BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039C05

Length=664
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009773066.1|  PREDICTED: elongation factor 1-alpha               244   1e-78   Nicotiana sylvestris
gb|AAR83865.1|  elongation factor 1-alpha                               245   2e-78   Capsicum annuum
ref|XP_010458012.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    241   5e-77   Camelina sativa [gold-of-pleasure]
dbj|BAD95246.1|  translation elongation factor eEF-1 alpha chain        240   5e-77   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH20400.1|  AT1G07940                                              240   1e-76   Arabidopsis thaliana [mouse-ear cress]
gb|AAQ90154.1|  putative translation elongation factor protein          243   2e-76   Solanum tuberosum [potatoes]
ref|XP_006307730.1|  hypothetical protein CARUB_v100096370mg            240   2e-76   
dbj|BAO57272.1|  elongation factor 1-alpha                              248   4e-76   Ipomoea nil [qian niu]
gb|ACF81592.1|  unknown                                                 239   6e-76   Zea mays [maize]
gb|ABW74483.1|  elongation factor                                       239   8e-76   Paeonia suffruticosa [moutan peony]
emb|CAA09041.1|  elongation factor 1-alpha                              236   1e-75   Cicer arietinum [garbanzo]
gb|AAT72900.1|  elongation factor 1A SMV resistance-related protein     238   1e-75   Glycine max [soybeans]
gb|AAC06383.1|  elongation factor 1 alpha                               236   2e-75   Malus domestica [apple tree]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          246   3e-75   Nicotiana tomentosiformis
dbj|BAF75826.1|  hypothetical protein                                   236   5e-75   Malus domestica [apple tree]
gb|KJB73626.1|  hypothetical protein B456_011G2412002                   236   6e-75   Gossypium raimondii
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    245   6e-75   Nicotiana tabacum [American tobacco]
dbj|BAA34348.1|  elongation factor-1 alpha                              244   7e-75   Nicotiana paniculata
gb|ABB02622.1|  elongation factor 1-alpha-like protein                  243   7e-75   Solanum tuberosum [potatoes]
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               244   8e-75   Nicotiana sylvestris
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          244   8e-75   Solanum lycopersicum
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               244   8e-75   Nicotiana tomentosiformis
ref|NP_001275420.1|  elongation factor 1-alpha-like protein             243   8e-75   Solanum tuberosum [potatoes]
gb|ABB86283.1|  elongation factor-1 alpha-like                          244   1e-74   Solanum tuberosum [potatoes]
ref|NP_001275481.1|  elongation factor 1-alpha-like                     244   1e-74   Solanum tuberosum [potatoes]
ref|NP_001234035.1|  elongation factor 1-alpha                          244   1e-74   Solanum lycopersicum
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             244   1e-74   Solanum tuberosum [potatoes]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          244   1e-74   Solanum tuberosum [potatoes]
dbj|BAC23049.1|  Elongation factor 1-alpha                              244   2e-74   Solanum tuberosum [potatoes]
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               244   2e-74   Nicotiana tomentosiformis
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          243   2e-74   Nicotiana sylvestris
gb|AGH55661.1|  elongation factor 1-alpha                               240   3e-74   Atropa belladonna [deadly nightshade]
ref|XP_007015467.1|  GTP binding Elongation factor Tu family prot...    240   3e-74   
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          243   3e-74   Nicotiana sylvestris
gb|AFW76429.1|  putative translation elongation factor Tu family ...    238   4e-74   
dbj|BAN42602.1|  putative elongation factor 1-alpha                     235   4e-74   Pyrus pyrifolia var. culta [Asian pear]
dbj|BAF75825.1|  hypothetical protein                                   234   4e-74   Malus domestica [apple tree]
gb|AHE76183.1|  elongation factor 1-alpha                               243   5e-74   Chrysanthemum indicum
ref|XP_006304901.1|  hypothetical protein CARUB_v100092941mg            239   5e-74   
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          243   5e-74   Solanum tuberosum [potatoes]
gb|AAN77897.1|  elongation factor 1 alpha                               243   5e-74   Stevia rebaudiana
gb|KJB73628.1|  hypothetical protein B456_011G2414001                   231   9e-74   Gossypium raimondii
gb|KJB53395.1|  hypothetical protein B456_009G4199001                   237   9e-74   Gossypium raimondii
emb|CAD60652.1|  elongation factor                                      242   1e-73   Solanum tuberosum [potatoes]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    242   1e-73   
emb|CDX70032.1|  BnaA10g23810D                                          238   1e-73   
gb|AIX10769.1|  elongation factor 1 alpha                               241   1e-73   Panax notoginseng [san-qi]
dbj|BAL14665.1|  elongation factor 1-alpha                              241   1e-73   Chrysanthemum seticuspe f. boreale
gb|KJB53396.1|  hypothetical protein B456_009G4199001                   238   1e-73   Gossypium raimondii
gb|ABV26710.1|  elongation factor 1 alpha                               241   1e-73   Gerbera hybrid cultivar
gb|AGZ15393.1|  elongation factor 1-alpha                               236   2e-73   Phaseolus vulgaris [French bean]
emb|CAL25349.1|  elongation factor 1 alpha                              233   2e-73   Platanus x hispanica [London plane tree]
gb|EEE58429.1|  hypothetical protein OsJ_09630                          240   2e-73   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    241   3e-73   Theobroma cacao [chocolate]
gb|AAC15413.1|  translation elongation factor-1 alpha                   241   3e-73   Oryza sativa Japonica Group [Japonica rice]
gb|KHG20498.1|  Elongation factor 1-alpha                               241   3e-73   Gossypium arboreum [tree cotton]
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          241   3e-73   Sesamum indicum [beniseed]
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          241   3e-73   Tarenaya hassleriana [spider flower]
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          240   3e-73   Tarenaya hassleriana [spider flower]
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          240   3e-73   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA23658.1|  EF-1 alpha                                             240   3e-73   Oryza sativa [red rice]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          240   3e-73   Oryza brachyantha
ref|NP_001049145.1|  Os03g0177400                                       240   3e-73   
emb|CAA06245.1|  elongation factor 1-alpha (EF1-a)                      236   4e-73   Cicer arietinum [garbanzo]
gb|KDP29082.1|  hypothetical protein JCGZ_16471                         234   4e-73   Jatropha curcas
emb|CAA65453.1|  elongation factor                                      234   4e-73   Narcissus pseudonarcissus
dbj|BAN42601.1|  putative elongation factor 1-alpha                     232   4e-73   Pyrus pyrifolia var. culta [Asian pear]
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             240   4e-73   Eutrema salsugineum [saltwater cress]
dbj|BAH56641.1|  elongation factor 1a                                   237   5e-73   Nelumbo nucifera [Indian lotus]
emb|CDY22710.1|  BnaC08g43440D                                          239   6e-73   Brassica napus [oilseed rape]
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               240   6e-73   Tarenaya hassleriana [spider flower]
gb|AID52924.1|  elongation factor 1-alpha                               239   7e-73   Carthamus tinctorius
emb|CDY61938.1|  BnaCnng38780D                                          239   7e-73   Brassica napus [oilseed rape]
gb|KJB09231.1|  hypothetical protein B456_001G130700                    239   8e-73   Gossypium raimondii
gb|AGZ90153.1|  elongation factor 1-alpha                               233   9e-73   Litsea cubeba [may chang]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    239   9e-73   Theobroma cacao [chocolate]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               239   9e-73   Tarenaya hassleriana [spider flower]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             239   1e-72   Brassica rapa
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             239   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        239   1e-72   Brassica rapa
dbj|BAF02151.1|  elongation factor 1-alpha                              239   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16628.1|  elongation factor 1 alpha                               238   1e-72   Saccharum hybrid cultivar R570
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             239   1e-72   Capsella rubella
ref|NP_200847.1|  elongation factor 1-alpha 4                           239   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        239   1e-72   Brassica rapa
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    239   1e-72   Arabidopsis thaliana [mouse-ear cress]
emb|CAA34456.1|  elongation factor 1-alpha                              239   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    239   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AGT16893.1|  elongation factor 1-alpha                               239   1e-72   Saccharum hybrid cultivar R570
