BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF039A14

Length=706
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDP29954.1|  hypothetical protein JCGZ_18523                         360   1e-118   Jatropha curcas
gb|KJB10232.1|  hypothetical protein B456_001G190900                    361   1e-118   Gossypium raimondii
ref|XP_002320530.2|  hypothetical protein POPTR_0014s16720g             361   2e-118   
gb|KHG30782.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    357   1e-117   Gossypium arboreum [tree cotton]
ref|XP_011008074.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    355   5e-117   Populus euphratica
ref|XP_007049391.1|  Rubisco methyltransferase family protein iso...    354   1e-116   Theobroma cacao [chocolate]
ref|XP_009601093.1|  PREDICTED: histone-lysine N-methyltransferas...    347   2e-116   
ref|XP_004243586.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    353   5e-116   Solanum lycopersicum
ref|XP_006357659.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    350   5e-115   Solanum tuberosum [potatoes]
ref|XP_009795542.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    348   3e-114   Nicotiana sylvestris
ref|XP_002532210.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...    348   4e-114   Ricinus communis
ref|XP_003542190.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    344   8e-113   Glycine max [soybeans]
ref|XP_010252799.1|  PREDICTED: histone-lysine N-methyltransferas...    344   9e-113   Nelumbo nucifera [Indian lotus]
gb|AFK46204.1|  unknown                                                 332   4e-111   Lotus japonicus
ref|XP_003601528.1|  SET domain-containing protein                      338   2e-110   Medicago truncatula
ref|XP_003605258.1|  SET domain-containing protein                      338   2e-110   
ref|XP_004502116.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    337   9e-110   Cicer arietinum [garbanzo]
emb|CBI28466.3|  unnamed protein product                                336   2e-109   Vitis vinifera
ref|XP_002267469.2|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    337   7e-109   Vitis vinifera
gb|KCW89047.1|  hypothetical protein EUGRSUZ_A01370                     329   7e-109   Eucalyptus grandis [rose gum]
ref|XP_004305682.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    334   8e-109   Fragaria vesca subsp. vesca
gb|KDO50962.1|  hypothetical protein CISIN_1g010607mg                   329   2e-108   Citrus sinensis [apfelsine]
gb|KCW89046.1|  hypothetical protein EUGRSUZ_A01370                     329   2e-108   Eucalyptus grandis [rose gum]
ref|XP_007146016.1|  hypothetical protein PHAVU_006G005700g             329   5e-107   Phaseolus vulgaris [French bean]
gb|KCW89043.1|  hypothetical protein EUGRSUZ_A01370                     327   6e-107   Eucalyptus grandis [rose gum]
gb|KHN39942.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    326   9e-107   Glycine soja [wild soybean]
ref|XP_011100517.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    329   1e-106   Sesamum indicum [beniseed]
ref|XP_006447826.1|  hypothetical protein CICLE_v10014974mg             329   1e-106   Citrus clementina [clementine]
gb|KDO50961.1|  hypothetical protein CISIN_1g010607mg                   329   1e-106   Citrus sinensis [apfelsine]
ref|XP_010048281.1|  PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5...    328   2e-106   Eucalyptus grandis [rose gum]
ref|XP_008229941.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    328   2e-106   Prunus mume [ume]
ref|XP_007215270.1|  hypothetical protein PRUPE_ppa004667mg             328   3e-106   Prunus persica
ref|XP_010689224.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    324   7e-106   
ref|XP_004144553.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    324   7e-105   Cucumis sativus [cucumbers]
ref|XP_010689223.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    324   7e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008462040.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    320   2e-103   Cucumis melo [Oriental melon]
ref|XP_010524627.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    320   5e-103   Tarenaya hassleriana [spider flower]
ref|XP_008342255.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    317   3e-102   
ref|XP_009361534.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    317   6e-102   Pyrus x bretschneideri [bai li]
ref|XP_002882542.1|  SET domain-containing protein                      317   7e-102   Arabidopsis lyrata subsp. lyrata
gb|KCW89045.1|  hypothetical protein EUGRSUZ_A01370                     315   1e-101   Eucalyptus grandis [rose gum]
ref|NP_187424.1|  Rubisco methyltransferase family protein              315   3e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAM61650.1|  putative ribulose-1,5-bisphosphate carboxylase/ox...    315   3e-101   Arabidopsis thaliana [mouse-ear cress]
gb|EYU42781.1|  hypothetical protein MIMGU_mgv1a004696mg                314   1e-100   Erythranthe guttata [common monkey flower]
emb|CDY22127.1|  BnaC01g39740D                                          312   5e-100   Brassica napus [oilseed rape]
ref|XP_009124214.1|  PREDICTED: histone-lysine N-methyltransferas...    312   5e-100   Brassica rapa
ref|XP_010456598.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    311   6e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010486336.1|  PREDICTED: histone-lysine N-methyltransferas...    311   6e-100   Camelina sativa [gold-of-pleasure]
gb|KFK38228.1|  hypothetical protein AALP_AA3G085300                    311   1e-99    Arabis alpina [alpine rockcress]
ref|XP_006407809.1|  hypothetical protein EUTSA_v10020552mg             309   4e-99    Eutrema salsugineum [saltwater cress]
gb|AAC14296.1|  putative methyltransferase                              309   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010464405.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    306   6e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010088354.1|  Ribulose-1,5 bisphosphate carboxylase/oxygen...    304   8e-97    
ref|XP_008802702.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    302   2e-96    Phoenix dactylifera
ref|XP_009391784.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    303   2e-96    
ref|XP_008802701.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    301   4e-96    Phoenix dactylifera
ref|XP_006857756.1|  hypothetical protein AMTR_s00061p00196800          298   2e-94    Amborella trichopoda
gb|KHG10408.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    295   6e-94    Gossypium arboreum [tree cotton]
ref|XP_010942848.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    295   9e-94    
gb|KJB22703.1|  hypothetical protein B456_004G061300                    295   2e-93    Gossypium raimondii
ref|XP_007049386.1|  Rubisco methyltransferase family protein           303   7e-93    
ref|NP_001047982.1|  Os02g0725200                                       289   4e-91    
gb|EEC73918.1|  hypothetical protein OsI_08761                          289   4e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_002454362.1|  hypothetical protein SORBIDRAFT_04g029430          286   3e-90    Sorghum bicolor [broomcorn]
ref|NP_001140387.1|  uncharacterized protein LOC100272441               286   3e-90    Zea mays [maize]
ref|XP_006649004.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    288   3e-90    
gb|ACG45124.1|  ribulose-1,5-bisphosphate carboxylase/oxygenase s...    286   3e-90    Zea mays [maize]
dbj|BAJ90575.1|  predicted protein                                      286   6e-90    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004953752.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    286   7e-90    
ref|XP_010236007.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    283   1e-88    Brachypodium distachyon [annual false brome]
gb|EMT07134.1|  hypothetical protein F775_17280                         268   2e-82    
gb|EMS68033.1|  Ribulose-1,5 bisphosphate carboxylase/oxygenase l...    246   1e-74    Triticum urartu
ref|XP_007049385.1|  Rubisco methyltransferase family protein, pu...    229   2e-71    
gb|AFK34799.1|  unknown                                                 222   7e-70    Lotus japonicus
gb|KDO50963.1|  hypothetical protein CISIN_1g010607mg                   228   3e-68    Citrus sinensis [apfelsine]
ref|XP_006297498.1|  hypothetical protein CARUB_v10013517mg             222   2e-65    
gb|KJB10233.1|  hypothetical protein B456_001G190900                    220   1e-64    Gossypium raimondii
ref|XP_010942853.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    203   6e-59    Elaeis guineensis
ref|XP_010942854.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    202   2e-58    Elaeis guineensis
gb|KDO50964.1|  hypothetical protein CISIN_1g010607mg                   159   1e-42    Citrus sinensis [apfelsine]
ref|XP_011100518.1|  PREDICTED: ribulose-1,5 bisphosphate carboxy...    159   2e-42    
ref|XP_002974548.1|  hypothetical protein SELMODRAFT_101776             140   4e-35    
ref|XP_002963244.1|  hypothetical protein SELMODRAFT_80789              136   9e-34    
ref|XP_001754252.1|  predicted protein                                  122   5e-29    
gb|KDO50965.1|  hypothetical protein CISIN_1g010607mg                 99.4    7e-21    Citrus sinensis [apfelsine]
ref|XP_002508524.1|  set domain protein                               85.5    9e-16    Micromonas commoda
tpg|DAA58352.1|  TPA: hypothetical protein ZEAMMB73_556117            79.7    2e-14    
ref|XP_003057276.1|  set domain protein                               75.1    1e-12    Micromonas pusilla CCMP1545
ref|XP_005850299.1|  hypothetical protein CHLNCDRAFT_142047           73.6    1e-11    Chlorella variabilis
ref|XP_003081307.1|  putative methyltransferase (ISS)                 68.2    6e-10    
emb|CEF99133.1|  Rubisco LS methyltransferase, substrate-binding ...  68.2    7e-10    Ostreococcus tauri
ref|XP_007510589.1|  predicted protein                                67.8    1e-09    Bathycoccus prasinos
ref|XP_001419603.1|  predicted protein                                66.2    3e-09    Ostreococcus lucimarinus CCE9901
gb|KIZ05290.1|  hypothetical protein MNEG_2664                        64.7    1e-08    Monoraphidium neglectum
ref|XP_001690988.1|  lysine N-methylase                               64.3    1e-08    Chlamydomonas reinhardtii
ref|XP_005649983.1|  ResB-domain-containing protein                   63.5    3e-08    Coccomyxa subellipsoidea C-169
ref|XP_002947838.1|  hypothetical protein VOLCADRAFT_88145            63.2    3e-08    Volvox carteri f. nagariensis
ref|XP_001696900.1|  rubisco small subunit N-methyltransferase        61.6    1e-07    Chlamydomonas reinhardtii
ref|XP_005719244.1|  unnamed protein product                          59.3    6e-07    Chondrus crispus [carageen]
ref|XP_005705388.1|  ribulose-1,5-bisphosphate carboxylase/oxygen...  55.5    1e-05    Galdieria sulphuraria
ref|XP_001712247.1|  met                                              55.5    1e-05    Hemiselmis andersenii
gb|EWM24078.1|  ribulose- -bisphosphate carboxylase oxygenase sma...  55.1    2e-05    Nannochloropsis gaditana
ref|XP_005537343.1|  similar to ribulose-1,5 bisphosphate carboxy...  55.1    2e-05    Cyanidioschyzon merolae strain 10D
gb|AFW65498.1|  hypothetical protein ZEAMMB73_874532                  53.1    6e-05    
gb|KDO67843.1|  hypothetical protein CISIN_1g0127291mg                51.2    1e-04    Citrus sinensis [apfelsine]
ref|XP_011449702.1|  PREDICTED: histone-lysine N-methyltransferas...  52.4    1e-04    Crassostrea gigas
ref|XP_006609971.1|  PREDICTED: histone-lysine N-methyltransferas...  51.6    2e-04    Apis dorsata [rock honeybee]
ref|XP_006609970.1|  PREDICTED: histone-lysine N-methyltransferas...  51.6    3e-04    Apis dorsata [rock honeybee]
emb|CBJ29688.1|  putative ribulose-1,5-bisphosphate carboxylase/o...  51.2    4e-04    Ectocarpus siliculosus
gb|EZA62035.1|  Histone-lysine N-methyltransferase setd3              50.8    4e-04    Ooceraea biroi
ref|XP_011338544.1|  PREDICTED: histone-lysine N-methyltransferas...  50.8    4e-04    Ooceraea biroi
ref|XP_006436151.1|  hypothetical protein CICLE_v10032643mg           50.1    5e-04    
ref|XP_002286075.1|  rubisco small subunit small subunit n-methyl...  50.4    5e-04    Thalassiosira pseudonana CCMP1335
ref|XP_001754113.1|  predicted protein                                50.4    6e-04    
ref|XP_003691619.1|  PREDICTED: histone-lysine N-methyltransferas...  49.7    0.001    Apis florea [dwarf honeybee]



