BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039A20

Length=645
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010938608.1|  PREDICTED: serine--glyoxylate aminotransfera...    333   6e-110   Elaeis guineensis
ref|XP_011090165.1|  PREDICTED: serine--glyoxylate aminotransferase     332   2e-109   Sesamum indicum [beniseed]
ref|XP_006659561.1|  PREDICTED: serine--glyoxylate aminotransfera...    332   2e-109   Oryza brachyantha
gb|KJB54391.1|  hypothetical protein B456_009G074800                    325   2e-109   Gossypium raimondii
gb|EYU35937.1|  hypothetical protein MIMGU_mgv1a026291mg                329   5e-109   Erythranthe guttata [common monkey flower]
ref|NP_001265946.1|  Hop-interacting protein THI032                     330   1e-108   Solanum lycopersicum
gb|AAL47679.1|  aminotransferase 1                                      329   2e-108   Cucumis melo [Oriental melon]
gb|KHG14448.1|  Serine--glyoxylate aminotransferase -like protein       328   3e-108   Gossypium arboreum [tree cotton]
gb|KJB83533.1|  hypothetical protein B456_013G252200                    327   3e-108   Gossypium raimondii
ref|XP_004139054.1|  PREDICTED: serine--glyoxylate aminotransfera...    328   3e-108   Cucumis sativus [cucumbers]
gb|KJB54393.1|  hypothetical protein B456_009G074800                    325   4e-108   Gossypium raimondii
ref|XP_006349776.1|  PREDICTED: serine--glyoxylate aminotransfera...    328   7e-108   Solanum tuberosum [potatoes]
gb|AFK37194.1|  unknown                                                 322   1e-107   Medicago truncatula
ref|XP_007212264.1|  hypothetical protein PRUPE_ppa006653mg             327   1e-107   Prunus persica
ref|XP_009775939.1|  PREDICTED: serine--glyoxylate aminotransferase     327   1e-107   Nicotiana sylvestris
ref|XP_009619693.1|  PREDICTED: serine--glyoxylate aminotransferase     327   1e-107   Nicotiana tomentosiformis
ref|XP_008227244.1|  PREDICTED: serine--glyoxylate aminotransferase     327   1e-107   Prunus mume [ume]
ref|XP_009338530.1|  PREDICTED: serine--glyoxylate aminotransfera...    327   2e-107   
gb|AAB95218.1|  putative serine-glyoxylate aminotransferase             327   2e-107   Fritillaria agrestis
ref|NP_001284450.1|  serine--glyoxylate aminotransferase                327   2e-107   Cucumis melo [Oriental melon]
ref|XP_009342610.1|  PREDICTED: serine--glyoxylate aminotransferase     327   2e-107   Pyrus x bretschneideri [bai li]
ref|XP_011080387.1|  PREDICTED: serine--glyoxylate aminotransfera...    326   2e-107   Sesamum indicum [beniseed]
gb|AAQ56192.1|  aminotransferase 1                                      326   3e-107   Cucumis melo [Oriental melon]
gb|AGT38285.1|  serine--glyoxylate aminotransferase                     326   3e-107   Gossypium hirsutum [American cotton]
ref|XP_004291746.1|  PREDICTED: serine--glyoxylate aminotransferase     326   3e-107   Fragaria vesca subsp. vesca
ref|XP_002531124.1|  serine-pyruvate aminotransferase, putative         326   4e-107   Ricinus communis
ref|XP_006369574.1|  hypothetical protein POPTR_0001s26020g             320   5e-107   
gb|KJB54389.1|  hypothetical protein B456_009G074800                    325   5e-107   Gossypium raimondii
ref|XP_008363560.1|  PREDICTED: serine--glyoxylate aminotransferase     325   8e-107   Malus domestica [apple tree]
ref|XP_007015204.1|  Alanine:glyoxylate aminotransferase isoform 1      324   2e-106   
ref|XP_010557501.1|  PREDICTED: serine--glyoxylate aminotransferase     324   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_010909203.1|  PREDICTED: serine--glyoxylate aminotransferase     324   2e-106   Elaeis guineensis
ref|XP_006843377.1|  hypothetical protein AMTR_s00053p00093890          324   2e-106   Amborella trichopoda
ref|XP_006369569.1|  hypothetical protein POPTR_0001s26020g             321   2e-106   
ref|XP_008812510.1|  PREDICTED: serine--glyoxylate aminotransferase     324   2e-106   Phoenix dactylifera
ref|NP_001237048.1|  enzymatic resistance protein                       324   2e-106   
gb|ACJ61246.1|  serine glyoxylate aminotransferase 2                    323   3e-106   Glycine max [soybeans]
ref|XP_006584642.1|  PREDICTED: enzymatic resistance protein isof...    323   3e-106   Glycine max [soybeans]
gb|AEX09250.1|  alanine glyoxylate aminotransferase                     322   3e-106   Peperomia schizandra
ref|XP_010277598.1|  PREDICTED: serine--glyoxylate aminotransferase     323   4e-106   Nelumbo nucifera [Indian lotus]
ref|NP_001062170.1|  Os08g0502700                                       323   4e-106   
ref|XP_010045046.1|  PREDICTED: serine--glyoxylate aminotransferase     323   5e-106   Eucalyptus grandis [rose gum]
ref|XP_010673724.1|  PREDICTED: serine--glyoxylate aminotransferase     323   5e-106   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008359496.1|  PREDICTED: serine--glyoxylate aminotransferase     323   5e-106   
ref|XP_008666471.1|  PREDICTED: serine--glyoxylate aminotransfera...    318   6e-106   
dbj|BAJ90006.1|  predicted protein                                      323   6e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABQ81924.1|  aminotransferase 2                                      323   6e-106   Cucumis sativus [cucumbers]
ref|XP_008449670.1|  PREDICTED: serine--glyoxylate aminotransfera...    323   7e-106   Cucumis melo [Oriental melon]
gb|ABQ81922.1|  aminotransferase 2                                      323   7e-106   Cucumis sativus [cucumbers]
ref|XP_003600159.1|  Alanine glyoxylate aminotransferase                322   7e-106   Medicago truncatula
gb|AAQ56193.1|  aminotransferase 2                                      322   7e-106   Cucumis melo [Oriental melon]
ref|NP_001284445.1|  serine--glyoxylate aminotransferase-like           322   8e-106   Cucumis melo [Oriental melon]
gb|KHN28521.1|  Serine--glyoxylate aminotransferase                     322   1e-105   Glycine soja [wild soybean]
ref|XP_004499480.1|  PREDICTED: serine--glyoxylate aminotransfera...    322   1e-105   
ref|NP_001276276.1|  serine--glyoxylate aminotransferase-like           322   1e-105   Glycine max [soybeans]
gb|AAL62332.1|AF461048_1  aminotransferase 2                            322   1e-105   Cucumis melo [Oriental melon]
ref|XP_009415566.1|  PREDICTED: serine--glyoxylate aminotransferase     322   1e-105   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP35982.1|  hypothetical protein JCGZ_08377                         322   1e-105   Jatropha curcas
gb|EMS66805.1|  Serine--glyoxylate aminotransferase                     322   1e-105   Triticum urartu
gb|KHG29969.1|  Serine--glyoxylate aminotransferase -like protein       321   2e-105   Gossypium arboreum [tree cotton]
gb|AFK40703.1|  unknown                                                 321   2e-105   Medicago truncatula
gb|ABQ81925.1|  aminotransferase 2                                      321   2e-105   Cucumis melo [Oriental melon]
gb|KDO44953.1|  hypothetical protein CISIN_1g0157291mg                  321   3e-105   Citrus sinensis [apfelsine]
ref|XP_006470731.1|  PREDICTED: serine--glyoxylate aminotransfera...    321   3e-105   Citrus sinensis [apfelsine]
ref|XP_007146302.1|  hypothetical protein PHAVU_006G029100g             321   3e-105   Phaseolus vulgaris [French bean]
gb|AEX09255.1|  alanine glyoxylate aminotransferase                     319   5e-105   Peperomia bracteata
gb|ACJ61247.1|  serine glyoxylate aminotransferase 3                    320   5e-105   Glycine max [soybeans]
ref|XP_002298306.1|  hypothetical protein POPTR_0001s26020g             320   6e-105   Populus trichocarpa [western balsam poplar]
gb|AEX09299.1|  alanine glyoxylate aminotransferase                     319   6e-105   Peperomia cerrateae
gb|AEX09298.1|  alanine glyoxylate aminotransferase                     318   8e-105   Peperomia cerrateae
gb|AEX09273.1|  alanine glyoxylate aminotransferase                     318   9e-105   Peperomia cerrateae
gb|AGV54322.1|  serine glyoxylate aminotransferase 2                    320   9e-105   Phaseolus vulgaris [French bean]
gb|EPS59280.1|  serine-glyoxylate aminotransferase                      319   1e-104   Genlisea aurea
emb|CBI24214.3|  unnamed protein product                                318   2e-104   Vitis vinifera
ref|XP_006446249.1|  hypothetical protein CICLE_v10015490mg             319   2e-104   Citrus clementina [clementine]
ref|XP_004140203.1|  PREDICTED: serine--glyoxylate aminotransfera...    319   2e-104   Cucumis sativus [cucumbers]
gb|AEX09247.1|  alanine glyoxylate aminotransferase                     317   2e-104   Peperomia cavispicata
ref|XP_011043786.1|  PREDICTED: serine--glyoxylate aminotransferase     319   2e-104   Populus euphratica
gb|AEX09254.1|  alanine glyoxylate aminotransferase                     318   2e-104   Peperomia bracteata
gb|ACN39798.1|  unknown                                                 319   2e-104   Picea sitchensis
gb|ABK24112.1|  unknown                                                 319   2e-104   Picea sitchensis
gb|AEX09265.1|  alanine glyoxylate aminotransferase                     317   2e-104   Peperomia radiatinervosa
gb|AEX09258.1|  alanine glyoxylate aminotransferase                     317   2e-104   Peperomia bracteata
gb|AEX09253.1|  alanine glyoxylate aminotransferase                     317   2e-104   Peperomia bracteata
gb|AEX09256.1|  alanine glyoxylate aminotransferase                     317   2e-104   Peperomia bracteata
gb|AEX09285.1|  alanine glyoxylate aminotransferase                     317   2e-104   Peperomia radiatinervosa
gb|AEX09257.1|  alanine glyoxylate aminotransferase                     317   3e-104   Peperomia bracteata
gb|AEX09276.1|  alanine glyoxylate aminotransferase                     317   3e-104   Peperomia parvisagittata
gb|AEX09303.1|  alanine glyoxylate aminotransferase                     317   3e-104   Peperomia ayacuchoana
gb|AEX09267.1|  alanine glyoxylate aminotransferase                     317   4e-104   Peperomia radiatinervosa
ref|XP_002279236.1|  PREDICTED: serine--glyoxylate aminotransferase     318   4e-104   Vitis vinifera
gb|ACN36238.1|  unknown                                                 315   5e-104   Zea mays [maize]
emb|CAN84001.1|  hypothetical protein VITISV_007680                     317   8e-104   Vitis vinifera
ref|XP_002444789.1|  hypothetical protein SORBIDRAFT_07g028080          317   8e-104   Sorghum bicolor [broomcorn]
gb|AEX09275.1|  alanine glyoxylate aminotransferase                     316   8e-104   Peperomia parvisagittata
gb|AEX09311.1|  alanine glyoxylate aminotransferase                     315   2e-103   Peperomia andina
gb|AEX09305.1|  alanine glyoxylate aminotransferase                     315   2e-103   Peperomia pseudoverruculosa
ref|XP_004973838.1|  PREDICTED: serine--glyoxylate aminotransfera...    316   2e-103   Setaria italica
ref|XP_003574732.2|  PREDICTED: serine--glyoxylate aminotransferase     318   3e-103   Brachypodium distachyon [annual false brome]
emb|CDP08481.1|  unnamed protein product                                316   3e-103   Coffea canephora [robusta coffee]
gb|AEX09248.1|  alanine glyoxylate aminotransferase                     315   3e-103   Peperomia questionis
ref|NP_001148339.1|  LOC100281949                                       316   3e-103   Zea mays [maize]
gb|AEX09270.1|  alanine glyoxylate aminotransferase                     314   4e-103   Peperomia verruculosa
gb|AEX09307.1|  alanine glyoxylate aminotransferase                     314   4e-103   Peperomia verruculosa
ref|XP_004973837.1|  PREDICTED: serine--glyoxylate aminotransfera...    316   5e-103   
gb|ABA00460.1|  serine-glyoxylate aminotransferase                      315   6e-103   Spirodela polyrhiza
ref|XP_002313371.1|  aminotransferase 2 family protein                  315   6e-103   
ref|XP_009410322.1|  PREDICTED: serine--glyoxylate aminotransfera...    315   7e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|AEX09259.1|  alanine glyoxylate aminotransferase                     313   9e-103   Peperomia bracteata
gb|AEX09306.1|  alanine glyoxylate aminotransferase                     313   1e-102   Peperomia peruviana
gb|AEX09300.1|  alanine glyoxylate aminotransferase                     313   2e-102   Peperomia parvifolia
ref|XP_011032100.1|  PREDICTED: serine--glyoxylate aminotransfera...    313   2e-102   Populus euphratica
gb|AEX09293.1|  alanine glyoxylate aminotransferase                     312   3e-102   Peperomia rupiseda
gb|AEX09301.1|  alanine glyoxylate aminotransferase                     311   6e-102   Peperomia sp. JN-2011
gb|AEX09304.1|  alanine glyoxylate aminotransferase                     311   7e-102   Peperomia chutanka
gb|ABK96624.1|  unknown                                                 312   7e-102   Populus trichocarpa x Populus deltoides
ref|XP_006409690.1|  hypothetical protein EUTSA_v10022711mg             312   9e-102   
emb|CDX81443.1|  BnaC09g08540D                                          311   1e-101   
emb|CDY37208.1|  BnaA09g08290D                                          311   1e-101   Brassica napus [oilseed rape]
ref|XP_009112244.1|  PREDICTED: serine--glyoxylate aminotransferase     311   1e-101   Brassica rapa
dbj|BAJ33858.1|  unnamed protein product                                313   2e-101   Eutrema halophilum
gb|AEX09286.1|  alanine glyoxylate aminotransferase                     310   2e-101   Peperomia cyclaminoides
gb|AEX09249.1|  alanine glyoxylate aminotransferase                     310   2e-101   Peperomia aff. gracillima JN-2011
gb|AEX09263.1|  alanine glyoxylate aminotransferase                     310   2e-101   Peperomia putlaensis
ref|XP_009136209.1|  PREDICTED: serine--glyoxylate aminotransfera...    309   1e-100   Brassica rapa
gb|AEX09268.1|  alanine glyoxylate aminotransferase                     307   3e-100   Peperomia peruviana
gb|AEX09295.1|  alanine glyoxylate aminotransferase                     306   3e-100   Peperomia pugnicaudex
emb|CDX89604.1|  BnaC03g45180D                                          307   6e-100   
gb|AEX09308.1|  alanine glyoxylate aminotransferase                     305   1e-99    Peperomia polycephala
gb|AEX09274.1|  alanine glyoxylate aminotransferase                     305   1e-99    Peperomia peruviana
ref|XP_010518509.1|  PREDICTED: serine--glyoxylate aminotransfera...    306   2e-99    Camelina sativa [gold-of-pleasure]
ref|XP_010488837.1|  PREDICTED: serine--glyoxylate aminotransfera...    306   3e-99    Camelina sativa [gold-of-pleasure]
ref|NP_178969.1|  alanine--glyoxylate aminotransferase                  305   6e-99    Arabidopsis thaliana [mouse-ear cress]
gb|ABF70331.1|  aminotransferase 1                                      304   8e-99    Cucumis sativus [cucumbers]
ref|XP_002885871.1|  hypothetical protein ARALYDRAFT_480305             303   3e-98    
gb|EMT09291.1|  Serine--glyoxylate aminotransferase                     296   4e-97    
ref|XP_006297832.1|  hypothetical protein CARUB_v10013869mg             300   4e-97    Capsella rubella
gb|AEA48973.1|  glyoxylate aminotransferase                             289   4e-96    Rosa roxburghii [chestnut rose]
gb|AEX09277.1|  alanine glyoxylate aminotransferase                     293   6e-95    Peperomia cyclaminoides
gb|AEX09245.1|  alanine glyoxylate aminotransferase                     293   7e-95    Peperomia putlaensis
gb|AEX09281.1|  alanine glyoxylate aminotransferase                     291   2e-94    Peperomia cyclaminoides
gb|AEX09272.1|  alanine glyoxylate aminotransferase                     291   2e-94    Peperomia cyclaminoides
ref|XP_010467178.1|  PREDICTED: serine--glyoxylate aminotransfera...    295   2e-94    Camelina sativa [gold-of-pleasure]
gb|AEX09280.1|  alanine glyoxylate aminotransferase                     290   4e-94    Peperomia peruviana
gb|AEX09266.1|  alanine glyoxylate aminotransferase                     291   4e-94    Peperomia peruviana
gb|AEX09284.1|  alanine glyoxylate aminotransferase                     290   7e-94    Peperomia peruviana
gb|AEX09261.1|  alanine glyoxylate aminotransferase                     289   1e-93    Peperomia aff. ovatopeltata JN-2011
gb|AEX09269.1|  alanine glyoxylate aminotransferase                     288   2e-93    Peperomia peruviana
gb|AEX09271.1|  alanine glyoxylate aminotransferase                     288   3e-93    Peperomia peruviana
gb|AEX09283.1|  alanine glyoxylate aminotransferase                     288   3e-93    Peperomia peruviana
gb|AEX09294.1|  alanine glyoxylate aminotransferase                     286   2e-92    Peperomia sp. JN-2011
gb|AEX09264.1|  alanine glyoxylate aminotransferase                     285   4e-92    Peperomia radiatinervosa
gb|AEX09302.1|  alanine glyoxylate aminotransferase                     283   2e-91    Peperomia sp. JN-2011
ref|XP_004491262.1|  PREDICTED: serine--glyoxylate aminotransfera...    285   3e-91    Cicer arietinum [garbanzo]
ref|XP_003617296.1|  Alanine glyoxylate aminotransferase                284   7e-91    Medicago truncatula
gb|AEX09252.1|  alanine glyoxylate aminotransferase                     282   8e-91    Peperomia exclamationis
gb|AEX09262.1|  alanine glyoxylate aminotransferase                     282   9e-91    Peperomia aff. ovatopeltata JN-2011
tpg|DAA47890.1|  TPA: hypothetical protein ZEAMMB73_424946              270   1e-88    
ref|XP_002990557.1|  hypothetical protein SELMODRAFT_448066             276   1e-87    Selaginella moellendorffii
ref|XP_002983655.1|  hypothetical protein SELMODRAFT_228964             275   4e-87    
gb|AEX09289.1|  alanine glyoxylate aminotransferase                     270   1e-86    Peperomia gigantea
gb|AEX09242.1|  alanine glyoxylate aminotransferase                     271   2e-86    Peperomia aff. pinoi JN-2011
gb|AEX09288.1|  alanine glyoxylate aminotransferase                     267   5e-85    Peperomia parvisagittata
gb|AEX09246.1|  alanine glyoxylate aminotransferase                     267   5e-85    Peperomia elatior
gb|AEX09291.1|  alanine glyoxylate aminotransferase                     266   5e-85    Peperomia jalcaensis
gb|AEX09309.1|  alanine glyoxylate aminotransferase                     265   3e-84    Peperomia wernerrauhii
gb|ABR26184.1|  serine-glyoxylate aminotransferase                      258   5e-84    Oryza sativa Indica Group [Indian rice]
gb|AEX09251.1|  alanine glyoxylate aminotransferase                     263   1e-83    Peperomia schizandra
gb|AEX09282.1|  alanine glyoxylate aminotransferase                     263   1e-83    Peperomia cerrateae
gb|AEX09244.1|  alanine glyoxylate aminotransferase                     263   1e-83    Peperomia basiradicans
gb|AEX09290.1|  alanine glyoxylate aminotransferase                     261   5e-83    Peperomia dolabella
gb|AEX09287.1|  alanine glyoxylate aminotransferase                     261   7e-83    Peperomia cerrateae
gb|AEX09292.1|  alanine glyoxylate aminotransferase                     259   3e-82    Peperomia klopfensteinii
gb|AEX09310.1|  alanine glyoxylate aminotransferase                     259   4e-82    Peperomia wernerrauhii
ref|XP_002969615.1|  hypothetical protein SELMODRAFT_267279             262   4e-82    Selaginella moellendorffii
ref|XP_002970880.1|  hypothetical protein SELMODRAFT_147375             260   1e-81    Selaginella moellendorffii
ref|XP_001755667.1|  predicted protein                                  254   2e-79    
ref|XP_001783551.1|  predicted protein                                  252   2e-78    
gb|AEX09243.1|  alanine glyoxylate aminotransferase                     246   3e-77    Peperomia sp. JN-2011
ref|XP_003617694.1|  Alanine glyoxylate aminotransferase                245   3e-76    
ref|XP_010094254.1|  Serine--glyoxylate aminotransferase                244   1e-75    Morus notabilis
gb|AEX09260.1|  alanine glyoxylate aminotransferase                     242   1e-75    Peperomia aff. ovatopeltata JN-2011
ref|XP_003600160.1|  Alanine glyoxylate aminotransferase                245   2e-75    
tpg|DAA47908.1|  TPA: hypothetical protein ZEAMMB73_592349              235   6e-74    
ref|XP_006369573.1|  hypothetical protein POPTR_0001s26020g             239   9e-74    
gb|ABR16109.1|  unknown                                                 238   1e-73    Picea sitchensis
gb|KDO44954.1|  hypothetical protein CISIN_1g0157291mg                  236   2e-72    Citrus sinensis [apfelsine]
tpg|DAA47863.1|  TPA: hypothetical protein ZEAMMB73_595389              233   2e-71    
dbj|BAD94403.1|  alanine-glyoxylate aminotransferase                    221   4e-70    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003615391.1|  Alanine glyoxylate aminotransferase                227   3e-69    
ref|XP_001763095.1|  predicted protein                                  223   5e-67    
gb|ABS86859.1|  alanine glyoxylate aminotransferase                     197   2e-60    Phaseolus vulgaris [French bean]
gb|ABS86860.1|  alanine glyoxylate aminotransferase                     195   1e-59    Phaseolus vulgaris [French bean]
gb|AGN53915.1|  glyoxylate aminotransferase                             192   3e-58    Silene latifolia
gb|AGN53895.1|  glyoxylate aminotransferase                             191   9e-58    Silene latifolia
gb|AGN53914.1|  glyoxylate aminotransferase                             190   1e-57    Silene latifolia
gb|AGN53916.1|  glyoxylate aminotransferase                             189   2e-57    Silene latifolia
gb|AGN53923.1|  glyoxylate aminotransferase                             189   3e-57    Silene latifolia
gb|AGN53897.1|  glyoxylate aminotransferase                             189   3e-57    Silene latifolia
gb|AGN54050.1|  glyoxylate aminotransferase                             189   5e-57    Silene vulgaris [maiden's-tears]
gb|AGN53921.1|  glyoxylate aminotransferase                             189   5e-57    Silene latifolia
gb|AGN53900.1|  glyoxylate aminotransferase                             188   6e-57    Silene latifolia
gb|AGN53906.1|  glyoxylate aminotransferase                             188   7e-57    Silene latifolia
gb|AGN53917.1|  glyoxylate aminotransferase                             188   7e-57    Silene latifolia
gb|AGN54049.1|  glyoxylate aminotransferase                             188   1e-56    Silene vulgaris [maiden's-tears]
ref|WP_040580464.1|  serine--glyoxylate aminotransferase                191   1e-54    
ref|WP_024878012.1|  MULTISPECIES: serine--glyoxylate aminotransf...    190   2e-54    Methylocystaceae
ref|WP_036293367.1|  serine--glyoxylate aminotransferase                190   2e-54    Methylosinus
ref|WP_018267457.1|  serine--glyoxylate aminotransferase                189   2e-54    Methylosinus sp. LW4
dbj|BAQ46928.1|  serine--glyoxylate aminotransferase                    187   2e-53    Methylobacterium aquaticum
gb|AFZ62596.1|  serine-glyoxylate aminotransferase                      187   2e-53    Hyphomicrobium nitrativorans NL23
ref|WP_041319044.1|  serine--glyoxylate aminotransferase                187   3e-53    
ref|WP_017485211.1|  serine--glyoxylate aminotransferase                186   4e-53    Methylobacterium sp. MB200
ref|WP_003613273.1|  serine--glyoxylate aminotransferase                186   5e-53    Methylosinus
ref|WP_012453656.1|  serine--glyoxylate aminotransferase                186   6e-53    Methylorubrum populi
emb|CAD13310.1|  serine-glyoxylate aminotransferase                     185   1e-52    Methylorubrum extorquens DM4
ref|WP_012590731.1|  serine--glyoxylate aminotransferase                185   1e-52    Methylocella silvestris
ref|WP_012253362.1|  serine--glyoxylate aminotransferase                185   1e-52    Methylobacteriaceae
ref|WP_003597639.1|  serine--glyoxylate aminotransferase                185   1e-52    Methylobacteriaceae
ref|WP_015950680.1|  serine--glyoxylate aminotransferase                185   2e-52    Methylorubrum extorquens
ref|WP_036260471.1|  serine--glyoxylate aminotransferase                184   7e-52    Methylocapsa aurea