gb|AAL57653.1|  At1g07930/T6D22_3                                       239   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AAK82537.1|  At1g07930/T6D22_3                                       239   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|AGJ50595.1|  EF1alpha                                                239   1e-72   Pericallis cruenta
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    239   1e-72   Setaria italica
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          239   1e-72   
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          239   2e-72   Tarenaya hassleriana [spider flower]
emb|CDX93604.1|  BnaA06g04440D                                          239   2e-72   
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   238   2e-72   Lilium longiflorum [Easter lily]
ref|XP_002518072.1|  elongation factor 1-alpha, putative                234   2e-72   Ricinus communis
ref|XP_002539209.1|  elongation factor 1-alpha, putative                234   2e-72   Ricinus communis
ref|WP_033581549.1|  elongation factor 1-alpha                          229   2e-72   
emb|CAN71914.1|  hypothetical protein VITISV_026485                     231   2e-72   Vitis vinifera
gb|ABA12218.1|  translation elongation factor 1A-2                      238   2e-72   Gossypium hirsutum [American cotton]
emb|CAL07988.1|  translation elongation factor 1 alpha                  231   2e-72   Platanus x hispanica [London plane tree]
ref|NP_001152668.1|  LOC100286309                                       238   2e-72   Zea mays [maize]
gb|ABA12220.1|  translation elongation factor 1A-4                      238   2e-72   Gossypium hirsutum [American cotton]
gb|AGH32502.1|  translation elongation factor-1 alpha                   238   2e-72   Stylosanthes guianensis [stylo]
gb|ACR38047.1|  unknown                                                 238   2e-72   Zea mays [maize]
gb|AAL79775.1|  elongation factor 1 alpha                               238   2e-72   Saccharum hybrid cultivar CP72-2086
gb|ABA12217.1|  translation elongation factor 1A-1                      238   2e-72   Gossypium hirsutum [American cotton]
gb|AFC88830.1|  putative elongation factor 1-alpha                      238   2e-72   Miscanthus sinensis
emb|CDX95108.1|  BnaC05g05630D                                          239   3e-72   
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               238   3e-72   Elaeis guineensis
gb|ABU63160.1|  elongation factor                                       238   3e-72   Saccharum officinarum [noble cane]
gb|KGN47308.1|  hypothetical protein Csa_6G290890                       233   3e-72   Cucumis sativus [cucumbers]
gb|KHG26926.1|  Elongation factor 1-alpha                               238   3e-72   Gossypium arboreum [tree cotton]
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               238   3e-72   Fragaria vesca subsp. vesca
gb|ABA12221.1|  translation elongation factor 1A-5                      238   3e-72   Gossypium hirsutum [American cotton]
ref|NP_001288407.1|  elongation factor 1-alpha-like                     238   3e-72   Zea mays [maize]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    238   3e-72   Daucus carota [carrots]
gb|KHN18669.1|  Elongation factor 1-alpha                               238   4e-72   Glycine soja [wild soybean]
ref|XP_008465824.1|  PREDICTED: elongation factor 1-alpha-like          232   4e-72   Cucumis melo [Oriental melon]
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    238   4e-72   Zea mays [maize]
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     238   4e-72   Saccharum hybrid cultivar CP65-357
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          238   4e-72   Nelumbo nucifera [Indian lotus]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         238   4e-72   
gb|AGY80449.1|  elongation factor 1-alpha                               238   4e-72   Dendrocalamus latiflorus [sweet bamboo]
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          238   4e-72   Zea mays [maize]
gb|AFY06644.1|  elongation factor 1-alpha                               234   4e-72   Carica papaya [mamon]
ref|NP_001237425.1|  elongation factor-1A                               238   4e-72   
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  238   4e-72   Citrus sinensis [apfelsine]
gb|AAX54511.1|  elongation factor 1 alpha                               238   4e-72   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             238   4e-72   Citrus clementina [clementine]
gb|ADC68236.1|  elongation factor 1-alpha                               231   4e-72   Dendrobium nobile
gb|ABS10822.1|  elongation factor 1-alpha                               229   4e-72   Phaseolus vulgaris [French bean]
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    238   4e-72   Glycine max [soybeans]
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    237   5e-72   Eucalyptus grandis [rose gum]
gb|ACG34498.1|  elongation factor 1-alpha                               237   5e-72   Zea mays [maize]
gb|ABA12222.1|  translation elongation factor 1A-6                      237   5e-72   Gossypium hirsutum [American cotton]
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          237   5e-72   Cicer arietinum [garbanzo]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    237   5e-72   
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          237   5e-72   Tarenaya hassleriana [spider flower]
gb|ACS68200.1|  elongation factor 1 alpha                               237   5e-72   Brassica napus [oilseed rape]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    237   6e-72   Eucalyptus grandis [rose gum]
ref|NP_001105933.1|  elongation factor alpha2                           237   7e-72   
ref|NP_001105617.1|  elongation factor alpha3                           237   7e-72   Zea mays [maize]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          237   8e-72   Setaria italica
emb|CDY58828.1|  BnaAnng15460D                                          240   8e-72   Brassica napus [oilseed rape]
ref|XP_008783723.1|  PREDICTED: elongation factor 1-alpha isoform X2    232   8e-72   
ref|NP_001105587.1|  elongation factor 1-alpha                          237   8e-72   Zea mays [maize]
gb|ADI24333.1|  elongation factor 1-alpha                               237   8e-72   Miscanthus sinensis
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        237   8e-72   Salsola komarovii
gb|ABA12225.1|  translation elongation factor 1A-9                      237   8e-72   Gossypium hirsutum [American cotton]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    237   8e-72   Zea mays [maize]
ref|NP_001288465.1|  elongation factor 1-alpha-like                     237   8e-72   Zea mays [maize]
gb|KHG01531.1|  Elongation factor 1-alpha                               237   9e-72   Gossypium arboreum [tree cotton]
gb|KHG23927.1|  Elongation factor 1-alpha                               237   9e-72   Gossypium arboreum [tree cotton]
dbj|BAH19898.1|  AT1G07930                                              237   9e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               236   9e-72   Elaeis guineensis
gb|AEN79476.1|  elongation factor 1-alpha                               236   9e-72   Ziziphus jujuba [Chinese jujube]
gb|AFW77593.1|  putative translation elongation factor Tu family ...    236   9e-72   
gb|KGN61480.1|  hypothetical protein Csa_2G139820                       233   9e-72   Cucumis sativus [cucumbers]
emb|CAJ38380.1|  translation elongation factor 1 alpha                  230   1e-71   Plantago major [cart-track plant]
dbj|BAC66180.1|  elongation factor 1A                                   236   1e-71   Avicennia marina
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               236   1e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002528020.1|  elongation factor 1-alpha, putative                233   1e-71   
gb|AAF63516.1|AF242732_1  translation elongation factor 1a              236   1e-71   Capsicum annuum
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        236   1e-71   Brassica rapa
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          236   1e-71   Eucalyptus grandis [rose gum]
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         235   1e-71   Jatropha curcas
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    236   1e-71   Sesamum indicum [beniseed]
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               236   1e-71   Sesamum indicum [beniseed]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          236   1e-71   Elaeis guineensis
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             236   2e-71   Citrus clementina [clementine]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    236   2e-71   Glycine max [soybeans]
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     236   2e-71   Glycine max [soybeans]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               236   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          236   2e-71   Eucalyptus grandis [rose gum]
gb|KHN42761.1|  Elongation factor 1-alpha                               236   2e-71   Glycine soja [wild soybean]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          236   2e-71   Pyrus x bretschneideri [bai li]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          236   2e-71   Fragaria vesca subsp. vesca