>gb|KDP29954.1| hypothetical protein JCGZ_18523 [Jatropha curcas]
Length=502

 Score =   360 bits (923),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP+DSVE+S+S+KKSDKCYKEK+EAL+KHGLS S+ FP
Sbjct  301  SYGKKSNGELLLSYGFVPREGTNPNDSVELSLSLKKSDKCYKEKVEALQKHGLSISQCFP  360

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            ++ITGWP+ELMAYAYLAVSPPSM+RQFEEMA+AASN+T++KKD+RYPEIEE ALQ+ILDS
Sbjct  361  LRITGWPVELMAYAYLAVSPPSMSRQFEEMASAASNKTTAKKDVRYPEIEEQALQFILDS  420

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+KF QASG MDLDVT+PKQLNRRVFLKQLAVDLC SERRILFRAQ +LRRRL
Sbjct  421  CESSISKYNKFSQASGSMDLDVTSPKQLNRRVFLKQLAVDLCNSERRILFRAQNVLRRRL  480

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDI+SGELRALKIF+G RNLFK
Sbjct  481  RDIKSGELRALKIFNGFRNLFK  502



>gb|KJB10232.1| hypothetical protein B456_001G190900 [Gossypium raimondii]
Length=558

 Score =   361 bits (927),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 192/202 (95%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG NPSDSVE+ +S+KKSDKCYKEK+EAL+KHGLSTS+ +P
Sbjct  357  SYGKKSNGELLLSYGFVPKEGANPSDSVELPLSLKKSDKCYKEKLEALRKHGLSTSQCYP  416

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSPPSM++QF+E+AAAASN+++ KKD+RYP+IEE ALQ+ILDS
Sbjct  417  IQITGWPLELMAYAYLAVSPPSMSKQFDEIAAAASNKSTIKKDLRYPDIEEKALQFILDS  476

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQ SG MDLDVT PKQLNRRVFLKQLAVDLCTSE+RILFRAQYILRRRL
Sbjct  477  CESSISKYSKFLQVSGSMDLDVTTPKQLNRRVFLKQLAVDLCTSEQRILFRAQYILRRRL  536

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL+IFDGLRN+FK
Sbjct  537  RDMRSGELRALRIFDGLRNIFK  558



>ref|XP_002320530.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
 gb|EEE98845.2| hypothetical protein POPTR_0014s16720g [Populus trichocarpa]
Length=561

 Score =   361 bits (926),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 190/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VPREGTNPSDSVE+S+S+KKSDKCYKEK+EALKKHGLS S+ FP
Sbjct  360  SYGRKSNGELLLSYGFVPREGTNPSDSVELSLSLKKSDKCYKEKLEALKKHGLSVSQCFP  419

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGWPLELMAYAYLAVSPPSM+RQFEEMAAAASN+T++ K I YP+IEE ALQ+ILDS
Sbjct  420  LQVTGWPLELMAYAYLAVSPPSMSRQFEEMAAAASNKTTTNKKITYPDIEEQALQFILDS  479

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE  ISKY+KFLQASG MDLDVT+PKQLNRR+FLKQLAVDLC+SERRILFRAQY+LRRRL
Sbjct  480  CELSISKYTKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLCSSERRILFRAQYVLRRRL  539

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELR LKIF+G RNLF+
Sbjct  540  RDIRSGELRGLKIFNGFRNLFR  561



>gb|KHG30782.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Gossypium arboreum]
Length=504

 Score =   357 bits (915),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 167/202 (83%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSD VE+ +S+KKSD+CYKEK+EALKKHGLS S+ +P
Sbjct  303  SYGKKSNGELLLSYGFVPKEGTNPSDLVELPLSLKKSDRCYKEKLEALKKHGLSASQCYP  362

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSPPSM++QF+E+AAAASN+++ KKD++YP+IEE ALQ+ILDS
Sbjct  363  IQITGWPLELMAYAYLAVSPPSMSKQFDEIAAAASNKSTIKKDLKYPDIEEKALQFILDS  422

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQASG MDLDVT+PKQLNRRVFLKQLAVDLCTSE+RILFRA+YILRRRL
Sbjct  423  CESSISKYSKFLQASGSMDLDVTSPKQLNRRVFLKQLAVDLCTSEQRILFRAEYILRRRL  482

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL+IFDGLRN+FK
Sbjct  483  RDMRSGELRALRIFDGLRNIFK  504



>ref|XP_011008074.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Populus euphratica]
Length=503

 Score =   355 bits (912),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 189/201 (94%), Gaps = 0/201 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP EGTNPSDSVE+ +S+KKSDK YKEK+EALKKHGLS S+ FP
Sbjct  302  SYGRKSNGELLLSYGFVPSEGTNPSDSVELPLSLKKSDKYYKEKLEALKKHGLSASQCFP  361

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGWPLELMAYAYLAVSPPSM+RQFEEMAAAASN+T++ K+I YP+IEE ALQ+ILDS
Sbjct  362  LQVTGWPLELMAYAYLAVSPPSMSRQFEEMAAAASNKTTTNKNITYPDIEEQALQFILDS  421

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+KFLQASG MDLDVT+PKQLNRR+FLKQLAVDLC+SERRILFRAQY+LRRRL
Sbjct  422  CESSISKYTKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLCSSERRILFRAQYVLRRRL  481

Query  164  RDIRSGELRALKIFDGLRNLF  102
            RDIRSGELRALKIF+G RNLF
Sbjct  482  RDIRSGELRALKIFNGFRNLF  502



>ref|XP_007049391.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007049392.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93548.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX93549.1| Rubisco methyltransferase family protein isoform 1 [Theobroma 
cacao]
Length=506

 Score =   354 bits (909),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 168/202 (83%), Positives = 191/202 (95%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSDSVE+ +S+KK DKCYKEK+EAL+KHGLS S+ +P
Sbjct  305  SYGKKSNGELLLSYGFVPKEGTNPSDSVELPLSLKKYDKCYKEKLEALRKHGLSASQCYP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYA LAVSPPSM+ QFEEMAAAASN++++KKD+RYPEIEE ALQ+ILDS
Sbjct  365  IQITGWPLELMAYANLAVSPPSMSPQFEEMAAAASNKSTTKKDLRYPEIEEKALQFILDS  424

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQASG MDLDVT+PKQLNR VFLKQLAVDLCTSE+RILFRAQ+ILRRRL
Sbjct  425  CESSISKYSKFLQASGSMDLDVTSPKQLNRGVFLKQLAVDLCTSEQRILFRAQHILRRRL  484

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL+IFDGL+N+FK
Sbjct  485  RDMRSGELRALRIFDGLQNIFK  506



>ref|XP_009601093.1| PREDICTED: histone-lysine N-methyltransferase setd3, partial 
[Nicotiana tomentosiformis]
Length=293

 Score =   347 bits (889),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 174/202 (86%), Positives = 193/202 (96%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VPREGTNPSDSVE+S S+KKSDKCYKEK+EALKKHGLS SE FP
Sbjct  92   SYGRKSNGELLLSYGFVPREGTNPSDSVELSFSLKKSDKCYKEKVEALKKHGLSASECFP  151

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGWPLELMA+AYL VSPPSM+RQFEEM+AAASN+++SKKD++YPEIEE ALQ+ILDS
Sbjct  152  IQVTGWPLELMAFAYLVVSPPSMSRQFEEMSAAASNKSTSKKDMKYPEIEEKALQFILDS  211

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQASGEMDLD+TNPKQLNRRVFLKQLAVDLCTSERRILFR+QYILRRRL
Sbjct  212  CESSISKYSKFLQASGEMDLDITNPKQLNRRVFLKQLAVDLCTSERRILFRSQYILRRRL  271

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL +FDG RNLFK
Sbjct  272  RDIRSGELKALNLFDGFRNLFK  293



>ref|XP_004243586.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Solanum lycopersicum]
Length=501

 Score =   353 bits (905),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 178/202 (88%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP+EGTNPSDSVEVS+++KKSDKCYKEK+EALKKHGLS SE FP
Sbjct  300  SYGRKSNGELLLSYGFVPKEGTNPSDSVEVSLALKKSDKCYKEKVEALKKHGLSASECFP  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            VQ+TGWPLELMA+AYL VSPPSM+RQFEEMAAAASN+ +SKKDI+YPEIEEDALQ+ILDS
Sbjct  360  VQVTGWPLELMAFAYLVVSPPSMSRQFEEMAAAASNKATSKKDIKYPEIEEDALQFILDS  419

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRIL+R+QYILRRRL
Sbjct  420  CESSISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILYRSQYILRRRL  479

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRAL +FDGL+NLFK
Sbjct  480  RDIRSGELRALNLFDGLKNLFK  501



>ref|XP_006357659.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Solanum 
tuberosum]
Length=504

 Score =   350 bits (898),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 195/202 (97%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP+EGTNPSDSVEVS+++KKSDKCYKEK+EALKKHGLS SE FP
Sbjct  303  SYGRKSNGELLLSYGFVPKEGTNPSDSVEVSLALKKSDKCYKEKVEALKKHGLSASECFP  362

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            VQ+TGWPLELMA+AYL VSPPSM+RQFEEMAAAASN+ +SKKDI+YPEIEEDALQ+ILDS
Sbjct  363  VQVTGWPLELMAFAYLVVSPPSMSRQFEEMAAAASNKATSKKDIKYPEIEEDALQFILDS  422

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQASGEMDLDVTNPKQLNRR+FLKQLAVDLCTSERRIL+R+QYILRRRL
Sbjct  423  CESSISKYSKFLQASGEMDLDVTNPKQLNRRLFLKQLAVDLCTSERRILYRSQYILRRRL  482

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL +FDGL+NLFK
Sbjct  483  RDIRSGELKALNLFDGLKNLFK  504



>ref|XP_009795542.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Nicotiana sylvestris]
Length=510

 Score =   348 bits (894),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/202 (87%), Positives = 194/202 (96%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VPREGTNPSDSVE+S S+KKSDKCYKEK+EALKKHGLS SE FP
Sbjct  309  SYGRKSNGELLLSYGFVPREGTNPSDSVELSFSLKKSDKCYKEKVEALKKHGLSASECFP  368