ref|WP_026610206.1|  serine--glyoxylate aminotransferase                181   3e-51    Methylocaldum szegediense
dbj|BAQ18801.1|  serine-glyoxylate aminotransferase                     181   4e-51    Methyloceanibacter caenitepidi
ref|XP_011399157.1|  Serine-glyoxylate aminotransferase                 180   7e-51    Auxenochlorella protothecoides
ref|WP_027172630.1|  serine--glyoxylate aminotransferase                179   2e-50    Methylobacterium
ref|WP_026175686.1|  serine--glyoxylate aminotransferase                178   6e-50    Methylobacterium sp. 88A
sp|O08374.2|SGAA_HYPME  RecName: Full=Serine--glyoxylate aminotra...    178   8e-50    Hyphomicrobium methylovorum
ref|WP_013217108.1|  serine--glyoxylate aminotransferase                178   8e-50    Hyphomicrobium denitrificans
ref|XP_005709273.1|  serine--glyoxylate transaminase                    177   1e-49    Galdieria sulphuraria
ref|WP_026608295.1|  serine--glyoxylate aminotransferase                177   2e-49    Methylocapsa acidiphila
ref|WP_016921634.1|  serine--glyoxylate aminotransferase                177   2e-49    Methylocystis parvus
ref|WP_015599474.1|  serine--glyoxylate aminotransferase                177   2e-49    Hyphomicrobium denitrificans
ref|WP_020085137.1|  serine--glyoxylate aminotransferase                177   2e-49    Hyphomicrobium zavarzinii
ref|WP_026597137.1|  serine--glyoxylate aminotransferase                176   3e-49    Methylobacterium sp. 77
ref|WP_036284904.1|  serine--glyoxylate aminotransferase                176   6e-49    Methylocystis sp. ATCC 49242
ref|WP_042673896.1|  serine--glyoxylate aminotransferase                175   9e-49    Methylobacterium sp. B34
ref|WP_020092657.1|  serine--glyoxylate aminotransferase                175   9e-49    Methylobacterium
ref|WP_012320605.1|  MULTISPECIES: serine--glyoxylate aminotransf...    175   1e-48    Methylobacterium
ref|WP_007559580.1|  serine--glyoxylate aminotransferase                175   1e-48    Methylobacterium
ref|WP_043355705.1|  serine--glyoxylate aminotransferase                174   2e-48    Methylobacterium
ref|WP_043385155.1|  MULTISPECIES: serine--glyoxylate aminotransf...    174   2e-48    Methylobacterium
ref|WP_010687105.1|  Aminotransferase class V                           173   4e-48    Methylobacterium mesophilicum
ref|WP_035525480.1|  serine--glyoxylate aminotransferase                173   6e-48    Paraburkholderia sacchari
ref|WP_013949995.1|  MULTISPECIES: serine--glyoxylate aminotransf...    173   6e-48    Hyphomicrobium
gb|AIQ91949.1|  Aminotransferase class V                                174   6e-48    Methylobacterium oryzae CBMB20
gb|AEW08188.1|  hypothetical protein 2_2585_01                          165   7e-48    Pinus lambertiana
ref|WP_011630756.1|  serine--glyoxylate aminotransferase                172   9e-48    Granulibacter bethesdensis
ref|WP_038511699.1|  serine--glyoxylate aminotransferase                172   9e-48    Granulibacter bethesdensis
gb|AHJ64409.1|  Serine-pyruvate aminotransferase                        172   1e-47    Granulibacter bethesdensis CGDNIH4
ref|WP_035937801.1|  serine--glyoxylate aminotransferase                172   1e-47    Caballeronia glathei
gb|AHJ67030.1|  hypothetical protein GbCGDNIH2_0048                     172   1e-47    Granulibacter bethesdensis
gb|AID30749.1|  serine--glyoxylate aminotransferase                     168   2e-47    
ref|WP_031597721.1|  serine--glyoxylate aminotransferase                171   2e-47    Ferrovum
ref|WP_034858116.1|  serine--glyoxylate aminotransferase                171   3e-47    Ensifer sojae
ref|XP_002953765.1|  hypothetical protein VOLCADRAFT_75980              172   4e-47    Volvox carteri f. nagariensis
ref|WP_028755163.1|  serine--glyoxylate aminotransferase                171   4e-47    Rhizobium leucaenae
ref|WP_038515723.1|  serine--glyoxylate aminotransferase                171   4e-47    Granulibacter bethesdensis
ref|WP_010960683.1|  serine--glyoxylate aminotransferase                171   4e-47    Methylococcus capsulatus
ref|WP_015933415.1|  serine--glyoxylate aminotransferase                171   5e-47    Methylobacterium nodulans
ref|WP_008058631.1|  serine--glyoxylate aminotransferase                170   7e-47    Methyloversatilis universalis
ref|WP_026362994.1|  serine--glyoxylate aminotransferase                170   7e-47    Methylopila sp. M107
gb|AHJ61786.1|  Serine-pyruvate aminotransferase                        171   7e-47    Granulibacter bethesdensis
ref|WP_037437034.1|  serine--glyoxylate aminotransferase                166   1e-46    
gb|KIZ03753.1|  serine--glyoxylate transaminase                         170   1e-46    Monoraphidium neglectum
gb|AFG57258.1|  hypothetical protein 2_2585_01                          162   1e-46    Pinus taeda
ref|WP_037429341.1|  serine--glyoxylate aminotransferase                166   1e-46    Sinorhizobium fredii
ref|WP_037399704.1|  serine--glyoxylate aminotransferase                166   1e-46    Sinorhizobium fredii
ref|WP_037460312.1|  serine--glyoxylate aminotransferase                166   1e-46    Sinorhizobium fredii
ref|WP_037447404.1|  serine--glyoxylate aminotransferase                166   1e-46    Sinorhizobium fredii
ref|WP_014890662.1|  serine--glyoxylate aminotransferase                169   1e-46    Methylocystis sp. SC2
ref|WP_018405893.1|  serine--glyoxylate aminotransferase                169   2e-46    Methylocystis rosea
gb|AEW08187.1|  hypothetical protein 2_2585_01                          161   2e-46    Pinus radiata
ref|WP_026227793.1|  serine--glyoxylate aminotransferase                169   2e-46    Hoeflea sp. 108
ref|WP_029648781.1|  serine--glyoxylate aminotransferase                169   2e-46    Methylocystis sp. SB2
ref|WP_018238561.1|  serine--glyoxylate aminotransferase                169   2e-46    Ensifer sp. BR816
ref|WP_042306504.1|  serine--glyoxylate aminotransferase                169   2e-46    Paraburkholderia terrae
ref|WP_026616975.1|  serine--glyoxylate aminotransferase                169   2e-46    Sinorhizobium/Ensifer group
ref|WP_012405153.1|  serine--glyoxylate aminotransferase                169   2e-46    Paraburkholderia phymatum
ref|WP_012336184.1|  serine--glyoxylate aminotransferase                169   2e-46    Methylobacterium sp. 4-46
ref|WP_026190999.1|  serine--glyoxylate aminotransferase                169   2e-46    
ref|WP_037131645.1|  serine--glyoxylate aminotransferase                168   3e-46    
ref|WP_027147316.1|  MULTISPECIES: serine--glyoxylate aminotransf...    168   4e-46    
ref|WP_007585769.1|  serine--glyoxylate aminotransferase                168   5e-46    
ref|WP_035994918.1|  serine--glyoxylate aminotransferase                168   6e-46    
ref|WP_007742731.1|  serine--glyoxylate aminotransferase                168   7e-46    
ref|WP_020592928.1|  hypothetical protein                               167   7e-46    
ref|WP_032930697.1|  serine--glyoxylate aminotransferase                167   8e-46    
ref|WP_019858769.1|  serine--glyoxylate aminotransferase                167   8e-46    
ref|WP_026622911.1|  serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_023434100.1|  Serine--glyoxylate aminotransferase                167   1e-45    
ref|WP_012709136.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_020188076.1|  hypothetical protein                               167   1e-45    
ref|WP_026223456.1|  serine--glyoxylate aminotransferase                166   1e-45    
ref|WP_017840623.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_036253086.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_028367172.1|  serine--glyoxylate aminotransferase                167   2e-45    
ref|WP_036271184.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_043363897.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_040969922.1|  serine--glyoxylate aminotransferase                166   2e-45    
ref|WP_024925735.1|  MULTISPECIES: serine--glyoxylate aminotransf...    166   2e-45    
ref|WP_003535479.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_037384071.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_013819317.1|  serine--glyoxylate aminotransferase                166   3e-45    
ref|WP_010910076.1|  serine--glyoxylate aminotransferase                166   4e-45    
ref|WP_029644281.1|  serine--glyoxylate aminotransferase                165   4e-45    
ref|WP_042643125.1|  serine--glyoxylate aminotransferase                165   4e-45    
ref|WP_028097617.1|  serine--glyoxylate aminotransferase                165   5e-45    
ref|WP_037276810.1|  serine--glyoxylate aminotransferase                165   5e-45    
ref|WP_014329402.1|  serine--glyoxylate aminotransferase                165   5e-45    
ref|WP_040961132.1|  serine--glyoxylate aminotransferase                165   5e-45    
ref|WP_013894918.1|  serine--glyoxylate aminotransferase                165   6e-45    
ref|WP_023779196.1|  serine--glyoxylate aminotransferase                165   6e-45    
ref|WP_037416404.1|  serine--glyoxylate aminotransferase                165   7e-45    
ref|WP_022947294.1|  serine--glyoxylate aminotransferase                164   8e-45    
ref|WP_028212654.1|  serine--glyoxylate aminotransferase                165   9e-45    
ref|WP_014989411.1|  serine--glyoxylate aminotransferase                164   2e-44    
ref|WP_019867322.1|  serine--glyoxylate aminotransferase                164   2e-44    
ref|WP_036230592.1|  MULTISPECIES: serine--glyoxylate aminotransf...    164   2e-44    
ref|WP_041930245.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_037401694.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_037471319.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_029964417.1|  serine--glyoxylate aminotransferase                163   3e-44    
gb|ABM96214.1|  serine-glyoxylate aminotransferase                      163   3e-44    
ref|WP_041003840.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_023698325.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_037249159.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_023685219.1|  serine--glyoxylate aminotransferase                163   3e-44    
ref|WP_018410273.1|  serine--glyoxylate aminotransferase                163   4e-44    
ref|WP_026622392.1|  serine--glyoxylate aminotransferase                162   5e-44    
ref|WP_023763335.1|  serine--glyoxylate aminotransferase                162   6e-44    
ref|WP_023690974.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   7e-44    
ref|WP_023782620.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_040962653.1|  serine--glyoxylate aminotransferase                162   7e-44    
ref|WP_023706127.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   7e-44    
ref|WP_023829410.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_027051273.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_023769804.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   8e-44    
ref|WP_023670792.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_028223486.1|  serine--glyoxylate aminotransferase                162   8e-44    
ref|WP_014762541.1|  serine--glyoxylate aminotransferase                162   9e-44    
ref|WP_037380858.1|  serine--glyoxylate aminotransferase                162   9e-44    
ref|WP_023822176.1|  serine--glyoxylate aminotransferase                162   9e-44    
ref|WP_023700366.1|  serine--glyoxylate aminotransferase                162   9e-44    
ref|WP_023712721.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   9e-44    
ref|WP_023731220.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   1e-43    
ref|WP_023746858.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   1e-43    
ref|WP_023753463.1|  MULTISPECIES: serine--glyoxylate aminotransf...    162   1e-43    
ref|WP_014955398.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_031434945.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_006203221.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_008279759.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_012177563.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_023805485.1|  serine--glyoxylate aminotransferase                161   1e-43    
ref|WP_023714322.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_023741624.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_006005059.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_005371842.1|  MULTISPECIES: serine--glyoxylate aminotransf...    160   2e-43    
ref|WP_040981991.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_018001111.1|  serine--glyoxylate aminotransferase                161   2e-43    
ref|WP_027029542.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_027999163.1|  serine--glyoxylate aminotransferase                160   2e-43    
ref|WP_008757940.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_015314900.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_041007618.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_041011880.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|WP_023739129.1|  MULTISPECIES: serine--glyoxylate aminotransf...    160   3e-43    
ref|WP_023818017.1|  serine--glyoxylate aminotransferase                160   3e-43    
ref|XP_005648727.1|  serine glyoxylate aminotransferase                 161   3e-43    
ref|WP_027061369.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_014762956.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_024298006.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_039537917.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_023827347.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_011569032.1|  serine--glyoxylate aminotransferase                160   4e-43    
ref|WP_027168976.1|  serine--glyoxylate aminotransferase                160   5e-43    
ref|WP_038006422.1|  MULTISPECIES: serine--glyoxylate aminotransf...    160   5e-43    
ref|WP_023690293.1|  serine--glyoxylate aminotransferase                160   5e-43    
ref|WP_027044922.1|  serine--glyoxylate aminotransferase                160   6e-43    
ref|WP_027288003.1|  serine--glyoxylate aminotransferase                159   6e-43    
ref|WP_037283573.1|  serine--glyoxylate aminotransferase                159   7e-43    
ref|WP_027163728.1|  serine--glyoxylate aminotransferase                159   7e-43    
ref|WP_010441851.1|  serine--glyoxylate aminotransferase                159   9e-43    
ref|WP_033156535.1|  serine--glyoxylate aminotransferase                159   9e-43    
ref|WP_023665384.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_009834866.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_026604426.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_020482091.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_040651093.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_036274731.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_023833857.1|  serine--glyoxylate aminotransferase                159   1e-42    
ref|WP_013961473.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_036191573.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_018238011.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_020058450.1|  hypothetical protein                               158   2e-42    
ref|WP_027146511.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_015317366.1|  serine--glyoxylate aminotransferase                158   2e-42    
ref|WP_026850920.1|  serine--glyoxylate aminotransferase                158   3e-42    
ref|WP_011513322.1|  MULTISPECIES: serine--glyoxylate aminotransf...    158   3e-42    
ref|WP_043847105.1|  serine--glyoxylate aminotransferase                157   4e-42    
ref|WP_015888023.1|  serine--glyoxylate aminotransferase                157   5e-42    
gb|EAQ23658.1|  probable serine-glyoxylate aminotransferase             159   5e-42    
ref|WP_014149643.1|  serine--glyoxylate aminotransferase                157   5e-42    
ref|WP_010395294.1|  serine--glyoxylate aminotransferase                157   5e-42    
ref|WP_030092530.1|  serine--glyoxylate aminotransferase                157   6e-42    
ref|WP_043145413.1|  serine--glyoxylate aminotransferase                156   1e-41    
ref|WP_037293454.1|  serine--glyoxylate aminotransferase                156   1e-41    
ref|WP_036741500.1|  serine--glyoxylate aminotransferase                156   1e-41    
ref|WP_024505109.1|  serine--glyoxylate aminotransferase                156   2e-41    
gb|EBA13502.1|  Serine--glyoxylate transaminase                         156   2e-41    
ref|WP_034483968.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_034505845.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_037197032.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_015895604.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_037133426.1|  serine--glyoxylate aminotransferase                155   2e-41    
ref|WP_011280657.1|  serine--glyoxylate aminotransferase                155   4e-41    
ref|WP_013529882.1|  serine--glyoxylate aminotransferase                155   5e-41    
ref|WP_037094842.1|  serine--glyoxylate aminotransferase                154   5e-41    
ref|WP_037308357.1|  serine--glyoxylate aminotransferase                154   5e-41    
ref|WP_011750154.1|  serine--glyoxylate aminotransferase                154   5e-41    
ref|WP_028719065.1|  serine--glyoxylate aminotransferase                154   6e-41    
ref|WP_010968118.1|  serine--glyoxylate aminotransferase                154   6e-41    
gb|ABG64679.1|  serine-glyoxylate aminotransferase apoenzyme            154   7e-41    
ref|WP_041545642.1|  serine--glyoxylate aminotransferase                154   7e-41    
gb|ERL97602.1|  serine-pyruvate aminotransferase/archaeal asparta...    154   9e-41    
ref|WP_005670252.1|  serine-glyoxylate aminotransferase                 148   1e-40    
ref|WP_004668649.1|  serine--glyoxylate aminotransferase                154   1e-40    
ref|WP_031437003.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_006890572.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_037126267.1|  serine--glyoxylate aminotransferase                153   1e-40    
ref|WP_014869675.1|  serine--glyoxylate aminotransferase                153   2e-40    
ref|WP_018329867.1|  serine--glyoxylate aminotransferase                153   2e-40    
ref|WP_024844788.1|  serine--glyoxylate aminotransferase                153   2e-40    
ref|WP_016841706.1|  hypothetical protein                               150   2e-40    
ref|WP_009464599.1|  serine--glyoxylate aminotransferase                153   2e-40    
ref|WP_028712351.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_028716825.1|  serine--glyoxylate aminotransferase                152   2e-40    
ref|WP_009812827.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_011455723.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_027528516.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|WP_036753911.1|  serine--glyoxylate aminotransferase                152   3e-40    
ref|XP_001702107.1|  serine glyoxylate aminotransferase                 153   3e-40    
ref|XP_001702106.1|  serine glyoxylate aminotransferase                 153   3e-40    
ref|WP_023263325.1|  serine--glyoxylate aminotransferase                152   5e-40    
ref|WP_039621788.1|  serine--glyoxylate aminotransferase                152   5e-40    
ref|WP_008888199.1|  serine--glyoxylate aminotransferase                152   5e-40    
ref|WP_044591882.1|  serine--glyoxylate aminotransferase                152   5e-40    
ref|WP_021102121.1|  Serine--glyoxylate aminotransferase                152   5e-40    
ref|WP_044541799.1|  serine--glyoxylate aminotransferase                152   5e-40    
ref|WP_023002149.1|  MULTISPECIES: serine--glyoxylate aminotransf...    151   6e-40    
ref|WP_043774228.1|  serine--glyoxylate aminotransferase                151   7e-40    
ref|WP_043870950.1|  serine--glyoxylate aminotransferase                151   9e-40    
ref|WP_003594239.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_028035328.1|  serine--glyoxylate aminotransferase                151   1e-39    
ref|WP_013046086.1|  serine--glyoxylate aminotransferase                151   1e-39    
ref|WP_011872107.1|  serine--glyoxylate aminotransferase                151   1e-39    
ref|WP_008558487.1|  serine--glyoxylate aminotransferase                150   1e-39    
ref|WP_012329920.1|  MULTISPECIES: serine--glyoxylate aminotransf...    150   1e-39    
ref|WP_012045640.1|  serine--glyoxylate aminotransferase                150   2e-39    
emb|CAM59875.2|  alanine:glyoxylate aminotransferase                    143   2e-39    
ref|WP_020919828.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_038386888.1|  serine--glyoxylate aminotransferase                150   2e-39    
emb|CAM59878.2|  alanine:glyoxylate aminotransferase                    143   2e-39    
gb|EEE42985.1|  aminotransferase, class V superfamily                   150   2e-39    
ref|WP_042299583.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_018272711.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_039166767.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|WP_012078301.1|  serine--glyoxylate aminotransferase                150   2e-39    
ref|XP_005539023.1|  serine-glyoxylate aminotransferase                 150   2e-39    
ref|WP_039523955.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_009827863.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_040450969.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_015498822.1|  serine--glyoxylate aminotransferase                149   3e-39    
ref|WP_029357831.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_029167381.1|  hypothetical protein                               144   3e-39    
ref|WP_035632551.1|  serine--glyoxylate aminotransferase                150   3e-39    
ref|WP_028337735.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_020084034.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_006935547.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_006311601.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_015494023.1|  serine--glyoxylate aminotransferase                149   4e-39    
ref|WP_020180326.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_039195772.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_009178240.1|  serine--glyoxylate aminotransferase                149   5e-39    
ref|WP_024927669.1|  MULTISPECIES: serine--glyoxylate aminotransf...    149   5e-39    
ref|WP_028149694.1|  serine--glyoxylate aminotransferase                149   6e-39    
emb|CAM59876.2|  alanine:glyoxylate aminotransferase                    142   6e-39    
ref|WP_028818976.1|  serine--glyoxylate aminotransferase                149   6e-39    
ref|WP_028957602.1|  serine--glyoxylate aminotransferase                149   6e-39    
emb|CAM59874.1|  alanine:glyoxylate aminotransferase                    141   6e-39    
ref|WP_007351739.1|  serine--glyoxylate aminotransferase                149   7e-39    
ref|WP_021080443.1|  alanine-glyoxylate transaminase/serine-glyox...    149   7e-39    
ref|WP_007205927.1|  serine--glyoxylate aminotransferase                149   7e-39    
ref|WP_027555031.1|  serine--glyoxylate aminotransferase                149   8e-39    
gb|KJF70525.1|  serine--glyoxylate aminotransferase                     149   8e-39    
emb|CAM59867.2|  alanine:glyoxylate aminotransferase                    140   8e-39    
ref|WP_027156802.1|  serine--glyoxylate aminotransferase                148   9e-39    
ref|WP_039152395.1|  MULTISPECIES: serine--glyoxylate aminotransf...    148   9e-39    
ref|WP_037279938.1|  serine--glyoxylate aminotransferase                148   9e-39    
ref|WP_039194170.1|  serine--glyoxylate aminotransferase                148   9e-39    
gb|ABZ06639.1|  putative aminotransferase class-V                       148   9e-39    