gb|KHN14872.1|  Elongation factor 1-alpha                               236   2e-71   Glycine soja [wild soybean]
gb|KHG28979.1|  Elongation factor 1-alpha                               236   2e-71   Gossypium arboreum [tree cotton]
gb|ACG31866.1|  elongation factor 1-alpha                               236   2e-71   Zea mays [maize]
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    236   2e-71   Pisum sativum [garden pea]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               236   2e-71   Malus domestica [apple tree]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             236   2e-71   Phaseolus vulgaris [French bean]
gb|ABA12219.1|  translation elongation factor 1A-3                      236   2e-71   Gossypium hirsutum [American cotton]
ref|NP_001105565.1|  elongation factor alpha5                           235   3e-71   
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   235   3e-71   Lilium longiflorum [Easter lily]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               235   3e-71   Cucumis melo [Oriental melon]
gb|KJB48746.1|  hypothetical protein B456_008G084000                    234   3e-71   Gossypium raimondii
gb|AHB86963.1|  elongation factor 1-alpha                               235   4e-71   Sedum alfredii
gb|AAR82894.1|  elongation factor 1-alpha                               235   4e-71   Cichorium intybus [radicchio]
gb|ABA12223.1|  translation elongation factor 1A-7                      235   4e-71   Gossypium hirsutum [American cotton]
gb|AAL32631.1|  putative elongation factor 1-a                          235   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               235   4e-71   Phoenix dactylifera
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             235   4e-71   Prunus persica
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          235   4e-71   Malus domestica [apple tree]
gb|AEQ75495.1|  elongation factor 1-alpha                               235   4e-71   Rosa multiflora [Japanese rose]
gb|KDP29084.1|  hypothetical protein JCGZ_16473                         233   4e-71   Jatropha curcas
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               235   4e-71   Prunus mume [ume]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    235   4e-71   Vicia faba [broad bean]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          235   5e-71   Phoenix dactylifera
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    235   5e-71   Populus euphratica
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          235   5e-71   Populus euphratica
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    235   5e-71   Theobroma cacao [chocolate]
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    235   5e-71   Populus euphratica
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  234   5e-71   Solanum tuberosum [potatoes]
gb|KHG24249.1|  Elongation factor 1-alpha                               233   5e-71   Gossypium arboreum [tree cotton]
gb|KJB48747.1|  hypothetical protein B456_008G084000                    234   5e-71   Gossypium raimondii
gb|KHG27341.1|  Elongation factor 1-alpha                               234   5e-71   Gossypium arboreum [tree cotton]
ref|XP_011031786.1|  PREDICTED: elongation factor 1-alpha-like          231   6e-71   Populus euphratica
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               234   6e-71   Cucumis melo [Oriental melon]
gb|KEH43533.1|  GTP-binding elongation factor Tu family protein         231   6e-71   Medicago truncatula
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          234   7e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               234   8e-71   Vitis vinifera
gb|ABR16818.1|  unknown                                                 225   8e-71   Picea sitchensis
gb|AHA84124.1|  elongation factor 1-alpha                               234   8e-71   Phaseolus vulgaris [French bean]
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          234   8e-71   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001290506.1|  elongation factor 1-alpha                          234   8e-71   Elaeis guineensis
gb|ABA12224.1|  translation elongation factor 1A-8                      234   8e-71   Gossypium hirsutum [American cotton]
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         234   9e-71   Jatropha curcas
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             234   9e-71   Prunus persica
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          234   9e-71   Eucalyptus grandis [rose gum]
gb|AEI29162.1|  EF1a-like protein                                       233   9e-71   Phalaenopsis hybrid cultivar
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          234   9e-71   Amborella trichopoda
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     234   9e-71   Glycine max [soybeans]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             234   9e-71   Phaseolus vulgaris [French bean]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             234   1e-70   Citrus clementina [clementine]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   234   1e-70   Ornithogalum longebracteatum [sea-onion]
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         234   1e-70   Jatropha curcas
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   234   1e-70   Lilium longiflorum [Easter lily]
dbj|BAM13874.1|  elongation factor 1 alpha                              234   1e-70   Symplocarpus renifolius
gb|AAL69396.1|  elongation factor 1-alpha                               234   1e-70   Elaeis oleifera
ref|XP_002518073.1|  elongation factor 1-alpha, putative                234   1e-70   Ricinus communis
ref|XP_002528028.1|  elongation factor 1-alpha, putative                234   1e-70   
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               234   1e-70   Vitis vinifera
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          234   1e-70   Elaeis guineensis
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        234   1e-70   Suaeda japonica
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          234   1e-70   
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          234   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          234   1e-70   Phoenix dactylifera
gb|ABF00115.1|  elongation factor 1-alpha                               233   1e-70   Litchi chinensis [litchi]
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          234   1e-70   Cucumis sativus [cucumbers]
gb|AGC94754.1|  elongation factor 1 alpha                               233   1e-70   Euphorbia lathyris
gb|ACI96243.1|  elongation factor 1-alpha                               233   1e-70   Prunus persica
gb|KJB76528.1|  hypothetical protein B456_012G093800                    233   1e-70   Gossypium raimondii
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    233   1e-70   
gb|AAY56337.1|  elongation factor-1 alpha                               233   2e-70   Musa acuminata [banana]
gb|AFP44110.1|  elongation factor 1-alpha                               233   2e-70   Lycoris longituba
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    233   2e-70   
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          233   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105935.1|  elongation factor alpha8                           233   2e-70   
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          233   2e-70   Cucumis sativus [cucumbers]
ref|NP_001183947.1|  uncharacterized protein LOC100502553               231   2e-70   
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               233   2e-70   Eucalyptus grandis [rose gum]
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             233   3e-70   Prunus persica
gb|AGD99674.1|  eukaryotic elongation factor 1A                         233   3e-70   Salicornia bigelovii
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          233   3e-70   Phoenix dactylifera
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        233   3e-70   Hevea brasiliensis [jebe]
dbj|BAM13877.1|  elongation factor 1 alpha                              233   3e-70   Arum maculatum [cuckoo-pint]
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               233   3e-70   Prunus mume [ume]
ref|XP_003604823.1|  Elongation factor 1-alpha                          233   3e-70   
gb|AFJ04514.1|  elongation factor 1-alpha                               232   3e-70   Vernicia fordii [tung oil tree]
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         233   3e-70   Medicago truncatula
gb|ADW83729.1|  elongation factor 1-alpha                               224   4e-70   Musa acuminata AAA Group [Cavendish banana]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               233   4e-70   Fragaria vesca subsp. vesca
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          232   4e-70   Elaeis guineensis
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          232   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             232   4e-70   
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        232   4e-70   Hevea brasiliensis [jebe]
ref|XP_003588821.1|  Elongation factor 1-alpha                          233   4e-70   
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          232   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|AIM48895.1|  elongation factor 1-alpha                               232   5e-70   Cinnamomum camphora