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGWPLELMA+AYL VSPPSM+RQF EMAAAASN+++SKKD++YPEIEE+ALQ+ILDS
Sbjct  369  IQVTGWPLELMAFAYLVVSPPSMSRQFGEMAAAASNKSTSKKDMKYPEIEEEALQFILDS  428

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFR+QYILRRRL
Sbjct  429  CESSISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRSQYILRRRL  488

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL +FDGLRNLFK
Sbjct  489  RDIRSGELKALNLFDGLRNLFK  510



>ref|XP_002532210.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF30179.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplast precursor, putative [Ricinus 
communis]
Length=508

 Score =   348 bits (893),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNPSDSVE+S+S+KKSDK YKEK+EALKKHG S S+ FP
Sbjct  307  SYGKKSNGELLLSYGFVPREGTNPSDSVELSLSLKKSDKSYKEKLEALKKHGFSASQCFP  366

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V++TGWP+EL+AYAYLAVSPPSM+ +FEE+AAAASN+T+ KKD+ +PEIEE ALQ+ILDS
Sbjct  367  VRVTGWPVELLAYAYLAVSPPSMSSKFEELAAAASNKTTIKKDVGFPEIEEQALQFILDS  426

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+KFLQASG MDLDVT+PKQLNRR+FLKQLAVDLC SE+RILFRAQ +LRRRL
Sbjct  427  CESSISKYTKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLCNSEQRILFRAQNVLRRRL  486

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRALKIFDG RN FK
Sbjct  487  RDIRSGELRALKIFDGFRNWFK  508



>ref|XP_003542190.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Glycine max]
Length=499

 Score =   344 bits (883),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG NPSDSVE+S+S+KKSD  YKEK+E LK +GLS S+ FP
Sbjct  298  SYGKKSNGELLLSYGFVPKEGANPSDSVELSLSLKKSDASYKEKLELLKNYGLSASQCFP  357

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSP SM   FEEMAAAASN T+SKKD+RYPEIEE ALQ+ILDS
Sbjct  358  IQITGWPLELMAYAYLAVSPSSMRGDFEEMAAAASNNTTSKKDLRYPEIEEQALQFILDS  417

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+KFLQASG +DLDVT+PKQLNRR+FLKQLAVDLCTSERRILFRAQYILRR+L
Sbjct  418  CESSISKYNKFLQASGSLDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRAQYILRRKL  477

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R+GELRALKIF+G RNLF+
Sbjct  478  RDMRAGELRALKIFNGFRNLFQ  499



>ref|XP_010252799.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Nelumbo 
nucifera]
Length=502

 Score =   344 bits (883),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP+D VE+ +S+ KSDKCY+EK EAL+KHGLS S+RFP
Sbjct  301  SYGKKSNGELLLSYGFVPREGTNPNDMVELPLSLNKSDKCYREKSEALRKHGLSVSQRFP  360

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPPSM  QFEEMAA ASN+++SKKDIRYPEIEE ALQ+IL S
Sbjct  361  LQITGWPLELMAYAYLVVSPPSMRAQFEEMAAVASNKSTSKKDIRYPEIEEQALQFILGS  420

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+KFLQ SG +D+DV +PKQ+NR++FLKQLAVDLCTSERRILFR QYILRRRL
Sbjct  421  CESSISKYNKFLQGSGSIDIDVASPKQVNRKLFLKQLAVDLCTSERRILFRTQYILRRRL  480

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL+IFDG R LF+
Sbjct  481  RDMRSGELRALRIFDGFRKLFQ  502



>gb|AFK46204.1| unknown [Lotus japonicus]
Length=271

 Score =   332 bits (852),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG V REG NPSDSVE+S+S+KKSD  YKEK+E LKK+GLS S+ FP
Sbjct  70   SYGKKSNGELLLSYGFVTREGANPSDSVELSLSLKKSDGSYKEKLELLKKYGLSGSQCFP  129

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            ++ITGWPLELMAYAYLAVSP SM  QFE+MAAAASN+ +S KD +YPEIEE ALQ+ILDS
Sbjct  130  IRITGWPLELMAYAYLAVSPSSMRGQFEKMAAAASNKITSTKDFKYPEIEEQALQFILDS  189

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES +SKY+KFLQASG +DLDVT+PKQLNRR+FLKQLAVDLCTSERRIL+RAQYILRR+L
Sbjct  190  CESSMSKYNKFLQASGSLDLDVTSPKQLNRRLFLKQLAVDLCTSERRILYRAQYILRRQL  249

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R GELRA K+FDG+RN FK
Sbjct  250  RDMRDGELRAFKLFDGVRNFFK  271



>ref|XP_003601528.1| SET domain-containing protein [Medicago truncatula]
 gb|AES71779.1| rubisco methyltransferase family protein [Medicago truncatula]
 gb|AFK38105.1| unknown [Medicago truncatula]
Length=497

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSDSVE+S+S+KKSD+ YKEK+E LKK+GLS S+ FP
Sbjct  296  SYGKKSNGELLLSYGFVPKEGTNPSDSVELSLSLKKSDESYKEKLELLKKYGLSGSQCFP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWPLELMAYAYLAVSP SM  +FEEMAAAASN+T+SKKD+RYPEIEE ALQ+ILDS
Sbjct  356  IRVTGWPLELMAYAYLAVSPSSMRGKFEEMAAAASNKTTSKKDLRYPEIEEQALQFILDS  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+KFLQ SG +DLDVT+PKQLNRR+FLKQLAVDLC SERRILFRAQYILRRRL
Sbjct  416  CESSISKYNKFLQVSGSLDLDVTSPKQLNRRLFLKQLAVDLCNSERRILFRAQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R+GEL+ LKIF+G  N F+
Sbjct  476  RDMRTGELKGLKIFNGFWNFFQ  497



>ref|XP_003605258.1| SET domain-containing protein [Medicago truncatula]
Length=494

 Score =   338 bits (867),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSDSVE+S+S+KKSD+ YKEK+E LKK+GLS S+ FP
Sbjct  293  SYGKKSNGELLLSYGFVPKEGTNPSDSVELSLSLKKSDESYKEKLELLKKYGLSGSQCFP  352

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWPLELMAYAYLAVSP SM  +FEEMAAAASN+T+SKKD+RYPEIEE ALQ+ILDS
Sbjct  353  IRVTGWPLELMAYAYLAVSPSSMRGKFEEMAAAASNKTTSKKDLRYPEIEEQALQFILDS  412

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+KFLQ SG +DLDVT+PKQLNRR+FLKQLAVDLC SERRILFRAQYILRRRL
Sbjct  413  CESSISKYNKFLQVSGSLDLDVTSPKQLNRRLFLKQLAVDLCNSERRILFRAQYILRRRL  472

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R+GEL+ LKIF+G  N F+
Sbjct  473  RDMRTGELKGLKIFNGFWNFFQ  494



>ref|XP_004502116.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cicer arietinum]
Length=503

 Score =   337 bits (864),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNP DSVE+S+S+ KSD+ Y+EK+E LKK+GLS S+ FP
Sbjct  302  SYGKKSNGELLLSYGFVPKEGTNPCDSVELSLSLNKSDESYEEKLELLKKYGLSGSQCFP  361

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWPLELMAYAYLAVSP SM  +FEEMAAAASN T+S KD+RYPEIEE ALQ+ILDS
Sbjct  362  VRITGWPLELMAYAYLAVSPSSMRGKFEEMAAAASNETTSNKDLRYPEIEEQALQFILDS  421

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I+KY+KFLQ SG +DLDVT+PKQLNRR+FLKQLAVDLCTSERRILFRAQYILRR++
Sbjct  422  CESRITKYNKFLQVSGSLDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRAQYILRRKV  481

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R+GELRALKIF+G RNLFK
Sbjct  482  RDMRTGELRALKIFNGFRNLFK  503



>emb|CBI28466.3| unnamed protein product [Vitis vinifera]
Length=497

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP+D VE+ +S+KKSDKCYKEK EA+KKHGLSTS+ FP
Sbjct  296  SYGKKSNGELLLSYGFVPREGTNPNDKVELLLSLKKSDKCYKEKSEAMKKHGLSTSQCFP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPPSM++ FEE+AA ASN+T+SKKDIRYPE+EE ALQ+ILDS
Sbjct  356  IQITGWPLELMAYAYLVVSPPSMSQHFEEIAAVASNKTTSKKDIRYPELEEQALQFILDS  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYSKFLQ SG MDLDVT+PKQLNRRVFLKQLAVDLCTSERRILFR QYILRRRL
Sbjct  416  CEASISKYSKFLQESGSMDLDVTSPKQLNRRVFLKQLAVDLCTSERRILFRTQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRAL+IFDG R LFK
Sbjct  476  RDIRSGELRALRIFDGFRKLFK  497



>ref|XP_002267469.2| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Vitis vinifera]
Length=577

 Score =   337 bits (863),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 170/202 (84%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP+D VE+ +S+KKSDKCYKEK EA+KKHGLSTS+ FP
Sbjct  376  SYGKKSNGELLLSYGFVPREGTNPNDKVELLLSLKKSDKCYKEKSEAMKKHGLSTSQCFP  435

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPPSM++ FEE+AA ASN+T+SKKDIRYPE+EE ALQ+ILDS
Sbjct  436  IQITGWPLELMAYAYLVVSPPSMSQHFEEIAAVASNKTTSKKDIRYPELEEQALQFILDS  495

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYSKFLQ SG MDLDVT+PKQLNRRVFLKQLAVDLCTSERRILFR QYILRRRL
Sbjct  496  CEASISKYSKFLQESGSMDLDVTSPKQLNRRVFLKQLAVDLCTSERRILFRTQYILRRRL  555

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRAL+IFDG R LFK
Sbjct  556  RDIRSGELRALRIFDGFRKLFK  577



>gb|KCW89047.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=344

 Score =   329 bits (843),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP+EGTNPSDSVE+ +S+KKSDK Y +K+EAL+KHGLS S+ FP
Sbjct  143  SYGRKSNGELLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFP  202

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            VQITGWP+ELMAYAYLAVSPPSM+ QFE++AAAASN+T+++KD+R+PEIEE ALQYILDS
Sbjct  203  VQITGWPVELMAYAYLAVSPPSMSSQFEKLAAAASNKTTTRKDMRFPEIEEQALQYILDS  262

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQ SG MDLDVT+PKQLNRR+FLKQLAVDLCTSERRILFRAQYILRRRL
Sbjct  263  CESSISKYSKFLQESGSMDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRAQYILRRRL  322

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL +F+GLR LFK
Sbjct  323  RDLRSGELRALTLFNGLRKLFK  344



>ref|XP_004305682.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=498

 Score =   334 bits (857),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP +G NPSDSVE+SVS+ KSDKCY+EK+EAL+K+GLS  E FP
Sbjct  297  SYGKKSNGELLLSYGFVPSKGANPSDSVELSVSLLKSDKCYEEKVEALRKYGLSARECFP  356

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP ELMA+AYLAVSPPSM++QFEEMAAAASN+++++KD+RYPEIEE+ LQ+ILDS
Sbjct  357  VRITGWPSELMAFAYLAVSPPSMSKQFEEMAAAASNKSTTQKDLRYPEIEEEVLQFILDS  416