>ref|XP_010938608.1| PREDICTED: serine--glyoxylate aminotransferase-like [Elaeis guineensis]
Length=401

 Score =   333 bits (854),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGV AA+AYLQNTTPMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVGAAAAYLQNTTPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_011090165.1| PREDICTED: serine--glyoxylate aminotransferase [Sesamum indicum]
Length=401

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 179/182 (98%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDN+IARHT
Sbjct  220  EATKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNIIARHT  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAVV+PSYIDS+EIV++AWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVVIPSYIDSTEIVRQAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_006659561.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Oryza brachyantha]
 ref|XP_006659562.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Oryza brachyantha]
 ref|XP_006659563.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Oryza brachyantha]
Length=402

 Score =   332 bits (850),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RHT
Sbjct  221  EASKTAKSVRVFFDWADYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIKRHT  280

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVK AWKRYNLSLGLGLN
Sbjct  281  RLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKHAWKRYNLSLGLGLN  340

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  341  KVAGKVFRIGHLGHLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPS  400

Query  104  RI  99
            RI
Sbjct  401  RI  402



>gb|KJB54391.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=215

 Score =   325 bits (832),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHT
Sbjct  34   EASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHT  93

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            R+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLN
Sbjct  94   RMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLN  153

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPS
Sbjct  154  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPS  213

Query  104  RI  99
            RI
Sbjct  214  RI  215



>gb|EYU35937.1| hypothetical protein MIMGU_mgv1a026291mg, partial [Erythranthe 
guttata]
Length=359

 Score =   329 bits (844),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA SVRVFFDW DYLKFYK+G+YWPYTPSIQLLYGLRA LDLLFEEGLDNVIARHT
Sbjct  178  EASKTATSVRVFFDWNDYLKFYKLGSYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHT  237

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL  ATRLAV AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  238  RLAKATRLAVDAWGLKNCTQKEEWFSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLN  297

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPV LGSGVAAASA+LQNTTP+IPS
Sbjct  298  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVTLGSGVAAASAFLQNTTPLIPS  357

Query  104  RI  99
            RI
Sbjct  358  RI  359



>ref|NP_001265946.1| Hop-interacting protein THI032 [Solanum lycopersicum]
 ref|XP_010314658.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314659.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314661.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314662.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010314663.1| PREDICTED: hop-interacting protein THI032 isoform X1 [Solanum 
lycopersicum]
 gb|AEW69795.1| Hop-interacting protein THI032 [Solanum lycopersicum]
Length=401

 Score =   330 bits (845),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH 
Sbjct  220  EASKTAKSVRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AAL47679.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+
Sbjct  220  EASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|KHG14448.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   328 bits (842),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH+
Sbjct  220  EATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|KJB83533.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=342

 Score =   327 bits (837),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+
Sbjct  161  EATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHS  220

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLN
Sbjct  221  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLN  280

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPS
Sbjct  281  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPS  340

Query  104  RI  99
            RI
Sbjct  341  RI  342



>ref|XP_004139054.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004166102.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN66521.1| Aminotransferase 1 [Cucumis sativus]
Length=401

 Score =   328 bits (842),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 166/182 (91%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+
Sbjct  220  EASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|KJB54393.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=306

 Score =   325 bits (833),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHT
Sbjct  125  EASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHT  184

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            R+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLN
Sbjct  185  RMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLN  244

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPS
Sbjct  245  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPS  304

Query  104  RI  99
            RI
Sbjct  305  RI  306



>ref|XP_006349776.1| PREDICTED: serine--glyoxylate aminotransferase-like [Solanum 
tuberosum]
Length=401

 Score =   328 bits (840),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH 
Sbjct  220  EASKTAKSVRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +I+SSEIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIESSEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEMVLKDIGYPVK GSGVAAASA+LQN+TP+IPS
Sbjct  340  KVAGKVFRIGHLGSLNELQLLGCLAGVEMVLKDIGYPVKFGSGVAAASAFLQNSTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AFK37194.1| unknown [Medicago truncatula]
Length=238

 Score =   322 bits (824),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  57   EASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHN  116

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLN
Sbjct  117  RLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLN  176

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPS
Sbjct  177  KVAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPS  236

Query  104  RI  99
            RI
Sbjct  237  RI  238



>ref|XP_007212264.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
 gb|EMJ13463.1| hypothetical protein PRUPE_ppa006653mg [Prunus persica]
Length=401

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            K+AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPS
Sbjct  340  KIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_009775939.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana sylvestris]
Length=401

 Score =   327 bits (839),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH 
Sbjct  220  EAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_009619693.1| PREDICTED: serine--glyoxylate aminotransferase [Nicotiana tomentosiformis]
Length=401

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDLLFEEGL+NVIARH 
Sbjct  220  EAAKTAKSVRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLLFEEGLENVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSVEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVK GSGVAAAS +LQN+TP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKFGSGVAAASTFLQNSTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_008227244.1| PREDICTED: serine--glyoxylate aminotransferase [Prunus mume]
Length=401

 Score =   327 bits (838),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ EEWFSDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQSEEWFSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            K+AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAY QN TP+IPS
Sbjct  340  KIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYFQNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_009338530.1| PREDICTED: serine--glyoxylate aminotransferase-like [Pyrus x 
bretschneideri]
Length=401

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AAB95218.1| putative serine-glyoxylate aminotransferase [Fritillaria agrestis]
Length=401

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+S RVFFDW DYLKFYK+GTYWPYTPSIQ+LYGLRA LDL+FEEGLDNVIARH+
Sbjct  220  EASKTAQSARVFFDWNDYLKFYKIGTYWPYTPSIQMLYGLRAALDLIFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+ YLQN+TPMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAATYLQNSTPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|NP_001284450.1| serine--glyoxylate aminotransferase [Cucumis melo]
 gb|AAQ56194.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 176/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  641  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  462
            ASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+R
Sbjct  221  ASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSR  280

Query  461  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  282
            LG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLNK  340

Query  281  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  102
            VAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPSR
Sbjct  341  VAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPSR  400

Query  101  I  99
            I
Sbjct  401  I  401



>ref|XP_009342610.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
 ref|XP_009342611.1| PREDICTED: serine--glyoxylate aminotransferase [Pyrus x bretschneideri]
Length=401

 Score =   327 bits (837),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+FEEGLDNVIARH+
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLVFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            K+AGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPS
Sbjct  340  KIAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_011080387.1| PREDICTED: serine--glyoxylate aminotransferase-like [Sesamum 
indicum]
Length=401

 Score =   326 bits (836),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 167/181 (92%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  641  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  462
            A+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH R
Sbjct  221  ATKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHAR  280

Query  461  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  282
            LG ATRLAVQAWGLKNCTQKEEW+SDTVTAVVVPS IDSSEIV+RAWKRYNLSLGLGLNK
Sbjct  281  LGQATRLAVQAWGLKNCTQKEEWYSDTVTAVVVPSNIDSSEIVRRAWKRYNLSLGLGLNK  340

Query  281  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSR  102
            VAGKVFRIGHLG+LNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAYLQN+TP IPSR
Sbjct  341  VAGKVFRIGHLGHLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYLQNSTPYIPSR  400

Query  101  I  99
            I
Sbjct  401  I  401



>gb|AAQ56192.1| aminotransferase 1 [Cucumis melo]
Length=401

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+
Sbjct  220  EASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVF IGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPS
Sbjct  340  KVAGKVFSIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AGT38285.1| serine--glyoxylate aminotransferase [Gossypium hirsutum]
 gb|KJB83532.1| hypothetical protein B456_013G252200 [Gossypium raimondii]
Length=401

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDN+I RH+
Sbjct  220  EATKTAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNIIERHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDSSEIVKR WKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSSEIVKRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_004291746.1| PREDICTED: serine--glyoxylate aminotransferase [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   326 bits (836),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPS+QLLYGLRA LDLLFEEGLDNVIARH+
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSVQLLYGLRAALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            K+AGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN TP+IPS
Sbjct  340  KIAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDLGYPVKLGSGVAAASAYLQNNTPLIPS  399

Query  104  RI  99
            R+
Sbjct  400  RV  401



>ref|XP_002531124.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
 gb|EEF31258.1| serine-pyruvate aminotransferase, putative [Ricinus communis]
Length=401

 Score =   326 bits (835),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDYLKFYKMGT+WPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  220  EASKTAKSVRVFFDWKDYLKFYKMGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGL NCTQKEEWFSDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLNNCTQKEEWFSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_006369574.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66143.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=244

 Score =   320 bits (820),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH 
Sbjct  63   EASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHA  122

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  123  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLN  182

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I S
Sbjct  183  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIAS  242

Query  104  RI  99
            RI
Sbjct  243  RI  244



>gb|KJB54389.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54390.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54392.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
 gb|KJB54394.1| hypothetical protein B456_009G074800 [Gossypium raimondii]
Length=401

 Score =   325 bits (834),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARHT
Sbjct  220  EASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHT  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            R+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLN
Sbjct  280  RMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_008363560.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   325 bits (833),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+
Sbjct  220  EASKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ EEW SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQSEEWVSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            K+AGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGVAAASAY QN TP+IPS
Sbjct  340  KIAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVAAASAYFQNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_007015204.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015205.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 ref|XP_007015206.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32823.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32824.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
 gb|EOY32825.1| Alanine:glyoxylate aminotransferase isoform 1 [Theobroma cacao]
Length=401

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GT+WPYTPS+QLLYGLRA LDL+FEEGLDNVI RH+
Sbjct  220  EASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSVQLLYGLRAALDLIFEEGLDNVITRHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQNT PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_010557501.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
 ref|XP_010557502.1| PREDICTED: serine--glyoxylate aminotransferase [Tarenaya hassleriana]
Length=401