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          232   5e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    232   5e-70   
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          232   5e-70   Elaeis guineensis
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         232   6e-70   Medicago truncatula
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         232   6e-70   Medicago truncatula
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          232   6e-70   
gb|ABD66072.1|  elongation factor 1-alpha                               226   6e-70   
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               232   6e-70   
dbj|BAL41369.1|  elongation factor 1-alpha                              221   6e-70   
ref|NP_001151074.1|  elongation factor 1-alpha                          232   6e-70   
gb|AAV92325.1|  translation elongation factor-1 alpha                   226   6e-70   
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        232   6e-70   
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               232   7e-70   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          232   7e-70   
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    232   7e-70   
gb|KGN51228.1|  Elongation factor 1-alpha                               230   7e-70   
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          231   7e-70   
gb|ABD66517.1|  EF-1 alpha                                              231   1e-69   
gb|KGN51227.1|  hypothetical protein Csa_5G495940                       228   1e-69   
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         231   1e-69   
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          231   1e-69   
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          231   1e-69   
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          231   1e-69   
gb|EPS66340.1|  elongation factor 1-alpha                               231   1e-69   
ref|NP_001104938.1|  elongation factor 1 alpha                          231   1e-69   
gb|AGV54713.1|  elongation factor 1-alpha                               231   1e-69   
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    231   1e-69   
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             231   2e-69   
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                231   2e-69   
ref|NP_001280807.1|  elongation factor 1-alpha-like                     231   2e-69   
ref|XP_002311107.1|  ADR12-2 family protein                             231   2e-69   
ref|XP_002892424.1|  T6D22.2                                            239   2e-69   
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             231   2e-69   
ref|XP_002312029.1|  ADR12-2 family protein                             231   2e-69   
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               230   2e-69   
ref|XP_001763198.1|  predicted protein                                  228   2e-69   
gb|AGI15328.1|  elongation factor 1                                     230   2e-69   
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             230   3e-69   
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          230   3e-69   
gb|AAF79822.1|AC026875_2  T6D22.2                                       239   3e-69   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    229   3e-69   
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    233   3e-69   
ref|XP_008782124.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    221   3e-69   
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        230   4e-69   
ref|XP_003591959.1|  Elongation factor 1-alpha                          233   5e-69   
gb|ADK73624.1|  elongation factor 1 alpha                               225   5e-69   
gb|AAP80665.1|AF479046_1  elongation factor-1 alpha                     219   5e-69   
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          229   5e-69   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             229   5e-69   
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             229   5e-69   
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             229   6e-69   
ref|XP_009917077.1|  PREDICTED: elongation factor 1-alpha 1             226   6e-69   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             229   6e-69   
ref|XP_002311106.1|  ADR12-2 family protein                             229   6e-69   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             229   6e-69   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             229   6e-69   
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          229   7e-69   
gb|EPS66069.1|  elongation factor 1-alpha                               229   7e-69   
gb|AAF99703.1|  elongation factor                                       229   9e-69   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    229   1e-68   
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          228   1e-68   
ref|XP_001766482.1|  predicted protein                                  228   1e-68   
ref|NP_001104939.1|  elongation factor alpha6                           228   2e-68   
ref|NP_001105934.1|  elongation factor alpha7                           228   2e-68   
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               228   2e-68   
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          228   3e-68   
ref|XP_003604587.1|  Elongation factor 1-alpha                          227   5e-68   
ref|XP_001763194.1|  predicted protein                                  227   5e-68   
ref|XP_001763201.1|  predicted protein                                  227   5e-68   
ref|XP_001753181.1|  predicted protein                                  227   5e-68   
ref|XP_001753167.1|  predicted protein                                  227   5e-68   
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 226   6e-68   
ref|XP_006373866.1|  hypothetical protein POPTR_0016s08780g             225   8e-68   
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    226   8e-68   
emb|CAC27139.1|  translation elongation factor-1 alpha                  226   9e-68   
gb|ACN41180.1|  unknown                                                 226   9e-68   
gb|EMS52529.1|  Elongation factor 1-alpha                               226   1e-67   
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    234   1e-67   
gb|ABK25072.1|  unknown                                                 226   1e-67   
gb|ACN40081.1|  unknown                                                 226   1e-67   
gb|EMS59091.1|  Elongation factor 1-alpha                               227   2e-67   
gb|ACN40740.1|  unknown                                                 225   3e-67   
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 225   3e-67   
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                225   3e-67   
gb|ABK24265.1|  unknown                                                 224   5e-67   
gb|AGI78242.1|  elongation factor 1 alpha                               224   7e-67   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   224   8e-67   
ref|XP_003618775.1|  Elongation factor 1-alpha                          231   1e-66   
gb|ABK24843.1|  unknown                                                 223   2e-66   
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    231   2e-66   
gb|EMS49772.1|  Elongation factor 1-alpha                               223   2e-66   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    222   3e-66   
gb|AER42621.1|  elongation factor 1 alpha                               222   3e-66   
gb|AHZ58493.1|  translation elongation factor alpha                     222   3e-66   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    222   3e-66   
gb|EMS65134.1|  Elongation factor 1-alpha                               226   4e-66   
ref|XP_001753059.1|  predicted protein                                  222   5e-66   
gb|KHG15275.1|  Elongation factor 1-alpha                               221   5e-66   
gb|ABR17675.1|  unknown                                                 222   5e-66   
gb|EMT12343.1|  Elongation factor 1-alpha                               221   6e-66   
gb|EMT09703.1|  Elongation factor 1-alpha                               227   1e-65   
gb|ABQ81942.1|  elongation factor 1-alpha                               213   2e-65   
gb|ABE01408.1|  translation elongation factor 1a-2                      208   6e-65   
gb|AEE98364.1|  elongation factor 1-alpha                               219   6e-65   
gb|AGO97079.1|  elongation factor 1-alpha                               211   7e-65   
ref|XP_010456401.1|  PREDICTED: elongation factor 1-alpha 1             208   8e-65   
gb|ABQ81936.1|  elongation factor 1-alpha                               217   2e-64   
gb|ABE01407.1|  translation elongation factor 1a-1                      207   2e-64   
dbj|BAK08744.1|  elongation factor 1-alpha                              217   3e-64   
dbj|BAK08818.1|  elongation factor 1-alpha                              217   4e-64   
gb|AJF94634.1|  elongation factor 1-alpha                               206   5e-64   
gb|AGO97080.1|  elongation factor 1-alpha                               208   6e-64   
gb|AGO97078.1|  elongation factor 1-alpha                               208   7e-64   
ref|NP_001077483.1|  elongation factor 1-alpha 2                        213   2e-63   
dbj|BAK08819.1|  elongation factor 1-alpha                              215   2e-63   
gb|AHZ44777.1|  elongation factor 1 alpha                               204   3e-63   