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE  ISKYSKFLQASG MDLDVT+PKQLNRR+FLKQLAVDL TSE++ILFRAQYILRR+L
Sbjct  417  CEVSISKYSKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLSTSEQKILFRAQYILRRQL  476

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIR GELRAL IF+G R  FK
Sbjct  477  RDIRKGELRALTIFNGFRKWFK  498



>gb|KDO50962.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=378

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNPSDSVE+ +S+KKSDKCYKEK+EAL+K+GLS SE FP
Sbjct  177  SYGKKSNGELLLSYGFVPREGTNPSDSVELPLSLKKSDKCYKEKLEALRKYGLSASECFP  236

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPPSM  +FEEMAAAASN+ +SKKDI+ PEI+E ALQ+ILDS
Sbjct  237  IQITGWPLELMAYAYLVVSPPSMKGKFEEMAAAASNKMTSKKDIKCPEIDEQALQFILDS  296

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYS+FLQASG MDLD T+PKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL
Sbjct  297  CESSISKYSRFLQASGSMDLDTTSPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  356

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRAL++FD   NLFK
Sbjct  357  RDIRSGELRALRLFDNFVNLFK  378



>gb|KCW89046.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=381

 Score =   329 bits (843),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP+EGTNPSDSVE+ +S+KKSDK Y +K+EAL+KHGLS S+ FP
Sbjct  180  SYGRKSNGELLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFP  239

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            VQITGWP+ELMAYAYLAVSPPSM+ QFE++AAAASN+T+++KD+R+PEIEE ALQYILDS
Sbjct  240  VQITGWPVELMAYAYLAVSPPSMSSQFEKLAAAASNKTTTRKDMRFPEIEEQALQYILDS  299

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQ SG MDLDVT+PKQLNRR+FLKQLAVDLCTSERRILFRAQYILRRRL
Sbjct  300  CESSISKYSKFLQESGSMDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRAQYILRRRL  359

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL +F+GLR LFK
Sbjct  360  RDLRSGELRALTLFNGLRKLFK  381



>ref|XP_007146016.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
 gb|ESW18010.1| hypothetical protein PHAVU_006G005700g [Phaseolus vulgaris]
Length=492

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 180/202 (89%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG NPSDSVE+S+S+KKSD  YKEK+  LKK+GLS S+ FP
Sbjct  291  SYGKKSNGELLLSYGFVPKEGGNPSDSVELSLSLKKSDASYKEKLVLLKKYGLSASQCFP  350

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLEL+AYAYLAVSP SM   FEEMAAAASN T+SKKD+RYPEIEE ALQ+ILDS
Sbjct  351  IQITGWPLELLAYAYLAVSPSSMRENFEEMAAAASNNTTSKKDLRYPEIEEQALQFILDS  410

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY+KFLQASG +DLDVT+PKQLNRR+FLKQLAVDL  SERRILFRAQYILRR+L
Sbjct  411  CEASISKYNKFLQASGSLDLDVTSPKQLNRRLFLKQLAVDLSNSERRILFRAQYILRRKL  470

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R+GELRAL IF+G R  F+
Sbjct  471  RDMRAGELRALTIFNGFRKFFQ  492



>gb|KCW89043.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
 gb|KCW89044.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=439

 Score =   327 bits (839),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP+EGTNPSDSVE+ +S+KKSDK Y +K+EAL+KHGLS S+ FP
Sbjct  238  SYGRKSNGELLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFP  297

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            VQITGWP+ELMAYAYLAVSPPSM+ QFE++AAAASN+T+++KD+R+PEIEE ALQYILDS
Sbjct  298  VQITGWPVELMAYAYLAVSPPSMSSQFEKLAAAASNKTTTRKDMRFPEIEEQALQYILDS  357

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQ SG MDLDVT+PKQLNRR+FLKQLAVDLCTSERRILFRAQYILRRRL
Sbjct  358  CESSISKYSKFLQESGSMDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRAQYILRRRL  417

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL +F+GLR LFK
Sbjct  418  RDLRSGELRALTLFNGLRKLFK  439



>gb|KHN39942.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Glycine soja]
Length=409

 Score =   326 bits (835),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 180/202 (89%), Gaps = 5/202 (2%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG NPSDSVE+S+S+KKSD  YKEK+E LK +GLS S+ FP
Sbjct  213  SYGKKSNGELLLSYGFVPKEGANPSDSVELSLSLKKSDASYKEKLELLKNYGLSASQCFP  272

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSP SM   FEEMAAAASN T+SKKD+RYPEIEE ALQ+ILDS
Sbjct  273  IQITGWPLELMAYAYLAVSPSSMRGDFEEMAAAASNNTTSKKDLRYPEIEEQALQFILDS  332

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKY+     +G +DLDVT+PKQLNRR+FLKQLAVDLCTSERRILFRAQYILRR+L
Sbjct  333  CESSISKYN-----NGSLDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRAQYILRRKL  387

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R+GELRALKIF+G RNLF+
Sbjct  388  RDMRAGELRALKIFNGFRNLFQ  409



>ref|XP_011100517.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Sesamum 
indicum]
Length=508

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 168/201 (84%), Positives = 186/201 (93%), Gaps = 0/201 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP DSVE+S+S+KKSDKCYKEK+EALKKHGLS S+ FP
Sbjct  307  SYGKKSNGELLLSYGFVPREGTNPRDSVELSLSLKKSDKCYKEKLEALKKHGLSASQCFP  366

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWP+ELMAYAYL VSPPSM  +F+EMAAAASN+T+SKK I YPEIEE+ALQ+ILD 
Sbjct  367  IQITGWPVELMAYAYLTVSPPSMKNRFDEMAAAASNKTASKKAIVYPEIEEEALQFILDM  426

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYSKFLQASG MDLDVTNPK LNR++FLKQLAVDLCTSE+RILFRAQYILRRRL
Sbjct  427  CEASISKYSKFLQASGSMDLDVTNPKLLNRKLFLKQLAVDLCTSEQRILFRAQYILRRRL  486

Query  164  RDIRSGELRALKIFDGLRNLF  102
            RDIRSGELRAL+IFDG R LF
Sbjct  487  RDIRSGELRALRIFDGFRKLF  507



>ref|XP_006447826.1| hypothetical protein CICLE_v10014974mg [Citrus clementina]
 ref|XP_006469428.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Citrus 
sinensis]
 gb|ESR61066.1| hypothetical protein CICLE_v10014974mg [Citrus clementina]
Length=506

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNPSDSVE+ +S+KKSDKCYKEK+EAL+K+GLS SE FP
Sbjct  305  SYGKKSNGELLLSYGFVPREGTNPSDSVELPLSLKKSDKCYKEKLEALRKYGLSASECFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPPSM  +FEEMAAAASN+ +SKKDI+ PEI+E ALQ+ILDS
Sbjct  365  IQITGWPLELMAYAYLVVSPPSMKGKFEEMAAAASNKMTSKKDIKCPEIDEQALQFILDS  424

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYS+FLQASG MDLD T+PKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL
Sbjct  425  CESSISKYSRFLQASGSMDLDTTSPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  484

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRAL++FD   NLFK
Sbjct  485  RDIRSGELRALRLFDNFVNLFK  506



>gb|KDO50961.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=506

 Score =   329 bits (843),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNPSDSVE+ +S+KKSDKCYKEK+EAL+K+GLS SE FP
Sbjct  305  SYGKKSNGELLLSYGFVPREGTNPSDSVELPLSLKKSDKCYKEKLEALRKYGLSASECFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPPSM  +FEEMAAAASN+ +SKKDI+ PEI+E ALQ+ILDS
Sbjct  365  IQITGWPLELMAYAYLVVSPPSMKGKFEEMAAAASNKMTSKKDIKCPEIDEQALQFILDS  424

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYS+FLQASG MDLD T+PKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL
Sbjct  425  CESSISKYSRFLQASGSMDLDTTSPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  484

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRAL++FD   NLFK
Sbjct  485  RDIRSGELRALRLFDNFVNLFK  506



>ref|XP_010048281.1| PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic 
[Eucalyptus grandis]
Length=506

 Score =   328 bits (841),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 189/202 (94%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP+EGTNPSDSVE+ +S+KKSDK Y +K+EAL+KHGLS S+ FP
Sbjct  305  SYGRKSNGELLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            VQITGWP+ELMAYAYLAVSPPSM+ QFE++AAAASN+T+++KD+R+PEIEE ALQYILDS
Sbjct  365  VQITGWPVELMAYAYLAVSPPSMSSQFEKLAAAASNKTTTRKDMRFPEIEEQALQYILDS  424

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFLQ SG MDLDVT+PKQLNRR+FLKQLAVDLCTSERRILFRAQYILRRRL
Sbjct  425  CESSISKYSKFLQESGSMDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRAQYILRRRL  484

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL +F+GLR LFK
Sbjct  485  RDLRSGELRALTLFNGLRKLFK  506



>ref|XP_008229941.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Prunus mume]
Length=497

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP DSVE+S+SI KSDKCYKEK+EAL+KHGLS S+ +P
Sbjct  296  SYGKKSNGELLLSYGFVPREGTNPRDSVELSLSISKSDKCYKEKLEALRKHGLSASQCYP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGWPLELMAYAYLAVSPPSM+ QFEEMAAAASN++++KKD+RY EIEE+ALQ+ILDS
Sbjct  356  IQVTGWPLELMAYAYLAVSPPSMSGQFEEMAAAASNKSTTKKDLRYSEIEEEALQFILDS  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE  ISKY+KFLQASG MDLDVT+PKQLNRR+FLKQLAVDL TSERRILFRAQYILRRRL
Sbjct  416  CEVSISKYNKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLSTSERRILFRAQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R GELRAL IF+G R  FK
Sbjct  476  RDMRRGELRALTIFNGFRKFFK  497



>ref|XP_007215270.1| hypothetical protein PRUPE_ppa004667mg [Prunus persica]
 gb|EMJ16469.1| hypothetical protein PRUPE_ppa004667mg [Prunus persica]
Length=497

 Score =   328 bits (840),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/202 (82%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP DSVE+S+SI KSDKCYKEK+EAL+KHGLS S+ +P
Sbjct  296  SYGKKSNGELLLSYGFVPREGTNPRDSVELSLSISKSDKCYKEKLEALRKHGLSASQCYP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGWPLELMAYAYLAVSPPSM+ QFEEMAAAASN++++KKD+RY EIEE+ALQ+ILDS
Sbjct  356  IQVTGWPLELMAYAYLAVSPPSMSGQFEEMAAAASNKSTTKKDLRYSEIEEEALQFILDS  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE  ISKY+KFLQASG MDLDVT+PKQLNRR+FLKQLAVDL TSERRILFRAQYILRRRL
Sbjct  416  CEVSISKYNKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLSTSERRILFRAQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R GELRAL IF+G R  FK
Sbjct  476  RDMRRGELRALTIFNGFRKFFK  497