 Score =   324 bits (831),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EASKTAKSVRVFFDWSDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAVQAWGLKNCTQKEEW+SDTVTAVVVP +IDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVQAWGLKNCTQKEEWYSDTVTAVVVPPHIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAA AYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILRDVGYPVKLGSGVAAACAYLQNNVPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_010909203.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
 ref|XP_010909204.1| PREDICTED: serine--glyoxylate aminotransferase [Elaeis guineensis]
Length=402

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+
Sbjct  221  EASKMAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHS  280

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQK+EWFSDTVTAVVVP YIDS+++V+R WKRYNLSLGLGLN
Sbjct  281  RLGKATRLAVEAWGLKNCTQKDEWFSDTVTAVVVPPYIDSADVVRRGWKRYNLSLGLGLN  340

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQLLGCL+GVEM+LKD+GYPVKLGSGVAAA+AYLQNTTPMIPS
Sbjct  341  KVAGKVFRIGHLGNVNELQLLGCLSGVEMILKDVGYPVKLGSGVAAAAAYLQNTTPMIPS  400

Query  104  RI  99
            RI
Sbjct  401  RI  402



>ref|XP_006843377.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
 gb|ERN05052.1| hypothetical protein AMTR_s00053p00093890 [Amborella trichopoda]
Length=401

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYL+FYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+
Sbjct  220  EASKSAKSVRVFFDWNDYLRFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVV+P+ IDSSEIV+RAW RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVIPANIDSSEIVRRAWNRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEM+LKD+GYPVKLGSGVAAASAYLQN+ PMI S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLSGVEMILKDVGYPVKLGSGVAAASAYLQNSIPMIAS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_006369569.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66138.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=311

 Score =   321 bits (822),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH 
Sbjct  130  EASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHA  189

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  190  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLN  249

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I S
Sbjct  250  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIAS  309

Query  104  RI  99
            RI
Sbjct  310  RI  311



>ref|XP_008812510.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812512.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812513.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
 ref|XP_008812514.1| PREDICTED: serine--glyoxylate aminotransferase [Phoenix dactylifera]
Length=401

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EASKMAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+E+V+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEVVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEM+LKD+G PVKLGSGVAAA+AYLQNT PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLSGVEMILKDLGCPVKLGSGVAAAAAYLQNTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|NP_001237048.1| enzymatic resistance protein [Glycine max]
 gb|AAZ94162.1| enzymatic resistance protein [Glycine max]
Length=401

 Score =   324 bits (830),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA L+L+FEEGL+NVIARH+
Sbjct  220  EASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALNLIFEEGLENVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|ACJ61246.1| serine glyoxylate aminotransferase 2 [Glycine max]
Length=401

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+
Sbjct  220  EASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_006584642.1| PREDICTED: enzymatic resistance protein isoform X1 [Glycine max]
 gb|ACE63506.1| alanine:glyoxylate aminotransferase [Vigna radiata]
 gb|ACU23313.1| unknown [Glycine max]
 gb|KHM99689.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   323 bits (829),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+
Sbjct  220  EASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09250.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=362

 Score =   322 bits (825),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH+
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHS  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_010277598.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
 ref|XP_010277599.1| PREDICTED: serine--glyoxylate aminotransferase [Nelumbo nucifera]
Length=401

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+
Sbjct  220  EASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSSEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|NP_001062170.1| Os08g0502700 [Oryza sativa Japonica Group]
 dbj|BAD08917.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAD09269.1| putative aminotransferase [Oryza sativa Japonica Group]
 dbj|BAF24084.1| Os08g0502700 [Oryza sativa Japonica Group]
 gb|EAZ07527.1| hypothetical protein OsI_29783 [Oryza sativa Indica Group]
 gb|EAZ43252.1| hypothetical protein OsJ_27850 [Oryza sativa Japonica Group]
 dbj|BAG89198.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89373.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   323 bits (828),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLR  LDL+FEEGL+NVI RH 
Sbjct  221  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRTALDLIFEEGLENVIKRHN  280

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLN
Sbjct  281  RLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLN  340

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQL+G L+GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  341  KVAGKVFRIGHLGHLNELQLMGALSGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPS  400

Query  104  RI  99
            RI
Sbjct  401  RI  402



>ref|XP_010045046.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 ref|XP_010045047.1| PREDICTED: serine--glyoxylate aminotransferase [Eucalyptus grandis]
 gb|KCW87200.1| hypothetical protein EUGRSUZ_B03720 [Eucalyptus grandis]
Length=401

 Score =   323 bits (828),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS +VFFDWKDYLKFY+MGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EASKTAKSYKVFFDWKDYLKFYQMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL T TRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YI+SSEIV+RAWKRYNLSLGLGLN
Sbjct  280  RLATGTRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIESSEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYP+KLGSGV AASAY QNTTP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPIKLGSGVGAASAYFQNTTPLIAS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_010673724.1| PREDICTED: serine--glyoxylate aminotransferase [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+
Sbjct  220  EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP +IDS+E+VKRAW+RYN+SLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPHIDSNEVVKRAWRRYNMSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQLLG LAGVEM+LKD+GYPVKLGSGVAAA+AYLQN+TPMI S
Sbjct  340  KVAGKVFRIGHLGNINELQLLGALAGVEMILKDVGYPVKLGSGVAAAAAYLQNSTPMITS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_008359496.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
 ref|XP_008359497.1| PREDICTED: serine--glyoxylate aminotransferase [Malus domestica]
Length=401

 Score =   323 bits (827),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 164/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEW SDTVTAV+VP +IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQREEWVSDTVTAVLVPPHIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVL+D+GY VKLGSGVAAASAYLQN TP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLRDVGYXVKLGSGVAAASAYLQNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_008666471.1| PREDICTED: serine--glyoxylate aminotransferase-like [Zea mays]
 tpg|DAA47907.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=262

 Score =   318 bits (814),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH 
Sbjct  81   EASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHN  140

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGL NC QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLN
Sbjct  141  RLGTATRLAVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLN  200

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  201  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPS  260

Query  104  RI  99
            RI
Sbjct  261  RI  262



>dbj|BAJ90006.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90413.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95504.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95684.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHT
Sbjct  220  EAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHT  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV AWGLKNCT+KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLN
Sbjct  280  RLGTATRLAVAAWGLKNCTEKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|ABQ81924.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   323 bits (827),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_008449670.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
melo]
 gb|AAQ56195.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   323 bits (827),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|ABQ81922.1| aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   323 bits (827),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_003600159.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70410.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AAQ56193.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   322 bits (826),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|NP_001284445.1| serine--glyoxylate aminotransferase-like [Cucumis melo]
 gb|ABQ81923.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   322 bits (826),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|KHN28521.1| Serine--glyoxylate aminotransferase [Glycine soja]
Length=401

 Score =   322 bits (826),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 177/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKS+RVFFDWKD+LKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+
Sbjct  220  EASKHAKSLRVFFDWKDHLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_004499480.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+
Sbjct  220  EASKSAKSLRVFFDWSDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ EEW+SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQSEEWYSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+K GSGVAAASAYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIKYGSGVAAASAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|NP_001276276.1| serine--glyoxylate aminotransferase-like [Glycine max]
 gb|ACU18294.1| unknown [Glycine max]
Length=401

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+
Sbjct  220  EASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL GVEM+LKD+GYPVKLGSGVAAASAYLQ+T PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLTGVEMILKDVGYPVKLGSGVAAASAYLQDTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AAL62332.1|AF461048_1 aminotransferase 2 [Cucumis melo]
Length=401

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLR  LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRPALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_009415566.1| PREDICTED: serine--glyoxylate aminotransferase [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDLLFEEGLDNVIARH+
Sbjct  220  EAAKTAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVPSYI+S+++VKRAW RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPSYINSADVVKRAWTRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVL+D+GYPVKLGSGVAAA+AYL+N+TPMI S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLRDVGYPVKLGSGVAAAAAYLRNSTPMITS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|KDP35982.1| hypothetical protein JCGZ_08377 [Jatropha curcas]
Length=401

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+SVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EASKTARSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP  IDS+EIV+R WKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPSIDSAEIVRRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASA+LQN TP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMLLRDVGYPVKLGSGVAAASAFLQNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|EMS66805.1| Serine--glyoxylate aminotransferase [Triticum urartu]
Length=401

 Score =   322 bits (825),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 169/182 (93%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHT
Sbjct  220  EAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHT  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLN
Sbjct  280  RLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCL GVEMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLGGVEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|KHG29969.1| Serine--glyoxylate aminotransferase -like protein [Gossypium 
arboreum]
Length=401

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GT+WPYTPSIQLLYGLRA LDL+FEEGLD+VIARH 
Sbjct  220  EASKSAKSVRVFFDWNDYLKFYKLGTFWPYTPSIQLLYGLRAALDLIFEEGLDSVIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            R+G ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYN+SLGLGLN
Sbjct  280  RMGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSAEIVKRAWKRYNMSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN  PMIPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AFK40703.1| unknown [Medicago truncatula]
Length=401

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKR+NLSLGLGLN
Sbjct  280  RLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRFNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLG LAGVEM+LKD+GYPVKLGSGVAAASAYLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGALAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|ABQ81925.1| aminotransferase 2 [Cucumis melo]
Length=401

 Score =   321 bits (823),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVVVP Y+DS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVVVPPYMDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+YLQN  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYLQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|KDO44953.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=401

 Score =   321 bits (823),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH 
Sbjct  220  EASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHR  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_006470731.1| PREDICTED: serine--glyoxylate aminotransferase-like [Citrus sinensis]
Length=401

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH 
Sbjct  220  EASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHR  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_007146302.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 ref|XP_007146303.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18296.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
 gb|ESW18297.1| hypothetical protein PHAVU_006G029100g [Phaseolus vulgaris]
Length=401

 Score =   321 bits (822),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGTATRLAVEAWGLKNCTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG LNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPS
Sbjct  340  KVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09255.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   319 bits (817),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ACJ61247.1| serine glyoxylate aminotransferase 3 [Glycine max]
Length=401

 Score =   320 bits (821),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK AKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH+
Sbjct  220  EASKHAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP+YIDS+EIV+RAWKR NLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPAYIDSTEIVRRAWKRNNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQNT PMIPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNTIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_002298306.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 ref|XP_006369570.1| aminotransferase 2 family protein [Populus trichocarpa]
 ref|XP_006369571.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|EEE83111.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66139.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|ERP66140.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=401

 Score =   320 bits (821),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH 
Sbjct  220  EASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN+TP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNSTPLIAS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09299.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   319 bits (817),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09298.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   318 bits (816),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09273.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=362

 Score =   318 bits (816),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AGV54322.1| serine glyoxylate aminotransferase 2 [Phaseolus vulgaris]
Length=401

 Score =   320 bits (819),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCT+KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGTATRLAVEAWGLKNCTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG LNELQLLGCLAGVEM+L+D+GYPVKLGSGVAAASAY +NT P+IPS
Sbjct  340  KVAGKVFRIGHLGYLNELQLLGCLAGVEMILQDVGYPVKLGSGVAAASAYFKNTIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|EPS59280.1| serine-glyoxylate aminotransferase [Genlisea aurea]
Length=401

 Score =   319 bits (818),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+K+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EATKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLVFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ EEW SDTVTA++VPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQSEEWVSDTVTAIMVPSYIDSAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVE+VL+D+GYPVKLGSGVAAASAY QN+TP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVELVLRDVGYPVKLGSGVAAASAYFQNSTPLISS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>emb|CBI24214.3| unnamed protein product [Vitis vinifera]
Length=374

 Score =   318 bits (815),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+A+SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+
Sbjct  193  EASKSAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHS  252

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  253  RLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLN  312

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPS
Sbjct  313  KVAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPS  372

Query  104  RI  99
            RI
Sbjct  373  RI  374



>ref|XP_006446249.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 ref|XP_006446250.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59489.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
 gb|ESR59490.1| hypothetical protein CICLE_v10015490mg [Citrus clementina]
Length=401

 Score =   319 bits (818),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH 
Sbjct  220  EASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHR  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP +I+SSEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPPHINSSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAASAYLQN  PMIPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASAYLQNNIPMIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_004140203.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 ref|XP_004156042.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cucumis 
sativus]
 gb|KGN48108.1| Aminotransferase 2 [Cucumis sativus]
Length=401

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EASKTAKSLRVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLVFEEGLENVIARHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAV+VP YIDSSEIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGQATRLAVEAWGLKNCTQKEEWHSDTVTAVLVPPYIDSSEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS+Y QN  P+IPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASSYFQNNIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09247.1| alanine glyoxylate aminotransferase [Peperomia cavispicata]
Length=342

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  165  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  224

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  225  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  284

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  285  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  342



>ref|XP_011043786.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043787.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
 ref|XP_011043788.1| PREDICTED: serine--glyoxylate aminotransferase [Populus euphratica]
Length=401

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 162/182 (89%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH 
Sbjct  220  EASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFLEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIAS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09254.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   318 bits (814),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|ACN39798.1| unknown [Picea sitchensis]
Length=401

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHT
Sbjct  220  EATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHT  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIAS  399

Query  104  RI  99
            R+
Sbjct  400  RV  401



>gb|ABK24112.1| unknown [Picea sitchensis]
Length=401

 Score =   319 bits (817),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARHT
Sbjct  220  EATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHT  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKDIGYPVKLGSGVAAA+AYLQ TTP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDIGYPVKLGSGVAAAAAYLQMTTPLIAS  399

Query  104  RI  99
            R+
Sbjct  400  RV  401



>gb|AEX09265.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=353

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  176  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  235

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  236  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  295

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  296  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  353



>gb|AEX09258.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09253.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09256.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=362

 Score =   317 bits (813),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09285.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=350

 Score =   317 bits (812),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  173  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  232

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  233  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  292

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  293  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  350



>gb|AEX09257.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
 gb|AEX09278.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
 gb|AEX09279.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=362

 Score =   317 bits (813),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09276.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   317 bits (812),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09303.1| alanine glyoxylate aminotransferase [Peperomia ayacuchoana]
Length=351

 Score =   317 bits (811),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  174  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  233

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  234  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  293

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  294  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  351



>gb|AEX09267.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=362

 Score =   317 bits (812),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGRATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_002279236.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
 ref|XP_010651495.1| PREDICTED: serine--glyoxylate aminotransferase [Vitis vinifera]
Length=401

 Score =   318 bits (815),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+A+SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+
Sbjct  220  EASKSAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPS
Sbjct  340  KVAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|ACN36238.1| unknown [Zea mays]
Length=328

 Score =   315 bits (808),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH 
Sbjct  147  EASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHN  206

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLN
Sbjct  207  RLGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLN  266

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  267  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPS  326

Query  104  RI  99
            RI
Sbjct  327  RI  328



>emb|CAN84001.1| hypothetical protein VITISV_007680 [Vitis vinifera]
Length=401

 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK A+SVR FFDW DYLKFYK+GT+WPYTPSIQLLYG+RA LD++FEEGLDNVI RH+
Sbjct  220  EASKXAQSVRFFFDWNDYLKFYKLGTFWPYTPSIQLLYGMRAALDIIFEEGLDNVIERHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQREEWFSDTVTAVVVPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LN++QLLGCLAGVEMVLKD+GYPVK+GSGV AASAYLQNT P+IPS
Sbjct  340  KVAGKVFRIGHLGHLNDVQLLGCLAGVEMVLKDVGYPVKMGSGVGAASAYLQNTIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_002444789.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
 gb|EES14284.1| hypothetical protein SORBIDRAFT_07g028080 [Sorghum bicolor]
Length=402

 Score =   317 bits (813),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK A+SVRVFFDWKDYL+FY+MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH 
Sbjct  221  EASKAARSVRVFFDWKDYLRFYEMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVKRHN  280

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATR AV+AWGLKNC QKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLN
Sbjct  281  RLGTATRFAVEAWGLKNCCQKEECFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLN  340

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  341  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPS  400

Query  104  RI  99
            RI
Sbjct  401  RI  402



>gb|AEX09275.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=362

 Score =   316 bits (809),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQEEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09311.1| alanine glyoxylate aminotransferase [Peperomia andina]
Length=362

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRATLDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYI+S+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYINSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09305.1| alanine glyoxylate aminotransferase [Peperomia pseudoverruculosa]
Length=362

 Score =   315 bits (807),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+R WKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRGWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>ref|XP_004973838.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X2 
[Setaria italica]
 ref|XP_004973839.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X3 
[Setaria italica]
Length=402

 Score =   316 bits (810),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH 
Sbjct  221  EASKTAKSVRVFFDWNDYLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHK  280

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLN
Sbjct  281  RLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLN  340

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  341  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPS  400

Query  104  RI  99
            RI
Sbjct  401  RI  402



>ref|XP_003574732.2| PREDICTED: serine--glyoxylate aminotransferase [Brachypodium 
distachyon]
Length=461

 Score =   318 bits (815),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 168/182 (92%), Positives = 176/182 (97%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDL+FEEGLDNVI RHT
Sbjct  280  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLIFEEGLDNVIKRHT  339

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATR+AV+AWGLKNCTQKEE FSDTVTAVVVP YIDS+EIVK AWKRYNLSLGLGLN
Sbjct  340  RLGTATRMAVEAWGLKNCTQKEENFSDTVTAVVVPPYIDSAEIVKHAWKRYNLSLGLGLN  399

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N TP+IPS
Sbjct  400  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNATPLIPS  459

Query  104  RI  99
            RI
Sbjct  460  RI  461



>emb|CDP08481.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 161/182 (88%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDYLK YK+GTYWPYTPSI LLYGLRA LDL+FEEGL+NV ARH 
Sbjct  220  EASKTAKSVRVFFDWKDYLKVYKLGTYWPYTPSIHLLYGLRAALDLIFEEGLENVFARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL  ATRLA++AWGLKNCTQKEEW+SDTVTAV+VP  IDSSEIV+RAWKRYNLSLGLGLN
Sbjct  280  RLAKATRLAMEAWGLKNCTQKEEWYSDTVTAVLVPPNIDSSEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKD+GYPVKLGSGV AA AYLQNTTP+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDVGYPVKLGSGVGAACAYLQNTTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09248.1| alanine glyoxylate aminotransferase [Peperomia questionis]
Length=360

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 170/176 (97%), Gaps = 0/176 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  117
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTP  360



>ref|NP_001148339.1| LOC100281949 [Zea mays]
 ref|XP_008675752.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 ref|XP_008675758.1| PREDICTED: LOC100281949 isoform X1 [Zea mays]
 gb|ACG30854.1| serine--glyoxylate aminotransferase [Zea mays]
 gb|ACN28633.1| unknown [Zea mays]
 tpg|DAA47859.1| TPA: Serine--glyoxylate aminotransferase isoform 1 [Zea mays]
 tpg|DAA47860.1| TPA: Serine--glyoxylate aminotransferase isoform 2 [Zea mays]
 tpg|DAA47861.1| TPA: Serine--glyoxylate aminotransferase isoform 3 [Zea mays]
 tpg|DAA47862.1| TPA: Serine--glyoxylate aminotransferase isoform 4 [Zea mays]
Length=403