emb|CDX88757.1|  BnaA03g08920D                                          212   6e-63   
gb|KJB30602.1|  hypothetical protein B456_005G151200                    208   1e-62   
gb|AFN42763.1|  elongation factor 1-alpha                               206   2e-62   
gb|ABR25693.1|  putative elongation factor 1-alpha                      199   2e-61   
gb|ADP36952.1|  hypothetical protein                                    200   2e-61   
gb|AAO61852.1|  translation elongation factor-1 alpha                   207   5e-61   
gb|ABK26215.1|  unknown                                                 198   6e-61   
ref|XP_011069517.1|  PREDICTED: elongation factor 1-alpha               196   5e-60   
ref|XP_009387472.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    196   2e-59   
ref|XP_004173991.1|  PREDICTED: elongation factor 1-alpha-like          192   7e-59   
gb|ACL97363.1|  elongation factor-1 alpha                               202   1e-58   
dbj|BAH23674.1|  elongation factor 1-alpha                              194   1e-58   
emb|CEJ91279.1|  Putative Elongation factor 1-alpha                     202   2e-58   
gb|AAV34150.1|  EF-1 alpha                                              195   2e-58   
gb|EMS24916.1|  translation elongation factor EF-1 alpha subunit        192   3e-58   
emb|CEI96289.1|  Putative Elongation factor 1-alpha                     193   3e-58   
gb|ABL10112.1|  translation elongation factor 1-alpha                   193   3e-58   
ref|XP_005650451.1|  translation elongation factor                      201   6e-58   
gb|ACO50109.1|  elongation factor 1 alpha                               196   6e-58   
gb|EPY25861.1|  elongation factor 1-alpha                               198   6e-58   
gb|EPY33803.1|  elongation factor 1-alpha                               197   8e-58   
ref|XP_011125707.1|  hypothetical protein AOL_s00169g48                 199   2e-57   
emb|CDH51884.1|  elongation factor 1-alpha                              194   2e-57   
gb|EKG07919.1|  elongation factor 1-alpha (ef-1-alpha), putative        191   2e-57   
gb|KIO08245.1|  hypothetical protein M404DRAFT_997171                   199   3e-57   
gb|AIM46989.1|  translation elongation factor 1-alpha                   199   3e-57   
emb|CCX11704.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    195   3e-57   
gb|ACL97366.1|  elongation factor-1 alpha                               198   3e-57   
gb|ADG23104.1|  elongation factor 1-alpha                               190   4e-57   
ref|XP_007876992.1|  hypothetical protein PFL1_01298                    198   5e-57   
gb|KIJ68393.1|  hypothetical protein HYDPIDRAFT_185471                  198   6e-57   
gb|KIK43550.1|  hypothetical protein CY34DRAFT_699467                   198   6e-57   
emb|CCW70819.1|  unnamed protein product                                192   7e-57   
gb|EPY27955.1|  elongation factor 1-alpha                               197   8e-57   
ref|XP_002392294.1|  hypothetical protein MPER_08150                    194   9e-57   
ref|XP_003873869.1|  elongation factor 1-alpha                          191   9e-57   
gb|ACN60128.1|  translation elongation factor 1-alpha                   189   9e-57   
gb|ESA10680.1|  hypothetical protein GLOINDRAFT_348113                  198   9e-57   
gb|KDR85040.1|  hypothetical protein GALMADRAFT_233641                  198   9e-57   
gb|KFH03380.1|  elongation factor 1-alpha                               189   1e-56   
gb|ACO50110.1|  elongation factor 1 alpha                               197   1e-56   
ref|XP_003037261.1|  translation elongation factor 1a                   197   1e-56   
gb|ADB55729.1|  elongation factor 1-alpha                               198   1e-56   
sp|O42820.1|EF1A_SCHCO  RecName: Full=Elongation factor 1-alpha; ...    197   1e-56   
gb|EKF27061.1|  elongation factor 1-alpha (ef-1-alpha), putative        189   1e-56   
gb|KIK82926.1|  hypothetical protein PAXRUDRAFT_832117                  197   2e-56   
gb|AAF79371.1|AC007887_30  F15O4.37                                     202   2e-56   
dbj|GAK62779.1|  elongation factor 1-alpha                              189   2e-56   
gb|AJP13557.1|  translation elongation factor-1 alpha                   187   2e-56   
gb|ACO50115.1|  elongation factor 1 alpha                               196   2e-56   
gb|ABQ81935.1|  elongation factor 1-alpha                               196   2e-56   
ref|XP_007762783.1|  translation elongation factor 1a                   197   2e-56   
gb|AEG78376.1|  elongation factor 1 alpha                               190   3e-56   
ref|XP_007314394.1|  hypothetical protein SERLADRAFT_458623             196   3e-56   
ref|XP_002835319.1|  hypothetical protein                               193   3e-56   
gb|KIK71054.1|  hypothetical protein GYMLUDRAFT_33174                   196   3e-56   
emb|CBY16376.1|  unnamed protein product                                190   3e-56   
gb|KIO18434.1|  hypothetical protein M407DRAFT_16247                    195   4e-56   
ref|XP_006454380.1|  hypothetical protein AGABI2DRAFT_133083            196   4e-56   
gb|KIM66163.1|  hypothetical protein SCLCIDRAFT_111138                  196   4e-56   
gb|AJP77649.1|  elongation factor 1-alpha                               190   4e-56   
ref|XP_005941015.1|  PREDICTED: elongation factor 1-alpha-like          190   5e-56   
gb|AAZ81003.1|  eukaryotic translation elongation factor 1 alpha 1      187   5e-56   
emb|CCX05343.1|  Similar to Elongation factor 1-alpha; acc. no. Q...    196   5e-56   
gb|ACT36602.1|  elongation factor 1 alpha                               193   5e-56   
ref|XP_008712228.1|  elongation factor 1-alpha                          196   5e-56   
gb|KIJ45278.1|  hypothetical protein M422DRAFT_30129                    196   5e-56   
gb|KIJ21706.1|  hypothetical protein PAXINDRAFT_65274                   196   6e-56   
gb|AGW80518.1|  elongation factor 1-alpha 1                             187   6e-56   
gb|AAH12509.1|  EEF1A1 protein                                          187   6e-56   
gb|KIL70783.1|  hypothetical protein M378DRAFT_116001                   196   6e-56   
emb|CDP93913.1|  Protein Bm5195, isoform h                              188   6e-56   
ref|XP_001873214.1|  predicted protein                                  196   7e-56   
ref|XP_007298247.1|  translation elongation factor                      196   7e-56   
gb|EDL77720.1|  rCG25445, isoform CRA_b                                 187   7e-56   
gb|ABC75588.1|  elongation factor 1-alpha                               186   7e-56   
gb|ADK90073.1|  elongation factor 1 alpha                               195   8e-56   
ref|XP_822464.1|  elongation factor 1-alpha                             192   8e-56   
ref|XP_001551786.1|  elongation factor 1-alpha                          195   8e-56   
gb|KDQ12968.1|  hypothetical protein BOTBODRAFT_34109                   195   8e-56   
emb|CCO27325.1|  elongation factor EF-1 alpha subunit                   193   8e-56   
emb|CDH51795.1|  elongation factor 1-alpha                              195   9e-56   
gb|ESZ89813.1|  elongation factor 1-alpha                               195   9e-56   
gb|KIO31120.1|  hypothetical protein M407DRAFT_241866                   195   1e-55   
gb|KHJ95470.1|  putative translation elongation factor EF-1, subu...    192   1e-55   
gb|KIK28513.1|  hypothetical protein PISMIDRAFT_673531                  195   1e-55   
gb|KIM85280.1|  hypothetical protein PILCRDRAFT_96416                   195   1e-55   
gb|ACF70735.1|  eukaryotic translation elongation factor 1              187   1e-55   
sp|P28295.1|EF1A_ABSGL  RecName: Full=Elongation factor 1-alpha; ...    195   1e-55   
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     194   1e-55   
gb|KHJ34692.1|  putative elongation factor 1-alpha                      195   1e-55   
gb|EQB55271.1|  hypothetical protein CGLO_04815                         189   1e-55   
gb|KFX50753.1|  Elongation factor 1-alpha                               194   1e-55   
gb|KIM48158.1|  hypothetical protein M413DRAFT_439881                   194   1e-55   
ref|XP_007359855.1|  translation elongation factor 1a                   195   1e-55   
gb|ADO22142.1|  translation elongation factor 1 alpha                   194   1e-55   
gb|KJA29192.1|  hypothetical protein HYPSUDRAFT_61224                   195   1e-55   
gb|KFH65589.1|  elongation factor EF-1 alpha subunit                    191   1e-55   
gb|AHC00621.1|  tranlation elongation factor                            194   1e-55   
emb|CAI94748.1|  elongation factor                                      194   1e-55   
emb|CCC51157.1|  putative EF-1-alpha                                    194   1e-55   
ref|XP_008033061.1|  translation elongation factor                      194   2e-55   
emb|CCC51155.1|  putative elongation factor 1-alpha                     194   2e-55   
ref|XP_009547250.1|  hypothetical protein HETIRDRAFT_319829             194   2e-55   
ref|XP_002144043.1|  translation elongation factor EF-1 alpha sub...    194   2e-55   
gb|ABB46371.1|  elongation factor-1 alpha                               187   2e-55   
emb|CBQ70305.1|  probable translation elongation factor eEF-1 alp...    194   2e-55   
gb|ACL97367.1|  elongation factor-1 alpha                               194   2e-55   
ref|XP_001828758.1|  translation elongation factor 1 alpha              194   2e-55   
ref|XP_004622541.1|  PREDICTED: elongation factor 1-alpha-like          192   2e-55   