>ref|XP_010689224.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=413

 Score =   324 bits (830),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSDS E+S+S+KKSDKCYKEKMEAL K+GLS S+ FP
Sbjct  212  SYGKKSNGELLLSYGFVPKEGTNPSDSAELSLSLKKSDKCYKEKMEALMKYGLSGSQCFP  271

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGW +E+MAYAYL VSPPSM  QF++MAAAASN+T +KKDIRYP+++E ALQ+ILDS
Sbjct  272  LQVTGWSVEMMAYAYLVVSPPSMLNQFDKMAAAASNKTGTKKDIRYPDLDEQALQFILDS  331

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ I+KYSKFLQASG MDLDVT+PKQLNRR+FLKQLAVDLC SERRIL+RAQYILRRRL
Sbjct  332  CEASIAKYSKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLCNSERRILYRAQYILRRRL  391

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRALKIFDG RNLFK
Sbjct  392  RDIRSGELRALKIFDGFRNLFK  413



>ref|XP_004144553.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Cucumis 
sativus]
 ref|XP_004164054.1| PREDICTED: LOW QUALITY PROTEIN: ribulose-1,5 bisphosphate carboxylase/oxygenase 
large subunit N-methyltransferase, chloroplastic-like 
[Cucumis sativus]
 gb|KGN43400.1| hypothetical protein Csa_7G031610 [Cucumis sativus]
Length=497

 Score =   324 bits (830),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG+NPSDSVE+ +S+KKSDKCYKEK+EALKKHGL  S+ FP
Sbjct  296  SYGKKSNGELLLSYGFVPKEGSNPSDSVELLLSLKKSDKCYKEKLEALKKHGLRASQCFP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGWPLEL A+AYLAVSPPS++ QF+EMAAAASN++++KKD+ YP+IEE+ALQ+ILDS
Sbjct  356  IQVTGWPLELKAFAYLAVSPPSLSNQFDEMAAAASNKSTAKKDLNYPDIEEEALQFILDS  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY+KFLQASG MDLDVT+PKQLNRRVFLKQLAVDLCTSERRILFR+QYILRRRL
Sbjct  416  CETSISKYNKFLQASGSMDLDVTSPKQLNRRVFLKQLAVDLCTSERRILFRSQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRALK+F G   LFK
Sbjct  476  RDLRSGELRALKLFRGFGKLFK  497



>ref|XP_010689223.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=500

 Score =   324 bits (830),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 164/202 (81%), Positives = 187/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSDS E+S+S+KKSDKCYKEKMEAL K+GLS S+ FP
Sbjct  299  SYGKKSNGELLLSYGFVPKEGTNPSDSAELSLSLKKSDKCYKEKMEALMKYGLSGSQCFP  358

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +Q+TGW +E+MAYAYL VSPPSM  QF++MAAAASN+T +KKDIRYP+++E ALQ+ILDS
Sbjct  359  LQVTGWSVEMMAYAYLVVSPPSMLNQFDKMAAAASNKTGTKKDIRYPDLDEQALQFILDS  418

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ I+KYSKFLQASG MDLDVT+PKQLNRR+FLKQLAVDLC SERRIL+RAQYILRRRL
Sbjct  419  CEASIAKYSKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLCNSERRILYRAQYILRRRL  478

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGELRALKIFDG RNLFK
Sbjct  479  RDIRSGELRALKIFDGFRNLFK  500



>ref|XP_008462040.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Cucumis melo]
Length=497

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG+NPSDSVE+ +S+KKSDKCYKEK+EALKKHGL  S+ FP
Sbjct  296  SYGKKSNGELLLSYGFVPKEGSNPSDSVELLLSLKKSDKCYKEKLEALKKHGLRASQCFP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLEL A+AYLAVSPPS++ QF+EMAAA SN++++KKD+ YP+IEE+A+Q+ILDS
Sbjct  356  IQITGWPLELKAFAYLAVSPPSLSNQFDEMAAATSNKSTAKKDLSYPDIEEEAMQFILDS  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY+KFLQASG MDLDVT PKQLNRRVFLKQLAVDLCTSERRILFR+QYILRRRL
Sbjct  416  CETSISKYNKFLQASGSMDLDVTLPKQLNRRVFLKQLAVDLCTSERRILFRSQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRALK+F G   LFK
Sbjct  476  RDLRSGELRALKLFRGFGKLFK  497



>ref|XP_010524627.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Tarenaya hassleriana]
Length=508

 Score =   320 bits (819),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VP EGTNPSDSVE+SVS++K+DKCYKEK++AL+KHGL+T + FP
Sbjct  307  SYGNKSNGELLLSYGFVPGEGTNPSDSVELSVSLRKTDKCYKEKLDALRKHGLTTPQCFP  366

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWPLELMAYAYL  SP  M  +F+EMAAAASN++++KKDI++PEIEE+ALQ+ILDS
Sbjct  367  IRVTGWPLELMAYAYLVASPSDMRNRFDEMAAAASNKSTTKKDIKFPEIEEEALQFILDS  426

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYSKFLQASG MDLD+T+PKQLNRRVFLKQLAVDLC SERRIL+RAQYILRRRL
Sbjct  427  CEASISKYSKFLQASGSMDLDITSPKQLNRRVFLKQLAVDLCNSERRILYRAQYILRRRL  486

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F+GLRNLFK
Sbjct  487  RDIRSGELKALRLFNGLRNLFK  508



>ref|XP_008342255.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Malus domestica]
 ref|XP_008353614.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
 ref|XP_008362320.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Malus domestica]
Length=497

 Score =   317 bits (813),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP DSVE+ +S+ KSDKCYKEK+E L+K+GLS S+ +P
Sbjct  296  SYGKKSNGELLLSYGFVPREGTNPRDSVELPLSLSKSDKCYKEKLEVLRKYGLSASQCYP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSPPSM+ QF+EMAAAASN++++KKD+RY EIEE+ALQ+ILD+
Sbjct  356  MQITGWPLELMAYAYLAVSPPSMSGQFDEMAAAASNKSTAKKDLRYSEIEEEALQFILDT  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY+KFLQASG MDLDVT+PKQLNRR+FLKQLAVDL TSERRILFRAQYILRRRL
Sbjct  416  CEASISKYNKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLSTSERRILFRAQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL IF+G R  FK
Sbjct  476  RDIRSGELKALTIFNGFRKFFK  497



>ref|XP_009361534.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Pyrus x bretschneideri]
Length=497

 Score =   317 bits (811),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP DSVE+ +S+ KSDKCYKEK+E L+K+GLS S+ +P
Sbjct  296  SYGKKSNGELLLSYGFVPREGTNPRDSVELPLSLSKSDKCYKEKLEVLRKYGLSASQCYP  355

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSPPSM+ QF+EMAAAASN++++KKD++Y EIEE+ALQ+ILD+
Sbjct  356  IQITGWPLELMAYAYLAVSPPSMSGQFDEMAAAASNKSTAKKDLQYSEIEEEALQFILDT  415

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY+KFLQASG MDLDVT+PKQLNRR+FLKQLAVDL TSERRILFRAQYILRRRL
Sbjct  416  CEASISKYNKFLQASGSMDLDVTSPKQLNRRLFLKQLAVDLSTSERRILFRAQYILRRRL  475

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL IF+G R  FK
Sbjct  476  RDIRSGELKALTIFNGFRRFFK  497



>ref|XP_002882542.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH58801.1| SET domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=504

 Score =   317 bits (811),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 158/202 (78%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCYKEK++ALKKHGLST + FP
Sbjct  303  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFP  362

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL VSPP M   FEEMA AASN+TS+K D++YPEIEEDALQ+ILDS
Sbjct  363  VRITGWPMELMAYAYLVVSPPDMGNNFEEMAKAASNKTSTKTDLKYPEIEEDALQFILDS  422

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYS+FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  423  CETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  482

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F GLRN FK
Sbjct  483  RDIRSGELKALRLFSGLRNFFK  504



>gb|KCW89045.1| hypothetical protein EUGRSUZ_A01370 [Eucalyptus grandis]
Length=464

 Score =   315 bits (806),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 189/227 (83%), Gaps = 25/227 (11%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KSNGELLLSYG VP+EGTNPSDSVE+ +S+KKSDK Y +K+EAL+KHGLS S+ FP
Sbjct  238  SYGRKSNGELLLSYGFVPKEGTNPSDSVELLLSLKKSDKSYSQKLEALRKHGLSASQCFP  297

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFE-------------------------EMAAAAS  420
            VQITGWP+ELMAYAYLAVSPPSM+ QFE                         ++AAAAS
Sbjct  298  VQITGWPVELMAYAYLAVSPPSMSSQFEKVVKFYFEKYNVILLFYHYKASISLQLAAAAS  357

Query  419  NRTSSKKDIRYPEIEEDALQYILDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLK  240
            N+T+++KD+R+PEIEE ALQYILDSCES ISKYSKFLQ SG MDLDVT+PKQLNRR+FLK
Sbjct  358  NKTTTRKDMRFPEIEEQALQYILDSCESSISKYSKFLQESGSMDLDVTSPKQLNRRLFLK  417

Query  239  QLAVDLCTSERRILFRAQYILRRRLRDIRSGELRALKIFDGLRNLFK  99
            QLAVDLCTSERRILFRAQYILRRRLRD+RSGELRAL +F+GLR LFK
Sbjct  418  QLAVDLCTSERRILFRAQYILRRRLRDLRSGELRALTLFNGLRKLFK  464



>ref|NP_187424.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
 gb|AAF13085.1|AC009176_12 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAF21177.1|AC013483_1 putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAK76599.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AAL85066.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
 gb|AEE74585.1| Rubisco methyltransferase family protein [Arabidopsis thaliana]
Length=504

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCY+EK++ALKKHGLST + FP
Sbjct  303  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFP  362

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL VSPP M   FEEMA AASN+TS+K D++YPEIEEDALQ+ILDS
Sbjct  363  VRITGWPMELMAYAYLVVSPPDMRNNFEEMAKAASNKTSTKNDLKYPEIEEDALQFILDS  422

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYS+FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  423  CETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  482

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F GLRN FK
Sbjct  483  RDIRSGELKALRLFSGLRNFFK  504



>gb|AAM61650.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Arabidopsis thaliana]
Length=504

 Score =   315 bits (807),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 157/202 (78%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCY+EK++ALKKHGLST + FP
Sbjct  303  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFP  362

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL VSPP M   FEEMA AASN+TS+K D++YPEIEEDALQ+ILDS
Sbjct  363  VRITGWPMELMAYAYLVVSPPDMRNNFEEMAKAASNKTSTKNDLKYPEIEEDALQFILDS  422

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYS+FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  423  CETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  482

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F GLRN FK
Sbjct  483  RDIRSGELKALRLFSGLRNFFK  504



>gb|EYU42781.1| hypothetical protein MIMGU_mgv1a004696mg [Erythranthe guttata]
Length=514

 Score =   314 bits (804),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 161/197 (82%), Positives = 179/197 (91%), Gaps = 0/197 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP DSVE+S+S+ K D CYKEK EALKKHGLS S+ +P
Sbjct  309  SYGKKSNGELLLSYGFVPREGTNPRDSVEISLSLLKYDDCYKEKSEALKKHGLSASQCYP  368