 Score =   316 bits (809),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH 
Sbjct  222  EASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHN  281

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLN
Sbjct  282  RLGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLN  341

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  342  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPS  401

Query  104  RI  99
            RI
Sbjct  402  RI  403



>gb|AEX09270.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09296.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
 gb|AEX09297.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=362

 Score =   314 bits (805),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>gb|AEX09307.1| alanine glyoxylate aminotransferase [Peperomia verruculosa]
Length=351

 Score =   314 bits (804),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  174  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  233

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLN
Sbjct  234  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLN  293

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  294  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>ref|XP_004973837.1| PREDICTED: serine--glyoxylate aminotransferase-like isoform X1 
[Setaria italica]
Length=437

 Score =   316 bits (810),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLK YK+G+YWPYTPSIQLLYGLRA LDLLF EGLDNV  RH 
Sbjct  256  EASKTAKSVRVFFDWNDYLKSYKIGSYWPYTPSIQLLYGLRAALDLLFLEGLDNVFKRHK  315

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS EIVK AWKRYNLSLGLGLN
Sbjct  316  RLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSGEIVKHAWKRYNLSLGLGLN  375

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  376  KVAGKVFRIGHLGNLNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPS  435

Query  104  RI  99
            RI
Sbjct  436  RI  437



>gb|ABA00460.1| serine-glyoxylate aminotransferase [Spirodela polyrhiza]
Length=401

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 163/182 (90%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI RH+
Sbjct  220  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIRRHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDSSEIV+RAWKR+NLSLGLGLN
Sbjct  280  RLGTATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPGYIDSSEIVRRAWKRFNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVL+D+GYP KLGSGVAAA+AYL N TP+IPS
Sbjct  340  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLRDVGYPAKLGSGVAAAAAYLLNNTPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_002313371.1| aminotransferase 2 family protein [Populus trichocarpa]
 gb|EEE87326.1| aminotransferase 2 family protein [Populus trichocarpa]
Length=401

 Score =   315 bits (807),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 160/182 (88%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH 
Sbjct  220  EASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIAS  399

Query  104  RI  99
            R+
Sbjct  400  RV  401



>ref|XP_009410322.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009410323.1| PREDICTED: serine--glyoxylate aminotransferase-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   315 bits (807),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+K+AKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYG RA LDLLFEEGLDNVIARH+
Sbjct  220  EAAKSAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGFRAALDLLFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP +I+SS++VKRAW RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMVPPHINSSDVVKRAWTRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLN+LQLLGCL+GVEMVL+D+GY VKLGSGVAAA+AYLQNT PMI S
Sbjct  340  KVAGKVFRIGHLGNLNDLQLLGCLSGVEMVLRDVGYQVKLGSGVAAAAAYLQNTIPMISS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09259.1| alanine glyoxylate aminotransferase [Peperomia bracteata]
Length=351

 Score =   313 bits (801),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  174  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  233

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+A GLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  234  RLGKATRLAVEARGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  293

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  294  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  351



>gb|AEX09306.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=362

 Score =   313 bits (801),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTTPLI  362



>gb|AEX09300.1| alanine glyoxylate aminotransferase [Peperomia parvifolia]
Length=362

 Score =   313 bits (801),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW D LKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDNLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAW+RYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWERYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNTTP+I
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNTTPLI  362



>ref|XP_011032100.1| PREDICTED: serine--glyoxylate aminotransferase-like [Populus 
euphratica]
Length=401

 Score =   313 bits (803),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 170/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH 
Sbjct  220  EASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIAS  399

Query  104  RI  99
            R+
Sbjct  400  RV  401



>gb|AEX09293.1| alanine glyoxylate aminotransferase [Peperomia rupiseda]
Length=358

 Score =   312 bits (799),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09301.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=358

 Score =   311 bits (797),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVKLGSGVAAA+AYLQNT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKLGSGVAAAAAYLQNT  358



>gb|AEX09304.1| alanine glyoxylate aminotransferase [Peperomia chutanka]
Length=358

 Score =   311 bits (796),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>gb|ABK96624.1| unknown [Populus trichocarpa x Populus deltoides]
Length=401

 Score =   312 bits (800),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDYLKFY +GT+WPYTPSIQLLYGLRA LDLLF EGL+NV  RH 
Sbjct  220  EASKTAKSVRVFFDWKDYLKFYNLGTFWPYTPSIQLLYGLRAALDLLFAEGLENVFERHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            R G ATRLAV+AWGLKNCTQKEEWFSDTVTAVVVP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  280  RPGKATRLAVEAWGLKNCTQKEEWFSDTVTAVVVPPYIDSAEIVRRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAA AYLQN TP+I S
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAACAYLQNNTPLIAS  399

Query  104  RI  99
            R+
Sbjct  400  RV  401



>ref|XP_006409690.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
 gb|ESQ51143.1| hypothetical protein EUTSA_v10022711mg [Eutrema salsugineum]
Length=401

 Score =   312 bits (799),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>emb|CDX81443.1| BnaC09g08540D [Brassica napus]
Length=401

 Score =   311 bits (798),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>emb|CDY37208.1| BnaA09g08290D [Brassica napus]
Length=401

 Score =   311 bits (798),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_009112244.1| PREDICTED: serine--glyoxylate aminotransferase [Brassica rapa]
Length=401

 Score =   311 bits (798),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 157/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYP+ LGSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPIVLGSGVAAASTYLQHHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>dbj|BAJ33858.1| unnamed protein product [Thellungiella halophila]
Length=438

 Score =   313 bits (801),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/182 (87%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  257  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  316

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAVVVP  IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  317  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVVVPPNIDSTEIVKRAWKRYNLSLGLGLN  376

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPS
Sbjct  377  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHHIPLIPS  436

Query  104  RI  99
            RI
Sbjct  437  RI  438



>gb|AEX09286.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=358

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGEATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09249.1| alanine glyoxylate aminotransferase [Peperomia aff. gracillima 
JN-2011]
Length=358

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>gb|AEX09263.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=358

 Score =   310 bits (793),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/174 (90%), Positives = 168/174 (97%), Gaps = 0/174 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQNT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQNT  358



>ref|XP_009136209.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 ref|XP_009136210.1| PREDICTED: serine--glyoxylate aminotransferase-like [Brassica 
rapa]
 emb|CDX93112.1| BnaA03g38340D [Brassica napus]
Length=401

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/182 (86%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09268.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=359

 Score =   307 bits (786),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTT  120
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNTT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNTT  359



>gb|AEX09295.1| alanine glyoxylate aminotransferase [Peperomia pugnicaudex]
Length=356

 Score =   306 bits (785),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQ
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQ  356



>emb|CDX89604.1| BnaC03g45180D [Brassica napus]
Length=401

 Score =   307 bits (787),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 155/182 (85%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  IDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCLAGVEM+LKD+GYPV LGSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGHLNELQLLGCLAGVEMILKDVGYPVVLGSGVAAASTYLQHQIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09308.1| alanine glyoxylate aminotransferase [Peperomia polycephala]
Length=356

 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/172 (90%), Positives = 165/172 (96%), Gaps = 0/172 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA+AYLQ
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAAAYLQ  356



>gb|AEX09274.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=358

 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/174 (89%), Positives = 165/174 (95%), Gaps = 0/174 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA AYLQNT
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAAEAYLQNT  358



>ref|XP_010518509.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518516.1| PREDICTED: serine--glyoxylate aminotransferase isoform X1 [Camelina 
sativa]
 ref|XP_010518525.1| PREDICTED: serine--glyoxylate aminotransferase isoform X2 [Camelina 
sativa]
Length=401

 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            K+AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQN  P+IPS
Sbjct  340  KIAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQNHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_010488837.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=401

 Score =   306 bits (783),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            K+AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+IPS
Sbjct  340  KIAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|NP_178969.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 ref|NP_849951.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 sp|Q56YA5.2|SGAT_ARATH RecName: Full=Serine--glyoxylate aminotransferase; AltName: Full=Alanine--glyoxylate 
aminotransferase; Short=AGT; AltName: 
Full=Asparagine aminotransferase; AltName: Full=Serine--pyruvate 
aminotransferase [Arabidopsis thaliana]
 gb|AAC26854.1| alanine:glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAD28669.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 dbj|BAB20811.1| serine glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM20136.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AAM45058.1| putative alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06227.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
 gb|AEC06228.1| alanine--glyoxylate aminotransferase [Arabidopsis thaliana]
Length=401

 Score =   305 bits (780),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|ABF70331.1| aminotransferase 1 [Cucumis sativus]
Length=386

 Score =   304 bits (778),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKT+KSV+VFFDWKDYLKFY +GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+
Sbjct  213  EASKTSKSVKVFFDWKDYLKFYNLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHS  272

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATR AV+AWGLKNCTQKEEWFSDTVTAV+VPSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  273  RLGKATRPAVEAWGLKNCTQKEEWFSDTVTAVLVPSYIDSAEIVRRAWKRYNLSLGLGLN  332

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  126
            KVAGKVFRIGHLGNLNELQLLGCLAGVEM+LKD+GYPVKLGSGVAAAS  L N
Sbjct  333  KVAGKVFRIGHLGNLNELQLLGCLAGVEMILKDVGYPVKLGSGVAAASESLVN  385



>ref|XP_002885871.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62130.1| hypothetical protein ARALYDRAFT_480305 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/182 (83%), Positives = 171/182 (94%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IAR+ 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARNA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+IPS
Sbjct  340  KVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|EMT09291.1| Serine--glyoxylate aminotransferase [Aegilops tauschii]
Length=290

 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 172/182 (95%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
             A+KTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVI RHT
Sbjct  109  SAAKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQLLYGLRAGLDLLFEEGLDNVIKRHT  168

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV AWGLKNCT KEE FSDTVTAVVVP YIDSSEIVK AWKRYNLSLGLGLN
Sbjct  169  RLGTATRLAVAAWGLKNCTAKEENFSDTVTAVVVPPYIDSSEIVKHAWKRYNLSLGLGLN  228

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG+LNELQLLGCL G EMVLKDIGYPVKLGSGVAAA+AYL N+TP+IPS
Sbjct  229  KVAGKVFRIGHLGHLNELQLLGCLGGGEMVLKDIGYPVKLGSGVAAAAAYLSNSTPLIPS  288

Query  104  RI  99
            RI
Sbjct  289  RI  290



>ref|XP_006297832.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
 gb|EOA30730.1| hypothetical protein CARUB_v10013869mg [Capsella rubella]
Length=401

 Score =   300 bits (768),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP  ID SE+V+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPNIDGSEVVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P+I S
Sbjct  340  KVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIPLILS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEA48973.1| glyoxylate aminotransferase [Rosa roxburghii]
Length=168

 Score =   289 bits (740),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 147/167 (88%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  599  KDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGL  420
            ++YLKFYK+GTYWPYTPSIQLLYGLRA LDLLFEEGLDNVIARH+RLG ATR AV+AWGL
Sbjct  2    ENYLKFYKLGTYWPYTPSIQLLYGLRAALDLLFEEGLDNVIARHSRLGKATRHAVEAWGL  61

Query  419  KNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNL  240
            KNCTQKEEW SDTVTAV+VP YIDS+EIV+RAWKRYNLSLGLGLNK+AGKVFRIGHLGNL
Sbjct  62   KNCTQKEEWVSDTVTAVLVPPYIDSTEIVRRAWKRYNLSLGLGLNKIAGKVFRIGHLGNL  121

Query  239  NELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  99
            NELQLLGCLAGVEMVL+D+GYPVKLGSGVAAASAYLQN  P+IPSR+
Sbjct  122  NELQLLGCLAGVEMVLRDVGYPVKLGSGVAAASAYLQNNIPLIPSRV  168



>gb|AEX09277.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=351

 Score =   293 bits (750),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 150/167 (90%), Positives = 160/167 (96%), Gaps = 0/167 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  144
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  351



>gb|AEX09245.1| alanine glyoxylate aminotransferase [Peperomia putlaensis]
Length=349

 Score =   293 bits (749),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 159/165 (96%), Gaps = 0/165 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  150
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09281.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=330

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  165  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  224

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLN
Sbjct  225  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLN  284

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  147
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  285  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  330



>gb|AEX09272.1| alanine glyoxylate aminotransferase [Peperomia cyclaminoides]
Length=338

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 149/166 (90%), Positives = 159/166 (96%), Gaps = 0/166 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  173  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  232

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PS IDS+EIV+RAWKRYNLSLGLGLN
Sbjct  233  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSNIDSAEIVRRAWKRYNLSLGLGLN  292

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  147
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  293  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>ref|XP_010467178.1| PREDICTED: serine--glyoxylate aminotransferase-like [Camelina 
sativa]
Length=454

 Score =   295 bits (754),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KT+KS++VFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EATKTSKSLKVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTP  117
            K+AGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYP+ +GSGVAAAS YLQN  P
Sbjct  340  KIAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPIVMGSGVAAASTYLQNHIP  395



>gb|AEX09280.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=330

 Score =   290 bits (742),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 158/167 (95%), Gaps = 0/167 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  164  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHA  223

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  224  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  283

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAA  144
            KV GKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAAA
Sbjct  284  KVXGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAAA  330



>gb|AEX09266.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=350

 Score =   291 bits (744),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIXRHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  147
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  350



>gb|AEX09284.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=338

 Score =   290 bits (741),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 148/166 (89%), Positives = 158/166 (95%), Gaps = 0/166 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  173  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  232

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  233  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  292

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAA  147
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVAA
Sbjct  293  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVAA  338



>gb|AEX09261.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=327

 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  165  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  224

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  225  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  284

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSG  156
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSG
Sbjct  285  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSG  327



>gb|AEX09269.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=328

 Score =   288 bits (738),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  164  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIERHA  223

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  224  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  283

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  150
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  284  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  328



>gb|AEX09271.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=332

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  168  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  227

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  228  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  287

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  150
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  288  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  332



>gb|AEX09283.1| alanine glyoxylate aminotransferase [Peperomia peruviana]
Length=349

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 147/165 (89%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVA  150
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK GSGVA
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFGSGVA  349



>gb|AEX09294.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=345

 Score =   286 bits (733),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  162
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  345



>gb|AEX09264.1| alanine glyoxylate aminotransferase [Peperomia radiatinervosa]
Length=334

 Score =   285 bits (729),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 145/161 (90%), Positives = 155/161 (96%), Gaps = 0/161 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  174  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  233

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  234  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  293

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLG  162
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK G
Sbjct  294  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVKFG  334



>gb|AEX09302.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=343

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 143/159 (90%), Positives = 153/159 (96%), Gaps = 0/159 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI RH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIDRHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFS+TVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWFSNTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVK  168
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPVK
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPVK  343



>ref|XP_004491262.1| PREDICTED: serine--glyoxylate aminotransferase-like [Cicer arietinum]
Length=401

 Score =   285 bits (729),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 162/182 (89%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK A S+R +FDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEGL+NVI+RH 
Sbjct  220  EASKHATSLRSYFDWNGYLKCYNLGTYWPYTPSIQLLYGLRATLDLIFEEGLENVISRHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL  ATRLAV+AWGLKNC Q +E +SD+VTAVVVP+ IDS EIV RAWK+YNLSLG+GLN
Sbjct  280  RLAKATRLAVEAWGLKNCCQNKESYSDSVTAVVVPTNIDSGEIVNRAWKKYNLSLGVGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQLLGCLAGVEMVL+D+GYP+K GSGVAAASAYL NT P+IPS
Sbjct  340  KVAGKVFRIGHLGNINELQLLGCLAGVEMVLRDVGYPIKFGSGVAAASAYLHNTIPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>ref|XP_003617296.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00255.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=401

 Score =   284 bits (727),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 146/182 (80%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+K+A SVR FFDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH 
Sbjct  220  EATKSATSVRSFFDWNGYLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRHK  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL  ATRLAV+AWGLKNC QKEEW+S +VTA+VVP  IDS EIV RAWKRYNLSLG GLN
Sbjct  280  RLAKATRLAVEAWGLKNCCQKEEWYSASVTAIVVPPNIDSGEIVSRAWKRYNLSLGGGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGH+G+LNELQLLGCLAGVEM LKD+GYPVKLGSGVAAASAYL N  P+IPS
Sbjct  340  KVAGKVFRIGHVGHLNELQLLGCLAGVEMTLKDVGYPVKLGSGVAAASAYLLNNVPLIPS  399

Query  104  RI  99
            RI
Sbjct  400  RI  401



>gb|AEX09252.1| alanine glyoxylate aminotransferase [Peperomia exclamationis]
Length=342

 Score =   282 bits (721),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  171
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>gb|AEX09262.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=342

 Score =   282 bits (721),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPV  171
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLKD+GYPV
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLKDVGYPV  342



>tpg|DAA47890.1| TPA: hypothetical protein ZEAMMB73_424946 [Zea mays]
Length=159

 Score =   270 bits (690),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 0/159 (0%)
 Frame = -2

Query  575  MGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEE  396
            MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH RLGTATRLAV+AWGL NC QKEE
Sbjct  1    MGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHNRLGTATRLAVEAWGLSNCCQKEE  60

Query  395  WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  216
            WFSD VTAVVVP  IDS+E+V+ AWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC
Sbjct  61   WFSDIVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGC  120

Query  215  LAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  99
            L+GVEMVLKD+GYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LSGVEMVLKDVGYPVKLGSGVAAAAAYLSNSTPLIPSRI  159



>ref|XP_002990557.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
 gb|EFJ08434.1| hypothetical protein SELMODRAFT_448066 [Selaginella moellendorffii]
Length=401

 Score =   276 bits (706),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTA S RVFFDW DYLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH 
Sbjct  220  EAAKTATSPRVFFDWADYLKFYKLGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV AWGLK CT++ EW SDTVTAVVVP YI+S ++VK AWK+YNLSLG+GLN
Sbjct  280  RLGEATRLAVAAWGLKLCTKRPEWNSDTVTAVVVPPYINSLDVVKMAWKKYNLSLGVGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG +NELQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I S
Sbjct  340  KVAGKVFRIGHLGFVNELQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISS  399

Query  104  RI  99
            R+
Sbjct  400  RL  401



>ref|XP_002983655.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
 gb|EFJ15151.1| hypothetical protein SELMODRAFT_228964 [Selaginella moellendorffii]
Length=401