>ref|XP_009773066.1| PREDICTED: elongation factor 1-alpha, partial [Nicotiana sylvestris]
Length=149

 Score =   244 bits (624),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGA++FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  19   SKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  78

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  79   KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  138



>gb|AAR83865.1| elongation factor 1-alpha [Capsicum annuum]
Length=167

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  36   SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  95

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  96   KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  155



>ref|XP_010458012.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
Length=165

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  33   SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  92

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  93   KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  152



>dbj|BAD95246.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
Length=143

 Score =   240 bits (612),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  11   SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  70

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  71   KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  130



>dbj|BAH20400.1| AT1G07940 [Arabidopsis thaliana]
Length=186

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  54   SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  113

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  114  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  173



>gb|AAQ90154.1| putative translation elongation factor protein [Solanum tuberosum]
Length=287

 Score =   243 bits (621),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  156  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  215

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  216  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  275



>ref|XP_006307730.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
 gb|EOA40628.1| hypothetical protein CARUB_v100096370mg, partial [Capsella rubella]
Length=188

 Score =   240 bits (612),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  56   SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  115

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  116  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  175



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 119/120 (99%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ACF81592.1| unknown [Zea mays]
Length=184

 Score =   239 bits (609),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  54   SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  113

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  114  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  173



>gb|ABW74483.1| elongation factor [Paeonia suffruticosa]
Length=186

 Score =   239 bits (609),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  54   SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  113

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMR+TVAVGVIK+VDKKDPTG
Sbjct  114  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRRTVAVGVIKSVDKKDPTG  173



>emb|CAA09041.1| elongation factor 1-alpha [Cicer arietinum]
Length=130

 Score =   236 bits (602),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = -2

Query  660  KDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEK  481
            KDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEK
Sbjct  1    KDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEK  60

Query  480  EPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            EPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  61   EPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  119



>gb|AAT72900.1| elongation factor 1A SMV resistance-related protein [Glycine 
max]
Length=193

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  63   SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELE  122

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  123  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  182



>gb|AAC06383.1| elongation factor 1 alpha, partial [Malus domestica]
Length=143

 Score =   236 bits (601),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  13   SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  72

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  73   KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  132



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 117/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAF75826.1| hypothetical protein [Malus domestica]
Length=184

 Score =   236 bits (603),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  54   SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  113

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  114  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  173



>gb|KJB73626.1| hypothetical protein B456_011G2412002, partial [Gossypium raimondii]
Length=187

 Score =   236 bits (603),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  56   SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  115

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  116  KEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  175



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   245 bits (625),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGA+SFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|ABB02622.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   243 bits (621),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  269  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  328

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  329  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPSG  436



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   244 bits (624),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|NP_001275420.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABB16975.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=400

 Score =   243 bits (620),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  269  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  328

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  329  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  388



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|NP_001275481.1| elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB16996.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  318  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  377

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  378  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  437



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGA+SFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGASSFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGA++FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AGH55661.1| elongation factor 1-alpha, partial [Atropa belladonna]
Length=333

 Score =   240 bits (612),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFA +LTKIDRRSGKE+E
Sbjct  204  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAXILTKIDRRSGKEIE  263

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  264  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  323



>ref|XP_007015467.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
 gb|EOY33086.1| GTP binding Elongation factor Tu family protein isoform 2 [Theobroma 
cacao]
Length=348

 Score =   240 bits (613),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  216  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  275

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  276  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  335



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   243 bits (620),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGA++FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  436



>gb|AFW76429.1| putative translation elongation factor Tu family protein [Zea 
mays]
Length=293

 Score =   238 bits (607),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  163  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  222

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  223  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>dbj|BAN42602.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   235 bits (599),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  71   SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  130

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPT+PMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  131  KEPKFLKNGDAGMVKMLPTRPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  190



>dbj|BAF75825.1| hypothetical protein [Malus domestica]
Length=184

 Score =   234 bits (597),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK  A+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  54   SKDDPAKETANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  113

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  114  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  173



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_006304901.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
 gb|EOA37799.1| hypothetical protein CARUB_v100092941mg, partial [Capsella rubella]
Length=325

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  193  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  252

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  253  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  312