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWP+ELMAYAYLAVSPPSM  QF+EMAAAASN+ +SK+D+RYPE+EEDALQ+ILD+
Sbjct  369  LQITGWPVELMAYAYLAVSPPSMVNQFDEMAAAASNKNTSKRDVRYPELEEDALQFILDT  428

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE  ISKYSKFLQASG MDLDVTNPK LNR++FLKQLAVDL TSERRILFRAQYILRRRL
Sbjct  429  CEVSISKYSKFLQASGSMDLDVTNPKLLNRKLFLKQLAVDLSTSERRILFRAQYILRRRL  488

Query  164  RDIRSGELRALKIFDGL  114
            RDIRSG L+AL IFDGL
Sbjct  489  RDIRSGTLKALNIFDGL  505



>emb|CDY22127.1| BnaC01g39740D [Brassica napus]
Length=507

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+D CYKEK++ALKKHGLST + FP
Sbjct  305  SYGNKSNGELLLSYGFVPREGTNPSDSVELAMSLRKNDTCYKEKLDALKKHGLSTPQCFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWPLELMAYAYL VSPP M+  FEEMA AASN++S+ KD++YPEIEE+ALQ+ILDS
Sbjct  365  VRITGWPLELMAYAYLVVSPPDMSNSFEEMAKAASNKSSTNKDLKYPEIEEEALQFILDS  424

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYS+FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  425  CETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  484

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F G+RN FK
Sbjct  485  RDIRSGELKALRLFSGIRNFFK  506



>ref|XP_009124214.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Brassica 
rapa]
Length=507

 Score =   312 bits (799),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+D CYKEK++ALKKHGLST + FP
Sbjct  305  SYGNKSNGELLLSYGFVPREGTNPSDSVELAMSLRKNDTCYKEKLDALKKHGLSTPQCFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWPLELMAYAYL VSPP M+  FEEMA AASN++S+ KD++YPEIEE+ALQ+ILDS
Sbjct  365  VRITGWPLELMAYAYLVVSPPDMSNSFEEMAKAASNKSSTNKDLKYPEIEEEALQFILDS  424

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYS+FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  425  CETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  484

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F G+RN FK
Sbjct  485  RDIRSGELKALRLFSGIRNFFK  506



>ref|XP_010456598.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score =   311 bits (798),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCYKEK++ALKKHGLST + FP
Sbjct  304  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL VSPP M   FEEMA AASN+TS+K D++YPEIEE+ALQ+ILDS
Sbjct  364  VRITGWPMELMAYAYLVVSPPDMRNSFEEMAKAASNKTSTKNDLKYPEIEEEALQFILDS  423

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY++FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYI+RRRL
Sbjct  424  CETSISKYTRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYIIRRRL  483

Query  164  RDIRSGELRALKIFDGLRNLF  102
            RDIRSGEL+AL++F GLRN F
Sbjct  484  RDIRSGELKALRLFSGLRNFF  504



>ref|XP_010486336.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Camelina 
sativa]
Length=507

 Score =   311 bits (798),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 154/201 (77%), Positives = 183/201 (91%), Gaps = 0/201 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCYKEK++ALKKHGLST + FP
Sbjct  304  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL VSPP M   FEEMA AASN+TS+K D++YPEIEE+ALQ+ILDS
Sbjct  364  VRITGWPMELMAYAYLVVSPPDMRNSFEEMAKAASNKTSTKNDLKYPEIEEEALQFILDS  423

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY++FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYI+RRRL
Sbjct  424  CETSISKYTRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYIIRRRL  483

Query  164  RDIRSGELRALKIFDGLRNLF  102
            RDIRSGEL+AL++F GLRN F
Sbjct  484  RDIRSGELKALRLFTGLRNFF  504



>gb|KFK38228.1| hypothetical protein AALP_AA3G085300 [Arabis alpina]
Length=506

 Score =   311 bits (796),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE++VS++K+D CYKEK++ALKKHGLST + FP
Sbjct  304  SYGNKSNGELLLSYGFVPREGTNPSDSVELAVSLRKNDACYKEKLDALKKHGLSTPQCFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWPLELMAYAYL VSPP M   FEEMA AASN++S+ KD++YPEIEE+ALQ+ILD+
Sbjct  364  VRITGWPLELMAYAYLVVSPPEMRNSFEEMAKAASNKSSTNKDLKYPEIEEEALQFILDT  423

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY++FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  424  CEASISKYTRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  483

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F GLRN FK
Sbjct  484  RDIRSGELKALRLFSGLRNFFK  505



>ref|XP_006407809.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
 gb|ESQ49262.1| hypothetical protein EUTSA_v10020552mg [Eutrema salsugineum]
Length=506

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 183/202 (91%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCYKEK++ALKKHGLST + FP
Sbjct  304  SYGNKSNGELLLSYGFVPREGTNPSDSVELAMSLRKNDKCYKEKLDALKKHGLSTPQCFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWPLELMAYAYL VSPP M   FEEMA AASN++S+ K ++YPEIEE+ALQ+ILDS
Sbjct  364  VRITGWPLELMAYAYLVVSPPDMRNSFEEMAKAASNKSSTTKVLKYPEIEEEALQFILDS  423

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKYS+FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  424  CETSISKYSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  483

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F G+RN FK
Sbjct  484  RDIRSGELKALRLFSGIRNFFK  505



>gb|AAC14296.1| putative methyltransferase [Arabidopsis thaliana]
Length=504

 Score =   309 bits (791),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/202 (77%), Positives = 182/202 (90%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCY+EK++ALKKHGLST + FP
Sbjct  303  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKNDKCYEEKLDALKKHGLSTPQCFP  362

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL VSPP M   FEEMA  ASN+TS+K D++YPEIEEDALQ+ILDS
Sbjct  363  VRITGWPMELMAYAYLVVSPPDMRNNFEEMAKRASNKTSTKNDLKYPEIEEDALQFILDS  422

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISK S+FL+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  423  CETSISKCSRFLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  482

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RDIRSGEL+AL++F GLRN FK
Sbjct  483  RDIRSGELKALRLFSGLRNFFK  504



>ref|XP_010464405.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Camelina 
sativa]
Length=507

 Score =   306 bits (785),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/201 (76%), Positives = 182/201 (91%), Gaps = 0/201 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+DKCYKEK++ALKKHGLST + FP
Sbjct  304  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKNDKCYKEKLDALKKHGLSTPQCFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL +SPP M   FEEMA AASN+TS+ KD++YPEIEE+ALQ+ILDS
Sbjct  364  VRITGWPMELMAYAYLVMSPPDMRNSFEEMAKAASNKTSTTKDLKYPEIEEEALQFILDS  423

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE+ ISKY++ L+ SG MDLD+T+PKQLNR+ FLKQLAVDL TSERRIL+RAQYILRRRL
Sbjct  424  CETSISKYTRSLKESGSMDLDITSPKQLNRKAFLKQLAVDLSTSERRILYRAQYILRRRL  483

Query  164  RDIRSGELRALKIFDGLRNLF  102
            RDIRSGEL+AL++F GLRN F
Sbjct  484  RDIRSGELKALRLFTGLRNFF  504



>ref|XP_010088354.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
 gb|EXB34472.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase [Morus notabilis]
Length=527

 Score =   304 bits (779),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/174 (81%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSDSVE+S+S+ KSDKCYK+K+ AL+KHGL  S+R+P
Sbjct  301  SYGKKSNGELLLSYGFVPKEGTNPSDSVELSLSLSKSDKCYKQKLAALRKHGLQVSQRYP  360

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            ++ITGWPLELMAYAYLAVSPPSM+ QF+EMAAAASN+T  KKD+RYPEIEE+ALQ+ILDS
Sbjct  361  IRITGWPLELMAYAYLAVSPPSMSSQFDEMAAAASNKTDIKKDLRYPEIEEEALQFILDS  420

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQY  183
            CES ISKY+KFLQ SG +DLDVT+PKQLNRR+FLKQLAVDLCTSERRILFR QY
Sbjct  421  CESSISKYNKFLQQSGTLDLDVTSPKQLNRRLFLKQLAVDLCTSERRILFRTQY  474



>ref|XP_008802702.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=483

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG NP+DSVE+S+S+ KSDKCYKEK+EAL+K+GLS  +RFP
Sbjct  282  SYGKKSNGELLLSYGFVPKEGANPNDSVELSLSLNKSDKCYKEKLEALQKYGLSMPQRFP  341

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLE+ AYAYL V PP+M++QFEEMAAAASN++ SK  I YPE+EE  LQ++LD 
Sbjct  342  LQITGWPLEMTAYAYLVVCPPNMSQQFEEMAAAASNKSKSKTGINYPELEEQTLQFLLDC  401

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I+KY+KFL+  G  D   TN KQ NR+  LK+LA +LCTSERRIL+R+QY+LRRRL
Sbjct  402  CESSIAKYTKFLEGGGAPDSVPTNAKQANRKSLLKKLATELCTSERRILYRSQYVLRRRL  461

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL +F+G R LFK
Sbjct  462  RDMRSGELRALTLFNGFRKLFK  483



>ref|XP_009391784.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=502

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNP+DSVE+S+S+ KSDKCYKEK+EAL+KHGLST +RFP
Sbjct  300  SYGKKSNGELLLSYGFVPKEGTNPNDSVELSLSLNKSDKCYKEKLEALRKHGLSTPQRFP  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWP+E+MAY+YL VSP +M++ FEEMAAA+SN T+ K  I+ PE+EE ALQ+ILD 
Sbjct  360  LQITGWPVEMMAYSYLVVSPSNMSQHFEEMAAASSNGTALKMGIKNPELEEKALQFILDC  419

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFL+  G  D    + KQ NR+  LK++A DLCTSERRIL+R QYILRRRL
Sbjct  420  CESSISKYSKFLEGGGTPDSGTFSAKQANRKSLLKKMATDLCTSERRILYRTQYILRRRL  479

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL +F+G R LFK
Sbjct  480  RDMRSGELRALTLFNGFRKLFK  501



>ref|XP_008802701.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=501

 Score =   301 bits (772),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 140/202 (69%), Positives = 171/202 (85%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG NP+DSVE+S+S+ KSDKCYKEK+EAL+K+GLS  +RFP
Sbjct  300  SYGKKSNGELLLSYGFVPKEGANPNDSVELSLSLNKSDKCYKEKLEALQKYGLSMPQRFP  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLE+ AYAYL V PP+M++QFEEMAAAASN++ SK  I YPE+EE  LQ++LD 
Sbjct  360  LQITGWPLEMTAYAYLVVCPPNMSQQFEEMAAAASNKSKSKTGINYPELEEQTLQFLLDC  419

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I+KY+KFL+  G  D   TN KQ NR+  LK+LA +LCTSERRIL+R+QY+LRRRL
Sbjct  420  CESSIAKYTKFLEGGGAPDSVPTNAKQANRKSLLKKLATELCTSERRILYRSQYVLRRRL  479

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL +F+G R LFK
Sbjct  480  RDMRSGELRALTLFNGFRKLFK  501