 Score =   275 bits (702),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTA S RVFFDW DYLKFYK+G+YWPYTPS Q+LY LRA LDL+FEEGLDNVI RH 
Sbjct  220  EAAKTATSPRVFFDWADYLKFYKVGSYWPYTPSSQMLYALRASLDLIFEEGLDNVIKRHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV AWGLK CT++ EW SDTVTAVVVP Y++S ++VK AWK+YNLSLG+GLN
Sbjct  280  RLGEATRLAVAAWGLKLCTKRPEWNSDTVTAVVVPPYLNSLDVVKMAWKKYNLSLGVGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG +NELQLLG L+GVEM+LKDIGYPV LGSGVAAA+A+LQ  TP+I S
Sbjct  340  KVAGKVFRIGHLGFVNELQLLGALSGVEMILKDIGYPVVLGSGVAAAAAHLQKKTPLISS  399

Query  104  RI  99
            R+
Sbjct  400  RL  401



>gb|AEX09289.1| alanine glyoxylate aminotransferase [Peperomia gigantea]
Length=312

 Score =   270 bits (691),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 138/152 (91%), Positives = 147/152 (97%), Gaps = 0/152 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  161  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  220

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  221  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  280

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLK  189
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVLK
Sbjct  281  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVLK  312



>gb|AEX09242.1| alanine glyoxylate aminotransferase [Peperomia aff. pinoi JN-2011]
Length=335

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW SDTVTAVV+PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWSSDTVTAVVIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  192
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09288.1| alanine glyoxylate aminotransferase [Peperomia parvisagittata]
Length=335

 Score =   267 bits (682),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  192
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09246.1| alanine glyoxylate aminotransferase [Peperomia elatior]
Length=335

 Score =   267 bits (682),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  192
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|AEX09291.1| alanine glyoxylate aminotransferase [Peperomia jalcaensis]
Length=323

 Score =   266 bits (681),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  173  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  232

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  233  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  292

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  192
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  293  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  323



>gb|AEX09309.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=335

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSD VTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDAVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVL  192
            KVAGKVFRIGHLGN+NELQLLGCL+GVEMVL
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVEMVL  335



>gb|ABR26184.1| serine-glyoxylate aminotransferase [Oryza sativa Indica Group]
Length=152

 Score =   258 bits (659),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 144/152 (95%), Gaps = 0/152 (0%)
 Frame = -2

Query  554  TPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVT  375
            TPSIQLLYGLR  LDL+FEEGL+NVI RH RLGTATRLAV+AWGLKNCTQKEEWFSDTVT
Sbjct  1    TPSIQLLYGLRTALDLIFEEGLENVIKRHNRLGTATRLAVEAWGLKNCTQKEEWFSDTVT  60

Query  374  AVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMV  195
            AVVVP YIDS+EIVK AWKRYNLSLGLGLNKVAGKVFRIGHLG+LNELQL+G L+GVEMV
Sbjct  61   AVVVPPYIDSAEIVKHAWKRYNLSLGLGLNKVAGKVFRIGHLGHLNELQLMGALSGVEMV  120

Query  194  LKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  99
            LKDIGYPVKLGSGVAAA+AYL N+TP+IPSRI
Sbjct  121  LKDIGYPVKLGSGVAAAAAYLSNSTPLIPSRI  152



>gb|AEX09251.1| alanine glyoxylate aminotransferase [Peperomia schizandra]
Length=331

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 143/147 (97%), Gaps = 0/147 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGV  204
            KVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09282.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=332

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVE  201
            KVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09244.1| alanine glyoxylate aminotransferase [Peperomia basiradicans]
Length=332

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVE  201
            KVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGVE  332



>gb|AEX09290.1| alanine glyoxylate aminotransferase [Peperomia dolabella]
Length=311

 Score =   261 bits (667),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 134/148 (91%), Positives = 143/148 (97%), Gaps = 0/148 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  164  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  223

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  224  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  283

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVE  201
            KVAGKVFRIGHLGN+NELQLLGCL+GVE
Sbjct  284  KVAGKVFRIGHLGNVNELQLLGCLSGVE  311



>gb|AEX09287.1| alanine glyoxylate aminotransferase [Peperomia cerrateae]
Length=331

 Score =   261 bits (668),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 134/147 (91%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGV  204
            KVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGV  331



>gb|AEX09292.1| alanine glyoxylate aminotransferase [Peperomia klopfensteinii]
Length=330

 Score =   259 bits (663),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 141/146 (97%), Gaps = 0/146 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV++P YIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVMIPPYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAG  207
            KVAGKVFRIGHLGN+NELQLLGCL+G
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSG  330



>gb|AEX09310.1| alanine glyoxylate aminotransferase [Peperomia wernerrauhii]
Length=331

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 133/147 (90%), Positives = 142/147 (97%), Gaps = 0/147 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  245  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGV  204
            KVAGKVFRIGHLGN+NELQLLGCL+GV
Sbjct  305  KVAGKVFRIGHLGNVNELQLLGCLSGV  331



>ref|XP_002969615.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
 gb|EFJ29703.1| hypothetical protein SELMODRAFT_267279 [Selaginella moellendorffii]
Length=401

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+A+S R FFDW  YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH 
Sbjct  220  EASKSARSPRGFFDWSAYLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHH  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL  ATRLAV+AWGL+ C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLN
Sbjct  280  RLAHATRLAVKAWGLELCVKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG LNELQL+  LAGVEM LKD+G+PVKLGSGVAAA AYLQ +TP+IPS
Sbjct  340  KVAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVAAAQAYLQESTPLIPS  399

Query  104  RI  99
            R+
Sbjct  400  RL  401



>ref|XP_002970880.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
 gb|EFJ28206.1| hypothetical protein SELMODRAFT_147375 [Selaginella moellendorffii]
Length=401

 Score =   260 bits (665),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 160/182 (88%), Gaps = 0/182 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+A+S R FFDW  YLK Y++G+YWPYTPSIQLLYGLRA LDLLFEEGL+NVI RH 
Sbjct  220  EASKSARSPRGFFDWSAYLKSYELGSYWPYTPSIQLLYGLRAALDLLFEEGLENVIKRHH  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL  ATRLAV+AWGL+ C +  E +SDTVTAVVVPSY++S+++V+ AW++YNLS+G+GLN
Sbjct  280  RLAHATRLAVKAWGLELCIKDPELYSDTVTAVVVPSYLNSTDVVRVAWRKYNLSIGIGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLG LNELQL+  LAGVEM LKD+G+PVKLGSGV+AA AYLQ +TP+IPS
Sbjct  340  KVAGKVFRIGHLGFLNELQLISALAGVEMALKDVGFPVKLGSGVSAAQAYLQESTPLIPS  399

Query  104  RI  99
            R+
Sbjct  400  RL  401



>ref|XP_001755667.1| predicted protein [Physcomitrella patens]
 gb|EDQ79340.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   254 bits (650),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 156/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  641  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARHT  465
            A+K +KS RVFFDW DYLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH 
Sbjct  221  AAKQSKSTRVFFDWGDYLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARHC  280

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATR AV+AWGL  CTQ  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GLN
Sbjct  281  RLGEATRQAVKAWGLTLCTQDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGIGLN  340

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGHLGN+NELQ+LG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I S
Sbjct  341  KVAGKVFRIGHLGNVNELQMLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLISS  400

Query  104  RI  99
            RI
Sbjct  401  RI  402



>ref|XP_001783551.1| predicted protein [Physcomitrella patens]
 gb|EDQ51640.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 156/183 (85%), Gaps = 1/183 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARH  468
            EA+K +KS RVFFDW DYLKFY+ GTYWPYTPS Q+LYGLRA LD++  EEGLDNVIARH
Sbjct  220  EAAKRSKSTRVFFDWGDYLKFYEAGTYWPYTPSSQMLYGLRASLDMILNEEGLDNVIARH  279

Query  467  TRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGL  288
             RL  ATR AV+AWGL  CT+  +W SDTVTAVVVPS+I+S++IVK A+K+YNLSLG+GL
Sbjct  280  CRLAEATRQAVRAWGLTLCTKDPKWKSDTVTAVVVPSWINSNDIVKIAYKKYNLSLGVGL  339

Query  287  NKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIP  108
            NKVAGKVFRIGHLGN+NELQLLG LAGVE+ L ++GYPV LGSGVAAA A+L   TP+I 
Sbjct  340  NKVAGKVFRIGHLGNVNELQLLGALAGVELCLMEVGYPVTLGSGVAAAQAHLAKKTPLIV  399

Query  107  SRI  99
            SRI
Sbjct  400  SRI  402



>gb|AEX09243.1| alanine glyoxylate aminotransferase [Peperomia sp. JN-2011]
Length=301

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 127/140 (91%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  162  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  221

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEE FSDTVTAV++PSYIDS+EIV+RAWKRYNLSLGLGLN
Sbjct  222  RLGKATRLAVEAWGLKNCTQKEECFSDTVTAVMIPSYIDSAEIVRRAWKRYNLSLGLGLN  281

Query  284  KVAGKVFRIGHLGNLNELQL  225
            KVAGKVFRIGHLGN+NELQL
Sbjct  282  KVAGKVFRIGHLGNVNELQL  301



>ref|XP_003617694.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AET00653.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=350

 Score =   245 bits (625),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 145/166 (87%), Gaps = 1/166 (1%)
 Frame = -2

Query  593  YLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLAVQAWGLKN  414
            YLK Y +GTYWPYTPSI LLYGLRA LDL+FEEG +NVI RH RL  ATRLAV+AWGLKN
Sbjct  185  YLKCYNLGTYWPYTPSIPLLYGLRAALDLIFEEGFENVILRHKRLTKATRLAVEAWGLKN  244

Query  413  CTQKEE-WFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRIGHLGNLN  237
            C Q+EE W+S +VTA++VP  ID+ EIV RAWKRYNLSLG GLNKVAGKVFRIGH+GNLN
Sbjct  245  CCQQEEEWYSASVTAIIVPPNIDNGEIVSRAWKRYNLSLGGGLNKVAGKVFRIGHVGNLN  304

Query  236  ELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPSRI  99
            ELQLLGCLAGVEM+LK++GY +KLGSGVAAASAYL N  P+IPSRI
Sbjct  305  ELQLLGCLAGVEMILKEVGYLLKLGSGVAAASAYLLNNVPLIPSRI  350



>ref|XP_010094254.1| Serine--glyoxylate aminotransferase [Morus notabilis]
 gb|EXB55505.1| Serine--glyoxylate aminotransferase [Morus notabilis]
Length=358

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/138 (91%), Positives = 134/138 (97%), Gaps = 0/138 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKSVRVFFDW DYLKFYK+GTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH+
Sbjct  220  EASKSAKSVRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWYSDTVTAVLVPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNEL  231
            KVAGKVFRIGHLGNLNE+
Sbjct  340  KVAGKVFRIGHLGNLNEV  357



>gb|AEX09260.1| alanine glyoxylate aminotransferase [Peperomia aff. ovatopeltata 
JN-2011]
Length=326

 Score =   242 bits (618),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+NVIARH 
Sbjct  185  EASKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENVIARHA  244

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRL V+AWGLKNCT KEE FSDTVTAV++PSYIDS+EIV+RAWKR NLSLGLGLN
Sbjct  245  RLGKATRLXVEAWGLKNCTPKEECFSDTVTAVMIPSYIDSAEIVRRAWKRSNLSLGLGLN  304

Query  284  KVAGKVFRIGHLGNLNELQLLG  219
            KVAGKVFRIGHLGN+NELQLLG
Sbjct  305  KVAGKVFRIGHLGNVNELQLLG  326



>ref|XP_003600160.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES70411.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=408

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/141 (88%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+AKS+RVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGL+N+IARH 
Sbjct  220  EASKSAKSLRVFFDWSDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLENIIARHN  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGLKNCTQ+EEWFSDTVTAVVVP YID +EIV+RAWKRYNLSLGLGLN
Sbjct  280  RLGTATRLAVEAWGLKNCTQEEEWFSDTVTAVVVPPYIDGAEIVRRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLL  222
            KVAGKVFRIGHLGNLNE+ L+
Sbjct  340  KVAGKVFRIGHLGNLNEVTLI  360



>tpg|DAA47908.1| TPA: hypothetical protein ZEAMMB73_592349 [Zea mays]
Length=234

 Score =   235 bits (600),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH 
Sbjct  81   EASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHN  140

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGL NC QKEEWFSDTVTAVVVP  IDS+E+V+ AWKRYNLSLGLGLN
Sbjct  141  RLGTATRLAVEAWGLSNCCQKEEWFSDTVTAVVVPPNIDSAEVVRHAWKRYNLSLGLGLN  200

Query  284  KVAGKVFRIGHLGNLNEL  231
            KVAGKVFRIGHLGNLNE+
Sbjct  201  KVAGKVFRIGHLGNLNEV  218



>ref|XP_006369573.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
 gb|ERP66142.1| hypothetical protein POPTR_0001s26020g [Populus trichocarpa]
Length=381

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 123/141 (87%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS RVFFDWKDYLKFYK+GT+WPYTPSIQLLYGLR  LDLLF EGLDNVIARH 
Sbjct  220  EASKTAKSFRVFFDWKDYLKFYKLGTFWPYTPSIQLLYGLREALDLLFAEGLDNVIARHA  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VP YIDS+EIV+R WKRYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVLVPPYIDSAEIVRRGWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQLL  222
            KVAGKVFRIGHLGNLNE+  +
Sbjct  340  KVAGKVFRIGHLGNLNEVTFI  360



>gb|ABR16109.1| unknown [Picea sitchensis]
Length=359

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 131/137 (96%), Gaps = 0/137 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKS+RVFFDW DYLKFYK+GTYWPYTPSIQLLYGLR  LDL+F EGLDNVIARH+
Sbjct  220  EATKTAKSLRVFFDWNDYLKFYKLGTYWPYTPSIQLLYGLRTALDLIFLEGLDNVIARHS  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQ+EEW+SDTVTAVV+P YIDS+EIVKRAWKRYNLSLGLGLN
Sbjct  280  RLGRATRLAVEAWGLKNCTQREEWYSDTVTAVVIPPYIDSTEIVKRAWKRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNE  234
            KVAGKVFRIGHLGNLNE
Sbjct  340  KVAGKVFRIGHLGNLNE  356



>gb|KDO44954.1| hypothetical protein CISIN_1g0157291mg [Citrus sinensis]
Length=367

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/140 (86%), Positives = 133/140 (95%), Gaps = 0/140 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKSVRVFFDWKDY+KFY +GT+WPYTPSIQLLYGLRA LDL+FEEGL+NVI RH 
Sbjct  220  EASKTAKSVRVFFDWKDYIKFYNLGTFWPYTPSIQLLYGLRAALDLIFEEGLENVIERHR  279

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLG ATRLAV+AWGLKNCTQKEEWFSDTVTAV+VPS+I+SSEIV+RAW+RYNLSLGLGLN
Sbjct  280  RLGKATRLAVEAWGLKNCTQKEEWFSDTVTAVIVPSHINSSEIVRRAWQRYNLSLGLGLN  339

Query  284  KVAGKVFRIGHLGNLNELQL  225
            KVAGKVFRIGHLG+LNE+  
Sbjct  340  KVAGKVFRIGHLGHLNEVMF  359



>tpg|DAA47863.1| TPA: hypothetical protein ZEAMMB73_595389 [Zea mays]
Length=368

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+SVRVFFDWKDYL+FY MGTYWPYTPSIQLLYGLR  LDL+FEEGLDNV+ RH 
Sbjct  222  EASKTARSVRVFFDWKDYLRFYDMGTYWPYTPSIQLLYGLRTALDLIFEEGLDNVVRRHN  281

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RLGTATRLAV+AWGL NC QKEEWFSDTVTA VVP  IDS+E+V+ AWKRYNLSLGLGLN
Sbjct  282  RLGTATRLAVEAWGLSNCCQKEEWFSDTVTAAVVPPNIDSAEVVRHAWKRYNLSLGLGLN  341

Query  284  KVAGKVFRIGHLGNLNEL  231
            KVAGKVFRIGHLGNLNE+
Sbjct  342  KVAGKVFRIGHLGNLNEV  359



>dbj|BAD94403.1| alanine-glyoxylate aminotransferase [Arabidopsis thaliana]
Length=124

 Score =   221 bits (564),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 115/124 (93%), Gaps = 0/124 (0%)
 Frame = -2

Query  470  HTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLG  291
            H RLG ATRLAV+AWGLKNCTQKEEW S+TVTAV+VP +ID SEIV+RAW+RYNLSLGLG
Sbjct  1    HARLGKATRLAVEAWGLKNCTQKEEWISNTVTAVMVPPHIDGSEIVRRAWQRYNLSLGLG  60

Query  290  LNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            LNKVAGKVFRIGHLGN+NELQLLGCLAGVEM+LKD+GYPV +GSGVAAAS YLQ+  P+I
Sbjct  61   LNKVAGKVFRIGHLGNVNELQLLGCLAGVEMILKDVGYPVVMGSGVAAASTYLQHHIPLI  120

Query  110  PSRI  99
            PSRI
Sbjct  121  PSRI  124



>ref|XP_003615391.1| Alanine glyoxylate aminotransferase [Medicago truncatula]
 gb|AES98349.1| serine-glyoxylate aminotransferase-like protein [Medicago truncatula]
Length=343

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 141/182 (77%), Gaps = 19/182 (10%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASK+A S+R FFDW  YLK Y +GTYWPYTPSIQLLYGLRA LDL+FEEG +NVI RH 
Sbjct  181  EASKSATSLRSFFDWNGYLKCYNLGTYWPYTPSIQLLYGLRAALDLVFEEGFENVILRH-  239

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
                  +L V            EW+S +VTA+V P  IDS EIV RAWKR NLSLG GLN
Sbjct  240  ------KLVV------------EWYSASVTAIVGPPNIDSGEIVSRAWKRCNLSLGGGLN  281

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            KVAGKVFRIGH+G+LNELQLLGCLAGVEM LKD+GYPV+LGSGVAAASAYL N  P+IPS
Sbjct  282  KVAGKVFRIGHVGHLNELQLLGCLAGVEMTLKDVGYPVQLGSGVAAASAYLLNNVPIIPS  341

Query  104  RI  99
            RI
Sbjct  342  RI  343



>ref|XP_001763095.1| predicted protein [Physcomitrella patens]
 gb|EDQ71972.1| predicted protein [Physcomitrella patens]
Length=402

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/183 (66%), Positives = 145/183 (79%), Gaps = 1/183 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARH  468
            E SK AK  R +FDW +YLK YK GTY PYTPS+QLLYGLRA LD++  +EGL+NVIARH
Sbjct  220  ETSKQAKYPRGYFDWAEYLKSYKAGTYSPYTPSVQLLYGLRASLDIILKQEGLENVIARH  279

Query  467  TRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGL  288
             RL  ATR AV+AWGL  C +K +W S  VT VVVPS +DS++++K AWK+YNLSLGLGL
Sbjct  280  LRLAEATRRAVRAWGLTVCARKPQWDSAVVTGVVVPSSLDSNDVIKIAWKKYNLSLGLGL  339