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   243 bits (619),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KJB73628.1| hypothetical protein B456_011G2414001, partial [Gossypium raimondii]
Length=131

 Score =   231 bits (590),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  657  DDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKE  478
            DDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKE
Sbjct  1    DDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEKE  60

Query  477  PKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            PKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  61   PKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  118



>gb|KJB53395.1| hypothetical protein B456_009G4199001 [Gossypium raimondii]
Length=300

 Score =   237 bits (605),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  170  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  229

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  230  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  289



>emb|CAD60652.1| elongation factor [Solanum tuberosum]
Length=447

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CDX70032.1| BnaA10g23810D [Brassica napus]
Length=344

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  212  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  271

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  272  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  331



>gb|AIX10769.1| elongation factor 1 alpha [Panax notoginseng]
Length=449

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  436



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|KJB53396.1| hypothetical protein B456_009G4199001, partial [Gossypium raimondii]
Length=322

 Score =   238 bits (606),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  192  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  251

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  252  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  311



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AGZ15393.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=305

 Score =   236 bits (603),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  163  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELE  222

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  223  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  282



>emb|CAL25349.1| elongation factor 1 alpha [Platanus x acerifolia]
Length=199

 Score =   233 bits (593),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  69   SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  128

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  129  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  188



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   240 bits (613),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  297  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  356

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  357  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  416



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKK+P+G
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKEPSG  436



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   241 bits (614),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABF94276.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94277.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=449

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  319  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  378

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  379  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  438



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>emb|CAA06245.1| elongation factor 1-alpha (EF1-a) [Cicer arietinum]
Length=326

 Score =   236 bits (603),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  196  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  255

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  256  KEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  315



>gb|KDP29082.1| hypothetical protein JCGZ_16471 [Jatropha curcas]
Length=247

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  117  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  176

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  177  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  236



>emb|CAA65453.1| elongation factor [Narcissus pseudonarcissus]
Length=242

 Score =   234 bits (596),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAV+FAE+LTKIDRRSGKELE
Sbjct  112  SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVRFAEILTKIDRRSGKELE  171

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPP+GRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  172  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPMGRFAVRDMRQTVAVGVIKSVEKKDPTG  231



>dbj|BAN42601.1| putative elongation factor 1-alpha, partial [Pyrus pyrifolia 
var. culta]
Length=201

 Score =   232 bits (592),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  71   SKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  130

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  131  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  190



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   240 bits (612),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAH56641.1| elongation factor 1a, partial [Nelumbo nucifera]
Length=355

 Score =   237 bits (605),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  236  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  295

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK VDKKDPTG
Sbjct  296  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVDKKDPTG  355



>emb|CDY22710.1| BnaC08g43440D [Brassica napus]
 emb|CDY22711.1| BnaC08g43450D [Brassica napus]
Length=427

 Score =   239 bits (610),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  295  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  354

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  355  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   240 bits (612),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   239 bits (611),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF EL+TKIDRRSGKE+E
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFQELVTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CDY61938.1| BnaCnng38780D [Brassica napus]
 emb|CDY34479.1| BnaC04g13200D [Brassica napus]
 emb|CDY10804.1| BnaA05g11320D [Brassica napus]
 emb|CDY09211.1| BnaA02g06370D [Brassica napus]
Length=428

 Score =   239 bits (609),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  296  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  355

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  356  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  415



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|AGZ90153.1| elongation factor 1-alpha, partial [Litsea cubeba]
Length=239

 Score =   233 bits (593),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  109  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  168

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  169  KEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  228



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDSGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>dbj|BAF02151.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AGT16628.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=399

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  269  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  328

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  329  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_009126609.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK25877.1|AF360167_1 putative translation elongation factor eEF-1 alpha chain A4 [Arabidopsis 
thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>emb|CAA34456.1| elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AAK82537.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMMPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX93604.1| BnaA06g04440D [Brassica napus]
Length=460

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  328  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  387

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  388  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  447



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_002518072.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44205.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  163  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  222

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  223  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|XP_002539209.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF23174.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=295

 Score =   234 bits (596),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  163  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  222

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  223  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|WP_033581549.1| elongation factor 1-alpha, partial [Dickeya zeae]
Length=147

 Score =   229 bits (583),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 115/117 (98%), Gaps = 0/117 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  31   SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIE  90

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKD  313
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKD
Sbjct  91   KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKD  147



>emb|CAN71914.1| hypothetical protein VITISV_026485 [Vitis vinifera]
Length=226

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+ TKIDRRSGKELE
Sbjct  96   SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEITTKIDRRSGKELE  155

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  156  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  215



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CAL07988.1| translation elongation factor 1 alpha [Platanus x acerifolia]
Length=236

 Score =   231 bits (590),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  106  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  165

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  166  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  225



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL79775.1| elongation factor 1 alpha [Saccharum hybrid cultivar CP72-2086]
Length=441

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  311  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  370

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  371  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  430



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   238 bits (607),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   239 bits (610),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  338  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  397

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  398  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  457



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKD +G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDASG  436



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN47308.1| hypothetical protein Csa_6G290890 [Cucumis sativus]
Length=295

 Score =   233 bits (595),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  163  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  222

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  223  KEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|P29521.1|EF1A1_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 emb|CAA42843.1| elongation factor 1A [Daucus carota]
Length=449

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETF+EYPPLGRFAVR MRQTVAVGVIK V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFAEYPPLGRFAVRVMRQTVAVGVIKAVEKKDPTG  436



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_008465824.1| PREDICTED: elongation factor 1-alpha-like [Cucumis melo]
Length=273

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  141  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  200

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKD +G
Sbjct  201  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDASG  260



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL79774.1|AF331849_1 elongation factor 1 alpha [Saccharum hybrid cultivar CP65-357]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SK+DPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKEDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  377  KEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFY06644.1| elongation factor 1-alpha, partial [Carica papaya]
Length=334

 Score =   234 bits (597),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  204  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  263

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  264  KEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  323



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGA++FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGA++FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGASNFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPSG  436



>gb|ADC68236.1| elongation factor 1-alpha [Dendrobium nobile]
Length=238

 Score =   231 bits (588),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELE
Sbjct  109  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELE  168

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PT+PMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  169  KEPKFLKNGDAGFVKMVPTRPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  228



>gb|ABS10822.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=201

 Score =   229 bits (585),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  81   SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIE  140

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDP  310
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP
Sbjct  141  KEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDP  198



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/119 (94%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = -2

Query  660  KDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELEK  481
            KDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+EK
Sbjct  318  KDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIEK  377

Query  480  EPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            EPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  378  EPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGD+GMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDSGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>emb|CDY58828.1| BnaAnng15460D [Brassica napus]
Length=568

 Score =   240 bits (612),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  295  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  354

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  355  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  414



>ref|XP_008783723.1| PREDICTED: elongation factor 1-alpha isoform X2 [Phoenix dactylifera]
Length=293

 Score =   232 bits (592),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  163  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  222

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  223  KEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  282



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAC22127.1| eukaryotic elongation factor 1A [Salsola komarovii]
Length=447

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SK+DPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKNDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPM+VETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMLVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGLIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMV M PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVMMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKDPTG  436



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            +EPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  REPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   236 bits (603),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KGN61480.1| hypothetical protein Csa_2G139820 [Cucumis sativus]
Length=330

