIPYKWTACSDVLYEYWXDSEYSVLPTYKELIAAGLRIWVFSGDTDSVVPVTATRFSL  405

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
            + L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L + +  LTL +SFLAG
Sbjct  406  NHLNLTIKTPWYPWYSGRQVGGWTEVYDGLTFATVRGAGHEVPLIQAERGLTLFKSFLAG  465

Query  150  TSMP  139
              +P
Sbjct  466  KKLP  469



>ref|XP_008790133.1| PREDICTED: serine carboxypeptidase II-2 isoform X2 [Phoenix dactylifera]
Length=441

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/189 (53%), Positives = 118/189 (62%), Gaps = 32/189 (17%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSIFTP+C  S +     L +R    G     YDPCTE+HST+YFNLPEVQKALHV+   
Sbjct  285  YSIFTPSCPGSVTFSKNKLLKRLHSFGRAGEKYDPCTEKHSTVYFNLPEVQKALHVNPAV  344

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
            +  +W TCS                                GDTDAVIPV STRYS+D+L
Sbjct  345  APSKWETCS--------------------------------GDTDAVIPVASTRYSVDSL  372

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
            KLPTV+PW  WYD+GQVGGWTQ Y+GLTFV VRGAGH+V LHRPK AL L +SFL+G+ M
Sbjct  373  KLPTVTPWHAWYDDGQVGGWTQVYKGLTFVTVRGAGHEVPLHRPKQALVLFKSFLSGSPM  432

Query  141  PGLQRISDS  115
            P L    DS
Sbjct  433  PTLSEFDDS  441



>ref|XP_009358427.1| PREDICTED: serine carboxypeptidase 24 [Pyrus x bretschneideri]
Length=472

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 96/187 (51%), Positives = 127/187 (68%), Gaps = 6/187 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI---YDPCTERHSTIYFNLPEVQKALHVH  511
            YSI+TP C    +   R L+ ++    LLRR    YDPCTE ++  Y+N P+VQKA+H +
Sbjct  289  YSIYTPFCLTMLNNRKRHLRLKNT---LLRRRASGYDPCTENYAEKYYNRPDVQKAMHAN  345

Query  510  TTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSI  331
             T   ++W  CSD ++ +WKD   +VL  Y+ELI AGLRIWVFSGDTD+V+PVT+TR S+
Sbjct  346  VTRIPYKWTACSDVLFKYWKDSEYSVLPTYKELIAAGLRIWVFSGDTDSVVPVTATRLSL  405

Query  330  DALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAG  151
            + L L   +PW PWY   QVGGWT+ Y+GLTF  VRGAGH+V L + +  LTL +SFLAG
Sbjct  406  NHLNLTIKTPWYPWYSGSQVGGWTEVYDGLTFATVRGAGHEVPLIQAERGLTLFKSFLAG  465

Query  150  TSMPGLQ  130
              +P L 
Sbjct  466  KKLPKLN  472



>ref|XP_004288721.2| PREDICTED: serine carboxypeptidase 24 [Fragaria vesca subsp. 
vesca]
Length=470

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 122/181 (67%), Gaps = 2/181 (1%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIYDPCTERHSTIYFNLPEVQKALHVHTTN  502
            YSI+TP C    +  +R L  R +   L RR YDPC+E ++  Y+N P+VQKA+H + T 
Sbjct  289  YSIYTPFCLTQITNSARNL--RLKNTLLCRRGYDPCSENYAEKYYNRPDVQKAMHANITK  346

Query  501  SSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSIDAL  322
              ++W  CSD +   W D   ++L  Y+EL+ AGL+IWVFSGDTD+V+PVT+TR+S+  L
Sbjct  347  IPYKWTACSDTLIKNWNDSEDSMLPTYKELMAAGLKIWVFSGDTDSVVPVTATRFSLSHL  406

Query  321  KLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGTSM  142
             L   +PW PWY  GQVGGWT+ Y GLTF  +RGAGH+V L +PK A  L +SFLAG  +
Sbjct  407  NLTIKTPWYPWYTGGQVGGWTEVYHGLTFATIRGAGHEVPLFQPKRAFVLFQSFLAGKQL  466

Query  141  P  139
            P
Sbjct  467  P  467



>emb|CAN79972.1| hypothetical protein VITISV_010072 [Vitis vinifera]
Length=434

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 124/183 (68%), Gaps = 3/183 (2%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI--YDPCTERHSTIYFNLPEVQKALHVHT  508
            YSI+TP+C  +    S +   R +   + RR+  YDPCTE ++  Y+N P+VQKA+H ++
Sbjct  248  YSIYTPSCM-ALPNSSTIRSPRFKNSLVRRRVSGYDPCTENYAEKYYNRPDVQKAMHANS  306

Query  507  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
            T   ++W  CS  +  +W D   ++L +Y+ELI AGLRIWVFSGDTDAV+PVT+TR+S++
Sbjct  307  TGIPYKWTACSGVLIKYWNDSEASMLPIYKELIEAGLRIWVFSGDTDAVVPVTATRFSLN  366

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
             L L   +PW PWY  GQVGGWT+ YEGLTF  VRGAGH+V L +P  A  L  SFL G 
Sbjct  367  HLNLTVKTPWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPMRAFHLFRSFLGGK  426

Query  147  SMP  139
             +P
Sbjct  427  QLP  429



>ref|XP_006297594.1| hypothetical protein CARUB_v10013616mg [Capsella rubella]
 gb|EOA30492.1| hypothetical protein CARUB_v10013616mg [Capsella rubella]
Length=472