Query  287  NKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIP  108
             +V GKVFRIGHLG +NELQLLG LAGVE+VL ++GYPV  GSGVAAA A+L   TP+I 
Sbjct  340  GEVNGKVFRIGHLGYVNELQLLGALAGVELVLLEVGYPVIFGSGVAAAQAFLSKQTPIIA  399

Query  107  SRI  99
            SR+
Sbjct  400  SRL  402



>gb|ABS86859.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   197 bits (502),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/116 (89%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH 
Sbjct  34   EASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHN  93

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  297
            RLGTATRLAV+AWGLKNCT+KEEW SDTVTAVVVPSYIDS+EIV+RAWKRYNLSLG
Sbjct  94   RLGTATRLAVEAWGLKNCTEKEEWHSDTVTAVVVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|ABS86860.1| alanine glyoxylate aminotransferase [Phaseolus vulgaris]
Length=149

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTAKS+RVFFDWKDYLKFY++GTYWPYTPSI LLYGLRA LDL+FEEGL+NVIARH 
Sbjct  34   EASKTAKSLRVFFDWKDYLKFYQLGTYWPYTPSIHLLYGLRAALDLVFEEGLENVIARHN  93

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLG  297
            RLGTAT LAV+AWGLKNCTQKEEW SDTVTAV+VPSYIDS+EIV+RAWKRYNLSLG
Sbjct  94   RLGTATGLAVEAWGLKNCTQKEEWHSDTVTAVIVPSYIDSAEIVRRAWKRYNLSLG  149



>gb|AGN53915.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   192 bits (487),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVKRAWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKRAWKRYN  141



>gb|AGN53895.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53896.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53901.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53902.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53905.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53913.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53925.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53926.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53927.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53928.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   191 bits (484),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKRYN  141



>gb|AGN53914.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   190 bits (483),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDSS+IVK+AWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSSDIVKKAWKRYN  141



>gb|AGN53916.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVKRAWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKRAWKRYN  141



>gb|AGN53923.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWK+YN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53897.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53898.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53899.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53903.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53904.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53907.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53908.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53909.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53910.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53911.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53912.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53919.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53929.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53930.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53931.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53932.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53933.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53934.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   189 bits (480),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWK+YN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN54050.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 99/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YI+SSEIVK AWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYINSSEIVKMAWKRYN  141



>gb|AGN53921.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53922.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   189 bits (479),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/112 (87%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DY+KFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYMKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YIDS+EIVK+AWK+YN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYIDSAEIVKKAWKKYN  141



>gb|AGN53900.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53924.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   188 bits (478),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVK+AWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53906.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53920.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVK+AWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKKAWKRYN  141



>gb|AGN53917.1| glyoxylate aminotransferase, partial [Silene latifolia]
 gb|AGN53918.1| glyoxylate aminotransferase, partial [Silene latifolia]
Length=141

 Score =   188 bits (478),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVI+RH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVISRHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAV+VP YI+SS+IVKRAWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVIVPPYIESSDIVKRAWKRYN  141



>gb|AGN54049.1| glyoxylate aminotransferase, partial [Silene vulgaris]
Length=141

 Score =   188 bits (477),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/112 (88%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA+KTAKSVRVFFDW DYLKFYKMGTYWPYTPSIQLLYGLRA LDL+FEEGLDNVIARH 
Sbjct  30   EATKTAKSVRVFFDWNDYLKFYKMGTYWPYTPSIQLLYGLRAALDLIFEEGLDNVIARHG  89

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYN  309
            RL  ATRLAV+AWGLKNC QKEEWFSDTVTAVV+P YI+S+EIVK AWKRYN
Sbjct  90   RLAKATRLAVEAWGLKNCAQKEEWFSDTVTAVVIPPYINSAEIVKMAWKRYN  141



>ref|WP_040580464.1| serine--glyoxylate aminotransferase [Methyloferula stellata]
Length=404

 Score =   191 bits (484),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 130/178 (73%), Gaps = 1/178 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA  TAK  RVFF+++D +K    G Y+PYTPS+ LLYGLR  + ++FEEG +NV  RH 
Sbjct  223  EARHTAKCARVFFNFEDMIKSNATG-YFPYTPSLPLLYGLRESMKMMFEEGQENVFQRHH  281

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L +  R AV AWGLKNC  + +WFSDTVTA+VVP   + ++++  A++RYNL+LG GL 
Sbjct  282  YLASGVRAAVSAWGLKNCATEPKWFSDTVTAIVVPEGFNGADVIATAYRRYNLALGAGLA  341

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KVAGKVFRIGHLG+LNEL +LG LAG EM + DIG  ++ GSGVAAA  Y +++  +I
Sbjct  342  KVAGKVFRIGHLGDLNELMVLGALAGAEMSMLDIGIKIEPGSGVAAAQNYFRSSNSVI  399



>ref|WP_024878012.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylocystaceae]
Length=397

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH 
Sbjct  220  KAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHH  278

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L    R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLN
Sbjct  279  HLAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLN  338

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  138
            KVAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  339  KVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_036293367.1| serine--glyoxylate aminotransferase [Methylosinus sp. PW1]
Length=397

 Score =   190 bits (482),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH 
Sbjct  220  KAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHH  278

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L    R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLN
Sbjct  279  HLAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLN  338

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  138
            KVAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  339  KVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>ref|WP_018267457.1| serine--glyoxylate aminotransferase [Methylosinus sp. LW4]
Length=397

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH 
Sbjct  220  KAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHH  278

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L    R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GLN
Sbjct  279  HLAEGVRAAVAAWGLKPCAKEAKWNSDTVTAIVVPEGFDAAKVIEIAYKRYNLALGAGLN  338

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  138
            KVAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  339  KVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTAGSGVAAAQA  387



>dbj|BAQ46928.1| serine--glyoxylate aminotransferase [Methylobacterium aquaticum]
Length=396

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA+  RVFFD+ D  K    G Y+PYTP++ +LYGLR  L  + +EGL+NV ARH 
Sbjct  220  EASKTAECRRVFFDFGDQAKANATG-YFPYTPALPMLYGLREALRCVEDEGLENVFARHR  278

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL  +TR AV+AWGL  C ++E+W+SDTV+AV+VP  ++ +E++  A+KRYNL+LG GL+
Sbjct  279  RLADSTRAAVEAWGLTLCAKEEKWYSDTVSAVMVPDGVNGAEVIDIAYKRYNLALGAGLS  338

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            +VAGK+FRIGH+G+LNEL LLG LAGVEM + D G  ++ GSGVAAA   L+ +
Sbjct  339  QVAGKLFRIGHIGDLNELMLLGALAGVEMAMLDAGIRIEPGSGVAAAQKSLRGS  392



>gb|AFZ62596.1| serine-glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
 gb|AHB49532.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans 
NL23]
Length=400

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
            R FF W+D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R A
Sbjct  228  RCFFSWEDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAA  286

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRI
Sbjct  287  VDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRI  346

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            GHLG L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  347  GHLGALDEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  396



>ref|WP_041319044.1| serine--glyoxylate aminotransferase [Hyphomicrobium nitrativorans]
Length=397

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
            R FF W+D +K    G ++PYTP+ QL+ GLR  LDLLF EG+DNV ARHTRL +  R A
Sbjct  225  RCFFSWEDMIKTNDQG-FFPYTPATQLIRGLRTSLDLLFAEGIDNVFARHTRLASGVRAA  283

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTV+A++VP  IDS+ +VK A+ RYN SLG+GLNKVAGKVFRI
Sbjct  284  VDAWGLKLCAKEPKWHSDTVSAILVPEGIDSANVVKTAYYRYNTSLGVGLNKVAGKVFRI  343

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            GHLG L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N  P+ P+
Sbjct  344  GHLGALDEYMIGGVLFSVEMALKDCGVPVKLGSGTGAAAEYFVN-NPVKPA  393



>ref|WP_017485211.1| serine--glyoxylate aminotransferase [Methylobacterium sp. MB200]
Length=402

 Score =   186 bits (473),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            ++ +  +  RV+FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH 
Sbjct  225  QSGRNDRLARVYFDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHA  283

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL+
Sbjct  284  VLGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLS  343

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            +VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  344  QVAGKVFRIGHVGDLNELSLLGAIAGAEMSLLDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003613273.1| serine--glyoxylate aminotransferase [Methylosinus trichosporium]
Length=397

 Score =   186 bits (473),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +A +TAK  R +FD++D++K    G Y+PYTP++ LLYGLR  L++LFEEGLD V ARH 
Sbjct  220  KAGETAKLHRAYFDFQDHVKANATG-YFPYTPALPLLYGLRESLNVLFEEGLDQVYARHH  278

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L    R AV AWGLK C ++ +W SDTVTA++VP   D++++++ A+KRYNL+LG GL+
Sbjct  279  HLAEGVRAAVAAWGLKPCAKESKWNSDTVTAILVPEGFDAAKVIEIAYKRYNLALGAGLS  338

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASA  138
            KVAGKVFRIGHLG+LNEL LLG +AG EM + D+G PV  GSGVAAA A
Sbjct  339  KVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDVGIPVTPGSGVAAAQA  387



>ref|WP_012453656.1| serine--glyoxylate aminotransferase [Methylobacterium populi]
 gb|ACB79910.1| aminotransferase class V [Methylobacterium populi BJ001]
Length=402

 Score =   186 bits (472),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 127/174 (73%), Gaps = 1/174 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            ++ +  +  RV+FDW+D+ K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH 
Sbjct  225  QSGRNDRLARVYFDWEDHKKQNPAG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHA  283

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL+
Sbjct  284  VLGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLS  343

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            +VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  344  QVAGKVFRIGHVGDLNELSLLGAIAGAEMSLLDNGVNVTPGSGVAAASSYLREN  397



>emb|CAD13310.1| serine-glyoxylate aminotransferase [Methylobacterium extorquens 
DM4]
Length=379

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            ++ +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH 
Sbjct  202  QSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHA  260

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL+
Sbjct  261  VLGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLS  320

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            +VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  321  QVAGKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  374



>ref|WP_012590731.1| serine--glyoxylate aminotransferase [Methylocella silvestris]
 gb|ACK50661.1| aminotransferase class V [Methylocella silvestris BL2]
Length=396

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 94/176 (53%), Positives = 127/176 (72%), Gaps = 1/176 (1%)
 Frame = -2

Query  641  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  462
            ASKTA S R +FD+ D +K    G Y+PYTP + LLYGLR  L ++ +EGL+N+  RH+ 
Sbjct  216  ASKTATSKRCYFDFDDMIKANATG-YFPYTPPLPLLYGLRESLKMIEDEGLENIFVRHSH  274

Query  461  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  282
            L    R AV+AWGL  C ++ +W+SDTVTA+VVP   ++ +++  A+ RYNLSLG GL++
Sbjct  275  LAGGVRAAVKAWGLTPCAKEPKWYSDTVTAIVVPPQFNAVQVISTAYSRYNLSLGAGLSQ  334

Query  281  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  114
            VAGKVFRIGHLG+LNEL +LG LAG EM + D+G PV LGSGV AA ++ +   P+
Sbjct  335  VAGKVFRIGHLGDLNELMVLGALAGAEMAMADVGIPVTLGSGVGAAQSFYRAAAPV  390



>ref|WP_012253362.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ABY30194.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
PA1]
Length=402

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            ++ +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH 
Sbjct  225  QSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHA  283

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL+
Sbjct  284  VLGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLS  343

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            +VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  344  QVAGKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_003597639.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 sp|P55819.2|SGAA_METEA RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Methylobacterium extorquens AM1]
 gb|ACS39570.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
AM1]
 emb|CAX24121.1| serine-glyoxylate aminotransferase (SGAT) [Methylobacterium extorquens 
DM4]
 gb|EHP94104.1| Serine--glyoxylate transaminase [Methylobacterium extorquens 
DSM 13060]
Length=402

 Score =   185 bits (470),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            ++ +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH 
Sbjct  225  QSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHA  283

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL+
Sbjct  284  VLGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLS  343

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            +VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  344  QVAGKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_015950680.1| serine--glyoxylate aminotransferase [Methylobacterium extorquens]
 gb|ACK82978.1| aminotransferase class V [Methylobacterium extorquens CM4]
Length=402

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 126/174 (72%), Gaps = 1/174 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            ++ +  +  RV+FDW+D  K    G Y+PYTP + LLYGLR  L  LFEEGL+NV  RH 
Sbjct  225  QSGRNDRLARVYFDWEDQKKQNPTG-YFPYTPPLPLLYGLREALACLFEEGLENVYHRHA  283

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             LG ATR AV AWGLK C +  EW SDTVTA++ P  +D+++I+K A+ RYNL+LG GL+
Sbjct  284  VLGEATRQAVAAWGLKTCAKSPEWNSDTVTAILAPEGVDAAKIIKHAYVRYNLALGAGLS  343

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            +VAGKVFRIGH+G+LNEL LLG +AG EM L D G  V  GSGVAAAS+YL+  
Sbjct  344  QVAGKVFRIGHVGDLNELSLLGAIAGAEMSLIDNGVKVTPGSGVAAASSYLREN  397



>ref|WP_036260471.1| serine--glyoxylate aminotransferase [Methylocapsa aurea]
Length=412

 Score =   184 bits (466),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 127/172 (74%), Gaps = 1/172 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EASKTA   RVFFD+ D +K    G Y+PYTP++ +LYGLR  L +LFEE L++V  RH 
Sbjct  215  EASKTAGLKRVFFDFNDMIKANATG-YFPYTPALPMLYGLRESLKILFEEKLEHVFERHH  273

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L    R AV+AWGLK C  + +W+SDTVTA+VVP  I+ ++++  A++RYNLSLG GL+
Sbjct  274  VLAGGVRAAVKAWGLKPCATEPKWYSDTVTAIVVPPGINGADVIDAAYRRYNLSLGAGLS  333

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            +VAGKVFRIGHLG+LN+L +LG + G EM + D+G  VKLGSGV AA A+ +
Sbjct  334  QVAGKVFRIGHLGDLNDLMVLGAIGGAEMAMADVGIDVKLGSGVGAAQAHFR  385



>ref|WP_026610206.1| serine--glyoxylate aminotransferase [Methylocaldum szegediense]
Length=394

 Score =   181 bits (460),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 127/181 (70%), Gaps = 1/181 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            EA  TAKS R F D +D++     G Y+PYTPSI LLYGLR  +DLL EEGL NV ARH 
Sbjct  215  EARHTAKSRRCFLDIQDHITNNASG-YFPYTPSIPLLYGLRKAIDLLLEEGLQNVFARHQ  273

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL    R AV+AWGL+ C +  +W+S+TV+A+VVP   D+ +++  A+ RYNLSLG GL+
Sbjct  274  RLAEGVRRAVKAWGLELCARDPKWYSNTVSAIVVPQGYDARDVMHYAYHRYNLSLGAGLS  333

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            +VAGKVFRIGHLG+LNEL L   +AG EM ++D+G  V  GSGVAAA  Y + T P +  
Sbjct  334  EVAGKVFRIGHLGDLNELMLCSAIAGAEMAMRDVGIQVTPGSGVAAACEYWRETAPAVKP  393

Query  104  R  102
            R
Sbjct  394  R  394



>dbj|BAQ18801.1| serine-glyoxylate aminotransferase [Methyloceanibacter caenitepidi]
Length=372

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 126/170 (74%), Gaps = 1/170 (1%)
 Frame = -2

Query  632  TAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGT  453
            TA   R +F+  D+ K    G Y+PYTP++ LLYGLR  L ++FEEGLDN+ ARH  L +
Sbjct  193  TATCTRAYFNLADHFK-ANAGGYFPYTPALPLLYGLRESLAMMFEEGLDNIFARHRYLAS  251

Query  452  ATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAG  273
             TR AV AWGL  C ++ +W SDTV+A++VP+  + ++++ RA++RYNL+LG GL++VAG
Sbjct  252  GTRAAVDAWGLSLCAKEPKWQSDTVSAIMVPAGFNGADVIDRAYRRYNLALGAGLSEVAG  311

Query  272  KVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            K+FRIGHLG+LNEL LLG ++G EM ++D+G  V+ GSGVAAA  Y +N 
Sbjct  312  KLFRIGHLGDLNELMLLGAISGAEMSMRDVGIQVEPGSGVAAAQEYFRNA  361



>ref|XP_011399157.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
 gb|KFM26261.1| Serine-glyoxylate aminotransferase [Auxenochlorella protothecoides]
Length=377

 Score =   180 bits (457),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 130/188 (69%), Gaps = 4/188 (2%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +A  +AK  RV+F + D LK  K G   PYTP + LL+GL+A L LL  EGLDNV ARH 
Sbjct  193  DARSSAKLKRVYFSFDDMLKTNKNGGV-PYTPILPLLHGLKASLGLLNAEGLDNVFARHH  251

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL   TR AV AWGLK   ++  W SDT+T V VP  +DS +IV  A+ +YNLSLGLGL 
Sbjct  252  RLAEGTRAAVAAWGLKLLCREPRWQSDTLTVVEVPEGLDSQKIVDTAFAKYNLSLGLGLA  311

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMIPS  105
            +V GKVFRIGHLGN++EL L G L GVEM L+D+G P++LGSGV AA    Q  TP+IP+
Sbjct  312  EVQGKVFRIGHLGNMDELMLAGALGGVEMTLRDVGLPIELGSGVGAALKVWQEGTPVIPT  371

Query  104  RI*FKCVI  81
            R   +C++
Sbjct  372  R---ECLM  376



>ref|WP_027172630.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 10]
Length=402

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 123/163 (75%), Gaps = 1/163 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
             V+FDW D+ K    G Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  LG ATR A
Sbjct  234  HVYFDWADHQKQNGAG-YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLGEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFVRYNLALGAGLSQVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            GH+G+LNEL LLG +AG EM + D G  V+ GSGVAAAS+YL+
Sbjct  353  GHVGDLNELSLLGAIAGAEMAMLDNGVKVQPGSGVAAASSYLR  395



>ref|WP_026175686.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 88A]
Length=402

 Score =   178 bits (452),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 122/163 (75%), Gaps = 1/163 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
             V+FDW D+ K    G Y+PYTP++ LLYGLR  L  L EEGL+NV  RH  L  ATR A
Sbjct  234  HVYFDWADHQKQNGAG-YFPYTPALPLLYGLREALACLREEGLENVYHRHAVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA++VP  ID++ I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKEAKWNSDTVTAILVPEGIDAAAIIKHAFVRYNLALGAGLSQVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            GH+G+LNEL LLG +AG EM + D G  V+ GSGVAAAS+YL+
Sbjct  353  GHVGDLNELSLLGAIAGAEMAMLDNGVKVQPGSGVAAASSYLR  395



>sp|O08374.2|SGAA_HYPME RecName: Full=Serine--glyoxylate aminotransferase; Short=SGAT 
[Hyphomicrobium methylovorum]
 dbj|BAA19919.1| serine-glyoxylate aminotransferase [Hyphomicrobium methylovorum]
Length=405