>ref|XP_006857756.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
 gb|ERN19223.1| hypothetical protein AMTR_s00061p00196800 [Amborella trichopoda]
Length=541

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 4/205 (2%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG V REGTNP+DSV+V++SI KSD CY EK+EAL KHGLST +RFP
Sbjct  338  SYGKKSNGELLLSYGFVSREGTNPNDSVDVAMSINKSDPCYVEKVEALMKHGLSTPQRFP  397

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPP+M++Q+EEMAA AS++ +SKK+++YPE+EE ALQ+ILD 
Sbjct  398  LQITGWPLELMAYAYLVVSPPNMSQQYEEMAAVASSKGTSKKNLKYPELEEQALQFILDC  457

Query  344  CESGISKYSKFLQASG---EMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILR  174
            CES ISKY+KFL   G   +  ++++  KQ NR++ L+QLAVDLC+ ERRILFRAQYILR
Sbjct  458  CESSISKYTKFLDGIGSNIDNSIEISR-KQANRKLLLQQLAVDLCSRERRILFRAQYILR  516

Query  173  RRLRDIRSGELRALKIFDGLRNLFK  99
            RRLRD+R+GELRAL I +G R LFK
Sbjct  517  RRLRDMRTGELRALTILNGFRKLFK  541



>gb|KHG10408.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Gossypium arboreum]
Length=451

 Score =   295 bits (754),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 141/191 (74%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSER-F  528
            SYGKKSN ELLLSYG VP++GTN +DSVE+ +S+K SDKCYK+K++AL KHGLS S + +
Sbjct  261  SYGKKSNAELLLSYGFVPKQGTNLNDSVELPLSLKISDKCYKQKLKALMKHGLSASSQCY  320

Query  527  PVQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILD  348
            P+QI+GWPLELMAYAYL VSPPSM++QFEEMAA ASN +  +KD+RYPEIEE ALQ+ILD
Sbjct  321  PIQISGWPLELMAYAYLTVSPPSMSKQFEEMAAMASNESIIRKDLRYPEIEEKALQFILD  380

Query  347  SCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            SCES ISKYSKFL+ SG MDLD+T+ +Q NR VFLKQLAVDLCTSE++IL+RAQY L+RR
Sbjct  381  SCESSISKYSKFLKESGSMDLDITSQEQQNRGVFLKQLAVDLCTSEQKILYRAQYKLKRR  440

Query  167  LRDIRSGELRA  135
            LRD+RSGELRA
Sbjct  441  LRDMRSGELRA  451



>ref|XP_010942848.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942849.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942850.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942851.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
 ref|XP_010942852.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   295 bits (756),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 168/202 (83%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG V +EG NP DSVE+S+ + KSDKCYKEK+EAL+K+GLST +RFP
Sbjct  300  SYGKKSNGELLLSYGFVAKEGANPDDSVELSLPLNKSDKCYKEKLEALQKYGLSTPQRFP  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGW LE+ AYAYL V PP+M++ FEEMAAAASN+++SK  I YPE+EE  LQ++LD 
Sbjct  360  LQITGWSLEMKAYAYLVVCPPNMSQHFEEMAAAASNKSTSKAGINYPELEEQTLQFLLDC  419

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I+KY+KFL+  G  D   TN KQ NR++ LK+LA +LCTSERRIL+R QY+LRRRL
Sbjct  420  CESSIAKYTKFLEGGGAPDSVPTNAKQANRKLLLKKLATELCTSERRILYRTQYVLRRRL  479

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+RSGELRAL IF+G R LFK
Sbjct  480  RDMRSGELRALTIFNGFRKLFK  501



>gb|KJB22703.1| hypothetical protein B456_004G061300 [Gossypium raimondii]
Length=489

 Score =   295 bits (754),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSN ELLLSYG VP+EGTN +DSVE+ +S+K SDKCYK+K++ALKKHGLS S+ + 
Sbjct  300  SYGKKSNAELLLSYGFVPKEGTNLNDSVELPLSLKISDKCYKQKLKALKKHGLSASQCYT  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QI+GWPLELMAYAYL VSPPSM++QFEEMAA ASN +  +KD+RYPEIEE ALQ+ILD+
Sbjct  360  IQISGWPLELMAYAYLTVSPPSMSKQFEEMAAMASNESIIRKDLRYPEIEEKALQFILDN  419

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES ISKYSKFL+ SG MDLD+T+ +  NR VFLKQLAVDLC SE++IL RAQYIL+RRL
Sbjct  420  CESSISKYSKFLKESGSMDLDITSQELQNRGVFLKQLAVDLCISEQKILHRAQYILKRRL  479

Query  164  RDIRSGELRA  135
            RD+RSGELRA
Sbjct  480  RDMRSGELRA  489



>ref|XP_007049386.1| Rubisco methyltransferase family protein [Theobroma cacao]
 gb|EOX93543.1| Rubisco methyltransferase family protein [Theobroma cacao]
Length=927

 Score =   303 bits (777),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 163/174 (94%), Gaps = 2/174 (1%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EGTNPSDSVE+S+S+KKSDKCYKEK+EAL+KHG S    +P
Sbjct  50   SYGKKSNGELLLSYGFVPKEGTNPSDSVELSLSLKKSDKCYKEKLEALRKHGFSQC--YP  107

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSPPSM+ QFEEMAAAASN++++KKD+RYPEIEE ALQ+ILDS
Sbjct  108  IQITGWPLELMAYAYLAVSPPSMSPQFEEMAAAASNKSTTKKDLRYPEIEEKALQFILDS  167

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQY  183
            CES ISKYSKFLQASG MDLDVT+PKQLNR VFLKQLAVDLCTSE+RILFRAQ+
Sbjct  168  CESSISKYSKFLQASGSMDLDVTSPKQLNRGVFLKQLAVDLCTSEQRILFRAQH  221



>ref|NP_001047982.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAD12920.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAD13045.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase [Oryza sativa Japonica Group]
 dbj|BAF09896.1| Os02g0725200 [Oryza sativa Japonica Group]
 dbj|BAG96165.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57721.1| hypothetical protein OsJ_08208 [Oryza sativa Japonica Group]
Length=502

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE+ VS+ KSDKCYKEK++ALK++GLS  E FP
Sbjct  301  SYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQALKRNGLSEFESFP  360

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M+++FEEMA AASN++ SK  + YPE+EE ALQ+ILD 
Sbjct  361  LRVTGWPVELMAYAFLVVSPPEMSQRFEEMAVAASNKSPSKPGLNYPELEEQALQFILDC  420

Query  344  CESGISKYSKFLQ-ASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            CES I+KY+KFL+ +SG + L  TN KQ NR + LKQLA DLC SERRIL+R QYILRRR
Sbjct  421  CESNIAKYTKFLEGSSGSLQLS-TNSKQANRTLLLKQLARDLCISERRILYRTQYILRRR  479

Query  167  LRDIRSGELRALKIFDGLRNLFK  99
            LRD+R GEL+AL +F+GLR LFK
Sbjct  480  LRDMRGGELKALSLFNGLRKLFK  502



>gb|EEC73918.1| hypothetical protein OsI_08761 [Oryza sativa Indica Group]
Length=502

 Score =   289 bits (739),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 172/203 (85%), Gaps = 2/203 (1%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE+ VS+ KSDKCYKEK++ALK++GLS  E FP
Sbjct  301  SYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLNKSDKCYKEKLQALKRNGLSEFESFP  360

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M+++FEEMA AASN++ SK  + YPE+EE ALQ+ILD 
Sbjct  361  LRVTGWPVELMAYAFLVVSPPEMSQRFEEMAVAASNKSPSKPGLNYPELEEQALQFILDC  420

Query  344  CESGISKYSKFLQ-ASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            CES I+KY+KFL+ +SG + L  TN KQ NR + LKQLA DLC SERRIL+R QYILRRR
Sbjct  421  CESNIAKYTKFLEGSSGSLQLS-TNSKQANRTLLLKQLARDLCISERRILYRTQYILRRR  479

Query  167  LRDIRSGELRALKIFDGLRNLFK  99
            LRD+R GEL+AL +F+GLR LFK
Sbjct  480  LRDMRGGELKALSLFNGLRKLFK  502



>ref|XP_002454362.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
 gb|EES07338.1| hypothetical protein SORBIDRAFT_04g029430 [Sorghum bicolor]
Length=499

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 135/202 (67%), Positives = 167/202 (83%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE+ VS+ KSDKCYKEK++ALK++GLS SE FP
Sbjct  298  SYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLDKSDKCYKEKLQALKRNGLSESESFP  357

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M++ FEEMA AASN++SSK  + YP++EE ALQ+ILD 
Sbjct  358  LRVTGWPVELMAYAFLVVSPPDMSQHFEEMAVAASNKSSSKPRLSYPDLEEQALQFILDC  417

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE  I+KY+K+L+  G       N KQ NR + LKQ+A DLC SERRIL+R QYILRRRL
Sbjct  418  CEPNIAKYTKYLEGGGGSPEVSMNAKQANRTLLLKQVARDLCISERRILYRTQYILRRRL  477

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R GELRAL +F+GLR LFK
Sbjct  478  RDMRGGELRALSLFNGLRKLFK  499



>ref|NP_001140387.1| uncharacterized protein LOC100272441 [Zea mays]
 gb|ACF83720.1| unknown [Zea mays]
 gb|AFW63676.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE+ VS+ KSD CYKEK++ALK++GLS SE FP
Sbjct  302  SYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLDKSDNCYKEKLQALKRNGLSESESFP  361

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M++ FEEMAAAASN+TSSK  + YP++EE ALQ+ILD 
Sbjct  362  LRVTGWPVELMAYAFLVVSPPDMSQCFEEMAAAASNKTSSKPGLNYPDLEEQALQFILDC  421

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I KY+K+L+          N KQ NR + LKQLA DLC SERRIL+R QYILRRRL
Sbjct  422  CESNIEKYTKYLEGGAGSPEVPMNAKQANRTLLLKQLARDLCISERRILYRTQYILRRRL  481

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R GELRAL +F+GLR LFK
Sbjct  482  RDMRGGELRALSLFNGLRKLFK  503



>ref|XP_006649004.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like [Oryza brachyantha]
Length=551

 Score =   288 bits (736),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/203 (68%), Positives = 171/203 (84%), Gaps = 2/203 (1%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE+ VS+KKSD+CYKEK++ALK++GLS  E FP
Sbjct  350  SYGKKSSGELLLSYGFVPKEGTNPNDSVELFVSLKKSDECYKEKLQALKRNGLSEFESFP  409

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M+++FEEMA AASN++ SK  + YPE+EE ALQ+ILD 
Sbjct  410  LRVTGWPVELMAYAFLVVSPPEMSQRFEEMAVAASNKSPSKPGLNYPELEEQALQFILDC  469

Query  344  CESGISKYSKFLQ-ASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            CES I+KY+KFL+  SG   L  TN KQ NR + LKQLA DLC SERRI++R QYILRRR
Sbjct  470  CESNIAKYTKFLEDGSGSPRLS-TNSKQANRTLLLKQLAKDLCISERRIMYRTQYILRRR  528