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 94/188 (50%), Positives = 128/188 (68%), Gaps = 7/188 (4%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLL-----RRI--YDPCTERHSTIYFNLPEVQKA  523
            Y+I+ P C +S         RR  ++  L     R+I  YDPCTER++ IY+N P+VQKA
Sbjct  283  YNIYAPPCNKSSDGGVGSSGRRSMRLPHLPHSVWRKISGYDPCTERYAEIYYNRPDVQKA  342

Query  522  LHVHTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTST  343
            LH +TTN  ++W  CS+ +   W D  ++VL +Y+E+I  G+R+WVFSGD D+V+PVT+T
Sbjct  343  LHANTTNIPYKWTACSEVLNRNWNDTDSSVLPIYREMIAGGIRVWVFSGDVDSVVPVTAT  402

Query  342  RYSIDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVES  163
            RYS+  L L T  PW PWY   QVGGWT+ YEGLTFV VRGAGH+V L +P++AL L + 
Sbjct  403  RYSLARLSLSTKVPWYPWYVKKQVGGWTEVYEGLTFVTVRGAGHEVPLFKPRVALELFKY  462

Query  162  FLAGTSMP  139
            FL+G  +P
Sbjct  463  FLSGKPLP  470



>emb|CDY39224.1| BnaA03g50360D [Brassica napus]
Length=463

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 124/185 (67%), Gaps = 7/185 (4%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRI----YDPCTERHSTIYFNLPEVQKALHV  514
            YSI+TPTC  S    +  L+ ++    LLRR     YDPCTE ++  Y+N  +VQ+A+H 
Sbjct  279  YSIYTPTCVASKQKKTGFLRMKNT---LLRRRFVSGYDPCTESYAEKYYNRKDVQRAMHA  335

Query  513  HTTNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYS  334
            + T   ++W  CSD +   WKD   T+L VY+EL  AGLRIWVFSGDTD+V+PVT+TR+S
Sbjct  336  NVTGIRYKWTACSDVLIKNWKDSDKTMLPVYKELAAAGLRIWVFSGDTDSVVPVTATRFS  395

Query  333  IDALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLA  154
            +  L LP  + W PWY   QVGGWT+ Y+GLTF  VRGAGH+V L  PK AL L +SFLA
Sbjct  396  LSHLNLPVKTRWYPWYSGNQVGGWTEVYKGLTFATVRGAGHEVPLFEPKRALILFKSFLA  455

Query  153  GTSMP  139
            G  +P
Sbjct  456  GKELP  460



>ref|XP_002440854.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
 gb|EES19284.1| hypothetical protein SORBIDRAFT_09g008660 [Sorghum bicolor]
Length=495

 Score =   199 bits (506),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/199 (51%), Positives = 130/199 (65%), Gaps = 18/199 (9%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVG----LLRRIYDPCTERHSTIYFNLPEVQKALHV  514
            YS++TPTC ++ S  S    RR R++      +R  YD CTERHST+Y+N PEVQ+ALH 
Sbjct  291  YSMYTPTCNQTSSSSSSSTPRRIRRLKGRYPWMRASYDTCTERHSTVYYNRPEVQRALHA  350

Query  513  HTTNSSFEW-------------VTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGD  373
            + T                      SD + + W D P ++L +Y+ELI AGLRIWVFSGD
Sbjct  351  NVTGIKLHMGHLQFGAYMHVLLNDSSDTISNNWGDSPKSMLHIYKELIAAGLRIWVFSGD  410

Query  372  TDAVIPVTSTRYSIDALKLPTVSPWRPWYDN-GQVGGWTQEYEGLTFVAVRGAGHKVALH  196
            TD+V+P+T+TRYSIDAL LPTV  W PWYD+  +VGGW++ Y GLT V VRGAGH+V LH
Sbjct  411  TDSVVPLTATRYSIDALDLPTVVSWYPWYDDIKEVGGWSKVYNGLTLVTVRGAGHEVPLH  470

Query  195  RPKLALTLVESFLAGTSMP  139
            RP+ AL L + FL G  MP
Sbjct  471  RPRQALMLFQHFLNGEPMP  489



>ref|XP_010265560.1| PREDICTED: serine carboxypeptidase 24-like isoform X2 [Nelumbo 
nucifera]
Length=425

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/183 (51%), Positives = 123/183 (67%), Gaps = 5/183 (3%)
 Frame = -3

Query  681  YSIFTPTCTESFSIMSRVLKRRDRKVGLLRRIY--DPCTERHSTIYFNLPEVQKALHVHT  508
            YSI+TP C  S +    +   R +   L RR+Y  DPCTE ++  Y+N P+VQKA+H + 
Sbjct  244  YSIYTPICKASKNTTRSI---RLKNTLLHRRVYGYDPCTENYAEKYYNRPDVQKAMHANA  300

Query  507  TNSSFEWVTCSDEVYDFWKDCPTTVLDVYQELITAGLRIWVFSGDTDAVIPVTSTRYSID  328
            T   + W  CSD +   WKD   ++L  Y+EL+  GLRIWVFSGDTD+V+PVT+TR+S++
Sbjct  301  TGIPYRWTACSDFLLKNWKDSQFSMLPTYKELMEGGLRIWVFSGDTDSVVPVTATRFSLN  360

Query  327  ALKLPTVSPWRPWYDNGQVGGWTQEYEGLTFVAVRGAGHKVALHRPKLALTLVESFLAGT  148
             L L   + W PWY  GQVGGWT+ YEGLTF  VRGAGH+V L +P+ ALTL  SFLAG 
Sbjct  361  HLNLTVKTRWYPWYSGGQVGGWTEVYEGLTFATVRGAGHEVPLFQPERALTLFRSFLAGA  420

Query  147  SMP  139
             +P
Sbjct  421  ELP  423



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060