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 120/170 (71%), Gaps = 1/170 (1%)
 Frame = -2

Query  638  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRL  459
            SK  +  R FF ++D +K    G ++PYTP+ QLL GLR  LDLLF EGLDNV ARHTRL
Sbjct  219  SKNGRMNRCFFSFEDMIKTNDQG-FFPYTPATQLLRGLRTSLDLLFAEGLDNVFARHTRL  277

Query  458  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  279
             +  R AV AWGLK C ++ +W+SDTV+A++VP  IDS+ I K A+ RYN S GLGLNKV
Sbjct  278  ASGVRAAVDAWGLKLCAKEPKWYSDTVSAILVPEGIDSNAITKTAYYRYNTSFGLGLNKV  337

Query  278  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            AGKVFRIGHLG L+E+ + G L   EM LKD G  +KLGSG  AA+ Y  
Sbjct  338  AGKVFRIGHLGMLDEVMIGGALFAAEMALKDNGVNLKLGSGTGAAAEYFS  387



>ref|WP_013217108.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|ADJ24949.1| aminotransferase class V [Hyphomicrobium denitrificans ATCC 51888]
Length=402

 Score =   178 bits (451),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = -2

Query  638  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRL  459
            SK  +  R FF ++D +K   +G ++PYTP+  L+ GLRA +DLL  EG+DNV+ARH RL
Sbjct  219  SKNGRMNRCFFSFEDMIKTNDLG-FFPYTPATTLIRGLRASIDLLLAEGIDNVVARHHRL  277

Query  458  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  279
             +  R  V AWGLK C ++ +W+SDTV+A++VP  +DS+ + K A+ RYN SLGLGLNKV
Sbjct  278  ASGVRAGVAAWGLKLCAKEPKWYSDTVSAILVPEGVDSNAVTKTAYYRYNTSLGLGLNKV  337

Query  278  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            AGKVFRIGHLG+L+E  + G L  VEM LKD G PVKLGSG AAA+ Y  + 
Sbjct  338  AGKVFRIGHLGSLDEYMVGGVLFAVEMALKDNGIPVKLGSGTAAAAEYFTSN  389



>ref|XP_005709273.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
 gb|EME32753.1| serine--glyoxylate transaminase [Galdieria sulphuraria]
Length=400

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 126/178 (71%), Gaps = 1/178 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            E SK     RVFF ++D +    +G Y+PYTPSI LLYGL+  L +L EEGL++V  RH 
Sbjct  217  ERSKKNNLHRVFFSFEDMIVNNDVG-YFPYTPSIPLLYGLKESLAMLMEEGLESVYVRHR  275

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
            RL    R AV+AWGLK C +  + +SDTVTAVVVP   D+ ++++ A+++YNLSLG GL 
Sbjct  276  RLAHGVRRAVEAWGLKTCCKNPKEYSDTVTAVVVPEGFDAQQVIRIAYEKYNLSLGAGLM  335

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPMI  111
            KV G+VFRIGHLG+LNEL +L  LAG EM + ++G P+KLGSGVAAAS Y   T+  +
Sbjct  336  KVRGRVFRIGHLGDLNELMVLATLAGTEMAMLEVGIPIKLGSGVAAASEYYMKTSKQV  393



>ref|WP_026608295.1| serine--glyoxylate aminotransferase [Methylocapsa acidiphila]
Length=412

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/173 (52%), Positives = 129/173 (75%), Gaps = 1/173 (1%)
 Frame = -2

Query  641  ASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTR  462
            A+KTA   RV+FD+ D +K    G Y+PYTP++ +LYGLR  + +LFEE L++V  RH  
Sbjct  216  ATKTAGLKRVYFDFADMIKANATG-YFPYTPALPMLYGLRESMRILFEEKLEHVFERHHV  274

Query  461  LGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNK  282
            L    R AV+AWGL  C ++ +W SDTVTA+VVP+ I+ ++++  A++RYNLSLG GL++
Sbjct  275  LAGGVRAAVKAWGLHPCAKEAKWDSDTVTAIVVPAGINGADVIDTAYRRYNLSLGAGLSQ  334

Query  281  VAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            VAGKVFRIGHLG+LN+L +LG +AG EM ++D+G  ++LGSGV AA  + ++T
Sbjct  335  VAGKVFRIGHLGDLNDLMVLGAIAGAEMAMRDVGIDIQLGSGVGAAQEHFRST  387



>ref|WP_016921634.1| serine--glyoxylate aminotransferase [Methylocystis parvus]
Length=397

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 124/172 (72%), Gaps = 1/172 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +A KT K  R +F+++D +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH 
Sbjct  220  DAGKTNKGRRAYFEFQDMIAQNANG-YFPYTPSVPLLYGLKESLSILFEEGLDQVYKRHH  278

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L   TR AV AWGLK C ++ +W SDTVTA+VVP   D+ ++++ A+KRYNL+LG GL+
Sbjct  279  HLAEGTRAAVAAWGLKTCAKEPKWNSDTVTAIVVPEGYDAVKVIETAYKRYNLALGAGLS  338

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            +VAGKVFRIGHLG+LNEL LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  339  EVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDNGIKIEAGSGVAAAQAVFR  390



>ref|WP_015599474.1| serine--glyoxylate aminotransferase [Hyphomicrobium denitrificans]
 gb|AGK59459.1| class V aminotransferase [Hyphomicrobium denitrificans 1NES1]
Length=406

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 119/171 (70%), Gaps = 1/171 (1%)
 Frame = -2

Query  638  SKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRL  459
            SK  +  R FF ++D +K    G ++PYTP+  L+ GLR  +DLL  EG+DNV+ARH RL
Sbjct  220  SKNGRMNRCFFSFEDMIKTNDQG-FFPYTPATTLIRGLRTSIDLLLGEGIDNVVARHHRL  278

Query  458  GTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKV  279
             +  R  V AWGLK C ++ +W SDTV+AV+VP   DS+ + K A+ RYN SLGLGLNKV
Sbjct  279  ASGVRAGVHAWGLKLCAKEPKWHSDTVSAVLVPEGFDSNVVTKTAYYRYNTSLGLGLNKV  338

Query  278  AGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQN  126
            AGKVFRIGHLG+L+E  + G L  VEM LKD G PVKLGSG  AA+ Y  N
Sbjct  339  AGKVFRIGHLGSLDEFMVGGVLFAVEMALKDCGIPVKLGSGTGAAAEYFTN  389



>ref|WP_020085137.1| serine--glyoxylate aminotransferase [Hyphomicrobium zavarzinii]
Length=400

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
            R FF W+D +K   +G ++PYTP+ QL+ GLRA L+L+F EG+DN++ARHTRL +  R A
Sbjct  227  RCFFSWEDMIKTNDLG-FFPYTPATQLIRGLRASLNLIFAEGIDNIVARHTRLASGVRAA  285

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTV+A+VVP  ID++ ++K A+ RYN SLG GLNK+ G+VFRI
Sbjct  286  VDAWGLKLCAKEPKWHSDTVSAIVVPEGIDANNVLKTAYYRYNTSLGTGLNKLNGRVFRI  345

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG L+E  +   L  VEM LKD G P+K GSG  AA+ Y   T
Sbjct  346  GHLGALDEGMIGSALFNVEMTLKDCGVPIKFGSGTGAAAEYFSKT  390



>ref|WP_026597137.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 77]
Length=402

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/163 (59%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
             V+FDW D+ K    G Y+PYTP + LLYGLR  L  L EEGL+NV  RH  L  ATR A
Sbjct  234  HVYFDWADHQKQNGAG-YFPYTPPLPLLYGLREALACLREEGLENVYNRHKVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA++VP  +D++ I+K A+ RYNL+LG GL++VAGKVFRI
Sbjct  293  VAAWGLKTCAKEAKWNSDTVTAILVPEGVDAAAIIKHAFMRYNLALGAGLSQVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            GH+G+LNEL LLG +AG EM + D G  V+ GSGVAAAS+YL+
Sbjct  353  GHVGDLNELSLLGAIAGAEMSMLDNGVKVQPGSGVAAASSYLR  395



>ref|WP_036284904.1| serine--glyoxylate aminotransferase [Methylocystis sp. ATCC 49242]
Length=397

 Score =   176 bits (445),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 123/172 (72%), Gaps = 1/172 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            E  KT K  R +F+++D +     G Y+PYTPS+ LLYGL+  L +LFEEGLD V  RH 
Sbjct  220  EKGKTNKGRRAYFEFQDMIAQNANG-YFPYTPSVPLLYGLKEALSILFEEGLDQVYKRHH  278

Query  464  RLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLN  285
             L    R AV AWGLK C ++ +W SDTVTA+VVP   D++++++ A+KRYNL+LG GL+
Sbjct  279  HLAEGCRAAVAAWGLKTCAKEPKWNSDTVTAIVVPEGFDAAKVIETAYKRYNLALGAGLS  338

Query  284  KVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQ  129
            +VAGKVFRIGHLG+LNEL LLG +AG EM + D G  ++ GSGVAAA A  +
Sbjct  339  EVAGKVFRIGHLGDLNELMLLGAIAGAEMAMLDNGIKIQPGSGVAAAQAVFR  390



>ref|WP_042673896.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B34]
Length=402

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_020092657.1| serine--glyoxylate aminotransferase [Methylobacterium sp. 285MFTsu5.1]
Length=402

 Score =   175 bits (444),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAVVKEEGLENVYHRHHVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_012320605.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
 gb|ACB25646.1| aminotransferase class V [Methylobacterium radiotolerans JCM 
2831]
 gb|KIU30995.1| serine--glyoxylate aminotransferase [Methylobacterium radiotolerans]
 dbj|GAN47418.1| class V aminotransferase [Methylobacterium sp. ME121]
Length=402

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_007559580.1| serine--glyoxylate aminotransferase [Methylobacterium sp. GXF4]
 gb|EIZ86366.1| class V aminotransferase [Methylobacterium sp. GXF4]
Length=402

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+N+  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENIYHRHHVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVITHAYERYNLSLGAGLSKVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_043355705.1| serine--glyoxylate aminotransferase [Methylobacterium sp. B1]
Length=402

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_043385155.1| MULTISPECIES: serine--glyoxylate aminotransferase [Methylobacterium]
Length=402

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_010687105.1| Aminotransferase class V [Methylobacterium mesophilicum]
 gb|EMS39671.1| Aminotransferase class V [Methylobacterium mesophilicum SR1.6/6]
Length=402

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 120/165 (73%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L+++ EEGL+NV  RH  L  ATR A
Sbjct  234  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALEIVKEEGLENVYHRHHVLAEATRQA  292

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  293  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAFERYNLSLGAGLSKVAGKVFRI  352

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  353  GHLGDLNELSLLGAIAGAEMAMLDCGIKVTPGSGVAAASSYLREN  397



>ref|WP_035525480.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
 gb|KHD21372.1| serine--glyoxylate aminotransferase [Burkholderia sacchari]
Length=418

 Score =   173 bits (439),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +A +TAKS R +FD  D +K    G Y+PYTP++ LLYGLR  LDL+F+EGLDNV ARH 
Sbjct  223  KAIETAKSKRCYFDLGDMIKANATG-YFPYTPALSLLYGLRTALDLIFQEGLDNVFARHH  281

Query  464  RLGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGL  288
             L    R AV + WGL+ C +  +W+SDTV+A+VVP   +++ ++ RA++RYNL+LG GL
Sbjct  282  HLAQGVRAAVTEGWGLELCAKGPKWYSDTVSAIVVPQGFNAANVIDRAFRRYNLALGAGL  341

Query  287  NKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNTTPM  114
            +KVAGKVFRIGHLG+LNEL L   +AG EM + D+G  V+ GSG  AA+ Y +   P+
Sbjct  342  SKVAGKVFRIGHLGDLNELMLTSAIAGAEMAMLDVGIDVRPGSGTGAATQYWRTHDPL  399



>ref|WP_013949995.1| MULTISPECIES: serine--glyoxylate aminotransferase [Hyphomicrobium]
 emb|CCB67605.1| serine-glyoxylate aminotransferase [Hyphomicrobium sp. MC1]
Length=406

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
            R FF W+D +K   +G Y+PYTP+ QL+ GLRA LDL+  EG+DNV+ARH R+ +  R A
Sbjct  227  RCFFSWEDMIKTNDLG-YFPYTPATQLIRGLRASLDLILAEGIDNVVARHHRMASGVRAA  285

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTV+A++VP   D++ ++K A+ RYN SLG GLNKVAGKVFRI
Sbjct  286  VDAWGLKLCAKEPKWHSDTVSAILVPEGADANAVLKTAYYRYNTSLGTGLNKVAGKVFRI  345

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG ++E  + G L  VEM LKD G  +KLGSG  AA+ Y   T
Sbjct  346  GHLGAVDEFMVGGVLFAVEMALKDSGINIKLGSGTGAAAEYFSKT  390



>gb|AIQ91949.1| Aminotransferase class V [Methylobacterium oryzae CBMB20]
Length=443

 Score =   174 bits (440),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 96/165 (58%), Positives = 119/165 (72%), Gaps = 1/165 (1%)
 Frame = -2

Query  617  RVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHTRLGTATRLA  438
              +F WKD L     G Y+PYTP + LLYGLR  L ++ EEGL+NV  RH  L  ATR A
Sbjct  275  HAYFAWKDQLAANATG-YFPYTPVLPLLYGLREALAIVKEEGLENVYHRHHVLAEATRQA  333

Query  437  VQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGLNKVAGKVFRI  258
            V AWGLK C ++ +W SDTVTA+VVP   D+++++  A++RYNLSLG GL+KVAGKVFRI
Sbjct  334  VAAWGLKPCAKEPKWNSDTVTAIVVPEGADAAKVIIHAYERYNLSLGAGLSKVAGKVFRI  393

Query  257  GHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAYLQNT  123
            GHLG+LNEL LLG +AG EM + D G  V  GSGVAAAS+YL+  
Sbjct  394  GHLGDLNELSLLGAIAGAEMAMIDCGIKVTPGSGVAAASSYLREN  438



>gb|AEW08188.1| hypothetical protein 2_2585_01, partial [Pinus lambertiana]
Length=135

 Score =   165 bits (417),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 88/102 (86%), Positives = 96/102 (94%), Gaps = 1/102 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNVIARH  468
            EA+KTAKS+RVFFDW DYL+FYKMGTYWPYTPSIQLLYGLRA LDL+  EEGLDNVIARH
Sbjct  34   EAAKTAKSLRVFFDWNDYLRFYKMGTYWPYTPSIQLLYGLRAALDLILVEEGLDNVIARH  93

Query  467  TRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSS  342
             RLGTATRLAV+AWGLKNCTQKEEW+SDTVTAV+VP YIDS+
Sbjct  94   NRLGTATRLAVEAWGLKNCTQKEEWYSDTVTAVIVPPYIDSA  135



>ref|WP_011630756.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
 gb|ABI60946.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis 
CGDNIH1]
Length=394

 Score =   172 bits (437),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = -2

Query  644  EASKTAKS----VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNV  480
            EA K A++     RV+FD++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNV
Sbjct  215  EAQKAARANNPLRRVYFDFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNV  273

Query  479  IARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSL  300
            IARH  L    R AV+AWGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+L
Sbjct  274  IARHHYLAQGVREAVKAWGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLAL  333

Query  299  GLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  135
            G GL++VAGK+FRIGHLG+LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  334  GAGLSQVAGKLFRIGHLGDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  388



>ref|WP_038511699.1| serine--glyoxylate aminotransferase [Granulibacter bethesdensis]
Length=394

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = -2

Query  644  EASKTAKS----VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNV  480
            EA K A++     RV+FD++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNV
Sbjct  215  EAQKAARANNPLRRVYFDFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNV  273

Query  479  IARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSL  300
            IARH  L    R AV+AWGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+L
Sbjct  274  IARHHYLAQGVREAVKAWGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLAL  333

Query  299  GLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  135
            G GL++VAGK+FRIGHLG+LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  334  GAGLSQVAGKLFRIGHLGDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  388



>gb|AHJ64409.1| Serine-pyruvate aminotransferase [Granulibacter bethesdensis 
CGDNIH4]
Length=433

 Score =   172 bits (437),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 127/175 (73%), Gaps = 6/175 (3%)
 Frame = -2

Query  644  EASKTAKS----VRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLF-EEGLDNV  480
            EA K A++     RV+FD++D  K  + G Y+PYTP++ LLYGLR  L ++  EEGLDNV
Sbjct  254  EAQKAARANNPLRRVYFDFEDQSKANETG-YFPYTPALPLLYGLREALQIILDEEGLDNV  312

Query  479  IARHTRLGTATRLAVQAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSL  300
            IARH  L    R AV+AWGL  C + ++W+SDTV+A++VP   + ++++ RA+KRYNL+L
Sbjct  313  IARHHYLAQGVREAVKAWGLTLCAKDQKWYSDTVSAILVPEGFNGADVISRAFKRYNLAL  372

Query  299  GLGLNKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  135
            G GL++VAGK+FRIGHLG+LNEL  LG + G EM ++DIG  VK GSG AAA  Y
Sbjct  373  GAGLSQVAGKLFRIGHLGDLNELMCLGAITGAEMAMRDIGIDVKPGSGAAAAEEY  427



>ref|WP_035937801.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 gb|KDR42451.1| serine--glyoxylate aminotransferase [Burkholderia glathei]
 emb|CDY78627.1| Serine--glyoxylate aminotransferase [Burkholderia glathei]
Length=419

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = -2

Query  644  EASKTAKSVRVFFDWKDYLKFYKMGTYWPYTPSIQllyglragldlLFEEGLDNVIARHT  465
            +AS+TA S R +FD  D +K    G Y+PYTP++ LLYGLR  LDLLFEEGLDNV ARH 
Sbjct  223  KASETATSRRCYFDLADMIKANATG-YFPYTPALPLLYGLRTALDLLFEEGLDNVFARHH  281

Query  464  RLGTATRLAV-QAWGLKNCTQKEEWFSDTVTAVVVPSYIDSSEIVKRAWKRYNLSLGLGL  288
             L    R A+ + W L  C +  +W SDTV+A+VVP   +++ ++ RA++RYNL+LG GL
Sbjct  282  YLAQGVRAAITEGWDLGVCAKAPKWHSDTVSAIVVPEKFNAAHVIDRAYRRYNLALGAGL  341

Query  287  NKVAGKVFRIGHLGNLNELQLLGCLAGVEMVLKDIGYPVKLGSGVAAASAY  135
            +KVAGKVFRIGHLG+LNEL L+G +AG EM + DIG  V+ GSG  AA+ Y
Sbjct  342  SKVAGKVFRIGHLGDLNELMLMGAIAGAEMAMLDIGIDVRPGSGTGAAAQY  392



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000