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRS KELE
Sbjct  200  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSAKELE  259

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  260  KEPKFLKNGDAGMVKMIPTKPMVVETFSTYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  319



>emb|CAJ38380.1| translation elongation factor 1 alpha [Plantago major]
Length=249

 Score =   230 bits (587),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIG GYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  117  SKDDPAKEAANFTSQVIIMNHPGQIGQGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  176

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  177  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  236



>dbj|BAC66180.1| elongation factor 1A [Avicennia marina]
Length=449

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+P+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPSG  436



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SK+DPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  317  SKNDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_002528020.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34338.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=348

 Score =   233 bits (595),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  216  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  275

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  276  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  335



>gb|AAF63516.1|AF242732_1 translation elongation factor 1a [Capsicum annuum]
Length=447

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDR SGKELE
Sbjct  316  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRWSGKELE  375

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+E PPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  376  KEPKFLKNGDAGMVKMIPTKPMVVETFAENPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  435



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+VDKK PTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVDKKHPTG  436



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KDP29085.1| hypothetical protein JCGZ_16474 [Jatropha curcas]
Length=418

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  214  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  273

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  274  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  333



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDAGLVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/120 (94%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELE
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVII+NHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTAQVIIINHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AASF  QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+ELLTKIDRRSGKELE
Sbjct  317  SKDDPAREAASFASQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGD+GMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDSGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVK +ELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKVSELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            S DDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SXDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|Q41011.1|EF1A_PEA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Pisum 
sativum]
 emb|CAA65391.1| elongation factor 1-alpha [Pisum sativum]
Length=447

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  317  SKDDPAKDAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KK+PTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKEPTG  436



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELMTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAV DMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSQYPPLGRFAVLDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFNEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KK+PTG
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKEPTG  436



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSSYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|KJB48746.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=400

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDD AK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  269  SKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  328

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  329  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  388



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAR82894.1| elongation factor 1-alpha [Cichorium intybus]
Length=448

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 115/120 (96%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            S+D PAKGAASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF  LLTKIDRRSGKELE
Sbjct  316  SRDXPAKGAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFQXLLTKIDRRSGKELE  375

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV KNVDKKDPTG
Sbjct  376  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVTKNVDKKDPTG  435



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT Q IIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQGIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKGAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM PTKPMVVETFSEYPPLGRFAVRDMRQTV V VIK+VDKKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMTPTKPMVVETFSEYPPLGRFAVRDMRQTVTVSVIKSVDKKDPTG  436



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KDP29084.1| hypothetical protein JCGZ_16473 [Jatropha curcas]
Length=399

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  269  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  328

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  329  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELITKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008790814.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGLVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011026992.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026993.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026995.1| PREDICTED: elongation factor 1-alpha isoform X2 [Populus euphratica]
 ref|XP_011026996.1| PREDICTED: elongation factor 1-alpha isoform X3 [Populus euphratica]
Length=449

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHT HIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   235 bits (599),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAKGAASFT QVIIMNHPGQIGNGYAPVLDC  SHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKGAASFTAQVIIMNHPGQIGNGYAPVLDCTLSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KE KFLKNGDAGMVKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGV+KNVDKKDPTG
Sbjct  377  KEAKFLKNGDAGMVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVVKNVDKKDPTG  436



>gb|KHG24249.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=401

 Score =   233 bits (595),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  269  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  328

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  329  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  388



>gb|KJB48747.1| hypothetical protein B456_008G084000 [Gossypium raimondii]
Length=427

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDD AK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  296  SKDDLAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  355

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  356  KEPKFLKNGDAGMIKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  415



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_011031786.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=340

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  208  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  267

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  307
            KEPKFLKNGDAGM+KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKD +
Sbjct  268  KEPKFLKNGDAGMIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDAS  326



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KEH43533.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=347

 Score =   231 bits (590),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  216  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIE  275

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG++KM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDP+G
Sbjct  276  KEPKFLKNGDAGIIKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPSG  335



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETF++YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFAQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+F  QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFISQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDP+G
Sbjct  377  KEPKFLKNGDAGLVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPSG  436



>gb|ABR16818.1| unknown [Picea sitchensis]
Length=167

 Score =   225 bits (574),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SK+DPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TK+DRRSGKELE
Sbjct  36   SKNDPAREAANFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKVDRRSGKELE  95

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  307
            +EPKFLKNGDAG +KM+P+KPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK V+KKDPT
Sbjct  96   REPKFLKNGDAGFIKMIPSKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKAVEKKDPT  154



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_010669660.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669661.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SK+DPAK AA+F  QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  317  SKNDPAKEAANFIAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNV+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVEKKDPTG  436



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMVPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AEI29162.1| EF1a-like protein [Phalaenopsis hybrid cultivar]
Length=398

 Score =   233 bits (593),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  268  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  327

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  328  KEPKFLKNGDAGFVKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  387



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   234 bits (597),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+EL+TKIDRRSGKELE
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSDYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMVPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHT HIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTCHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAL69396.1| elongation factor 1-alpha [Elaeis oleifera]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+F  QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFIAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFS YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSAYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>dbj|BAC22126.1| eukaryotic elongation factor 1A [Suaeda japonica]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SK+DPAKGA+SFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKNDPAKGASSFTAQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPT  307
            KEPKFLKNGDAGMVKM+PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIK+VDKK+PT
Sbjct  377  KEPKFLKNGDAGMVKMIPTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVDKKEPT  435



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SK+DP K AASFT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKEDPTKEAASFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|ABF00115.1| elongation factor 1-alpha [Litchi chinensis]
Length=446

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE++TKIDRRSGKELE
Sbjct  316  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEIMTKIDRRSGKELE  375

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  376  KEPKFLKNGDAGYVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  435



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF+E+LTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFSEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETF+EYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFAEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKF E+LTKIDRRSGKE+E
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFGEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEL+TKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELVTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG VKM+PTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGFVKMIPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPA+ AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKELE
Sbjct  317  SKDDPAREAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGM+KM+PTKPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDP+G
Sbjct  377  KEPKFLKNGDAGMIKMIPTKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPSG  436



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/120 (93%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAG+VKM+PTKPMVVETF+EY PLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGLVKMIPTKPMVVETFAEYSPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/120 (92%), Positives = 118/120 (98%), Gaps = 0/120 (0%)
 Frame = -2

Query  663  SKDDPAKGAASFTXQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAELLTKIDRRSGKELE  484
            SKDDPAK AA+FT QVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAE+LTKIDRRSGKE+E
Sbjct  317  SKDDPAKEAANFTSQVIIMNHPGQIGNGYAPVLDCHTSHIAVKFAEILTKIDRRSGKEIE  376

Query  483  KEPKFLKNGDAGMVKMLPTKPMVVETFSEYPPLGRFAVRDMRQTVAVGVIKNVDKKDPTG  304
            KEPKFLKNGDAGMVKM+P+KPMVVETFS+YPPLGRFAVRDMRQTVAVGVIK+V+KKDPTG
Sbjct  377  KEPKFLKNGDAGMVKMVPSKPMVVETFSQYPPLGRFAVRDMRQTVAVGVIKSVEKKDPTG  436



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1037156799140