Query  167  LRDIRSGELRALKIFDGLRNLFK  99
            LRD+R GELRAL +F+GLR LFK
Sbjct  529  LRDMRGGELRALSLFNGLRKLFK  551



>gb|ACG45124.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Zea mays]
Length=503

 Score =   286 bits (733),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 137/202 (68%), Positives = 166/202 (82%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE+ VS+ KSD CYKEK++ALK++GLS SE FP
Sbjct  302  SYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLDKSDNCYKEKLQALKRNGLSESESFP  361

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M++ FEEMAAAASN+TSSK  + YP++EE ALQ+ILD 
Sbjct  362  LRVTGWPVELMAYAFLVVSPPDMSQCFEEMAAAASNKTSSKPGLNYPDLEEQALQFILDC  421

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I KY+K+L+          N KQ NR + LKQLA DLC SERRIL+R QYILRRRL
Sbjct  422  CESNIEKYTKYLEGGAGSPEVPMNAKQANRTLLLKQLARDLCISERRILYRTQYILRRRL  481

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R GELRAL +F+GLR LFK
Sbjct  482  RDMRGGELRALSLFNGLRKLFK  503



>dbj|BAJ90575.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=507

 Score =   286 bits (732),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 173/204 (85%), Gaps = 3/204 (1%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE  VS+KKSD+CYKEK++ALKKHGLS SE FP
Sbjct  305  SYGKKSSGELLLSYGFVPKEGTNPNDSVEFLVSLKKSDECYKEKLQALKKHGLSESESFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M ++FEEMA AASN+ SSK  + YPE++E ALQ+ILD 
Sbjct  365  LRVTGWPVELMAYAFLVVSPPEMIQRFEEMAVAASNKGSSKPAVNYPELDEQALQFILDC  424

Query  344  CESGISKYSKFLQ-ASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            CES I +Y+K+L+ A G  ++ + N KQ NR + LKQLA DLC SERRIL+R+QYILRRR
Sbjct  425  CESSIKRYTKYLEGAKGSAEVSI-NTKQANRTLLLKQLARDLCISERRILYRSQYILRRR  483

Query  167  LRDIRS-GELRALKIFDGLRNLFK  99
            LRD+R+ GEL+AL +F+GLRNLFK
Sbjct  484  LRDMRAGGELKALSLFNGLRNLFK  507



>ref|XP_004953752.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X1 [Setaria italica]
 ref|XP_004953753.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X2 [Setaria italica]
 ref|XP_004953754.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic-like isoform 
X3 [Setaria italica]
Length=503

 Score =   286 bits (731),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 136/202 (67%), Positives = 165/202 (82%), Gaps = 0/202 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE+ VS+ KSDKCYKEK++ALK++GLS SE FP
Sbjct  302  SYGKKSSGELLLSYGFVPKEGTNPNDSVELLVSLDKSDKCYKEKLQALKRNGLSASESFP  361

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M+++FEEMA AASN+ SSK    YPE+EE ALQ+ILD 
Sbjct  362  LRVTGWPVELMAYAFLVVSPPDMSQRFEEMAIAASNKNSSKPGFNYPELEEQALQFILDC  421

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I+KY+K+L+          N KQ NR + LKQLA  LC SERRIL+R QYILRRRL
Sbjct  422  CESNIAKYTKYLEGGNGSPQVSINAKQANRTLLLKQLANKLCISERRILYRTQYILRRRL  481

Query  164  RDIRSGELRALKIFDGLRNLFK  99
            RD+R GELRAL +F+GLR LFK
Sbjct  482  RDMRGGELRALSLFNGLRKLFK  503



>ref|XP_010236007.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic [Brachypodium 
distachyon]
Length=506

 Score =   283 bits (723),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 167/203 (82%), Gaps = 1/203 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE SVS+ KSD CY+EK++ALK+HGLS SE FP
Sbjct  304  SYGKKSSGELLLSYGFVPKEGTNPNDSVEFSVSLNKSDDCYREKLQALKRHGLSESESFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M ++FEEMA AASN++SSK  + YPE++E ALQ+ILD 
Sbjct  364  LRVTGWPVELMAYAFLVVSPPDMIQRFEEMAVAASNKSSSKPAVNYPELDEQALQFILDC  423

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CES I+KY+K+L+ +        N KQ NR + LKQLA DLC SERRIL+RAQYILRRRL
Sbjct  424  CESNITKYTKYLEGAKGSPQVSINSKQANRTLLLKQLARDLCISERRILYRAQYILRRRL  483

Query  164  RDIRS-GELRALKIFDGLRNLFK  99
            RD+R+ GEL+AL +F GLR  FK
Sbjct  484  RDMRAGGELKALSLFSGLRKFFK  506



>gb|EMT07134.1| hypothetical protein F775_17280 [Aegilops tauschii]
Length=579

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 161/194 (83%), Gaps = 2/194 (1%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE  VS+ KSD+CYKEK++ALKKHGLS SE FP
Sbjct  322  SYGKKSSGELLLSYGFVPKEGTNPNDSVEFLVSLNKSDECYKEKLQALKKHGLSESESFP  381

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M + FEEMA AASN+ SSK  + YPE++E+ALQ+ILD 
Sbjct  382  LRVTGWPVELMAYAFLVVSPPEMIQCFEEMAVAASNKGSSKPALNYPELDEEALQFILDC  441

Query  344  CESGISKYSKFLQ-ASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            CES I KY+K+L+ A G  ++ + N KQ NR + LKQLA DLC SERRIL+R+QYILRRR
Sbjct  442  CESSIKKYTKYLEGAKGSAEVSI-NTKQANRTLLLKQLARDLCISERRILYRSQYILRRR  500

Query  167  LRDIRSGELRALKI  126
            LRD+R+G+ RA  +
Sbjct  501  LRDMRAGDARAFAL  514



>gb|EMS68033.1| Ribulose-1,5 bisphosphate carboxylase/oxygenase large subunit 
N-methyltransferase, chloroplastic [Triticum urartu]
Length=509

 Score =   246 bits (629),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 152/192 (79%), Gaps = 5/192 (3%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKS+GELLLSYG VP+EGTNP+DSVE  VS+ KSD+CYKEK++ALKKHGLS SE FP
Sbjct  304  SYGKKSSGELLLSYGFVPKEGTNPNDSVEFLVSLNKSDECYKEKLQALKKHGLSESESFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++TGWP+ELMAYA+L VSPP M ++FEEMA AASN+ SSK  + YPE++E ALQ+ILD 
Sbjct  364  LRVTGWPVELMAYAFLVVSPPEMIQRFEEMAVAASNKGSSKPALNYPELDEQALQFILDC  423

Query  344  CESGISKYSKFLQ-ASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            CES I KY+K+L+ A G  ++ + N KQ NR + LKQLA DLC SERRIL+R+QY    +
Sbjct  424  CESSIKKYTKYLEGAKGSAEVSI-NTKQANRTLLLKQLARDLCISERRILYRSQYF---Q  479

Query  167  LRDIRSGELRAL  132
                 +GELR L
Sbjct  480  FHHPVAGELRCL  491



>ref|XP_007049385.1| Rubisco methyltransferase family protein, putative [Theobroma 
cacao]
 gb|EOX93542.1| Rubisco methyltransferase family protein, putative [Theobroma 
cacao]
Length=228

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 123/168 (73%), Positives = 140/168 (83%), Gaps = 12/168 (7%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG  P+EGTNPSDSVE+ +S+KKSDKCYKEK+EAL+KHGLS S+ +P
Sbjct  6    SYGKKSNGELLLSYGFAPKEGTNPSDSVELPLSLKKSDKCYKEKLEALRKHGLSASQCYP  65

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAY              MAAAASN++ +KKD+RYPEIEE A Q+ILDS
Sbjct  66   IQITGWPLELMAYAY------------LAMAAAASNKSITKKDLRYPEIEEKARQFILDS  113

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRI  201
            CES ISKYSKFLQA G MDLDVT+PKQLNRRVF+KQLAVDLCT  R +
Sbjct  114  CESSISKYSKFLQACGSMDLDVTSPKQLNRRVFMKQLAVDLCTKVRAV  161



>gb|AFK34799.1| unknown [Lotus japonicus]
Length=132

 Score =   222 bits (566),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = -3

Query  494  MAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDSCESGISKYSK  315
            MAYAYLAVSP SM  QFE+MAAAASN+ +S KD +YPEIEE ALQ+ILDSCES ISKY+K
Sbjct  1    MAYAYLAVSPSSMRGQFEKMAAAASNKITSTKDFKYPEIEEQALQFILDSCESSISKYNK  60

Query  314  FLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRLRDIRSGELRA  135
            FLQASG +DLDVT+PKQLNRR+FLK+LAVDLCTSERRIL+RAQYILRR+LRD+R GELRA
Sbjct  61   FLQASGSLDLDVTSPKQLNRRLFLKRLAVDLCTSERRILYRAQYILRRQLRDMRDGELRA  120

Query  134  LKIFDGLRNLFK  99
             K+FDG+RN FK
Sbjct  121  FKLFDGVRNFFK  132



>gb|KDO50963.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=442

 Score =   228 bits (581),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNPSDSVE+ +S+KKSDKCYKEK+EAL+K+GLS SE FP
Sbjct  305  SYGKKSNGELLLSYGFVPREGTNPSDSVELPLSLKKSDKCYKEKLEALRKYGLSASECFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYL VSPPSM  +FEEMAAAASN+ +SKKDI+ PEI+E ALQ+ILDS
Sbjct  365  IQITGWPLELMAYAYLVVSPPSMKGKFEEMAAAASNKMTSKKDIKCPEIDEQALQFILDS  424

Query  344  CESGISKYSKFLQA  303
            CES ISKYS+FLQ 
Sbjct  425  CESSISKYSRFLQV  438



>ref|XP_006297498.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
 gb|EOA30396.1| hypothetical protein CARUB_v10013517mg [Capsella rubella]
Length=498

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSNGELLLSYG VPREGTNPSDSVE+++S++K+D+CYKEK++ALKKHGLST + FP
Sbjct  304  SYGNKSNGELLLSYGFVPREGTNPSDSVELALSLRKTDECYKEKLDALKKHGLSTPQCFP  363

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            V+ITGWP+ELMAYAYL VSPP M   FEEMA AASN+TS+K D++YPEIEE+ALQYILDS
Sbjct  364  VRITGWPMELMAYAYLVVSPPDMRNSFEEMAKAASNKTSTKNDLKYPEIEEEALQYILDS  423

Query  344  CESGISKYSKFLQAS  300
            CE+ ISKYS+FL+ +
Sbjct  424  CETSISKYSRFLKVN  438



>gb|KJB10233.1| hypothetical protein B456_001G190900 [Gossypium raimondii]
Length=483

 Score =   220 bits (560),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VP+EG NPSDSVE+ +S+KKSDKCYKEK+EAL+KHGLSTS+ +P
Sbjct  357  SYGKKSNGELLLSYGFVPKEGANPSDSVELPLSLKKSDKCYKEKLEALRKHGLSTSQCYP  416

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGWPLELMAYAYLAVSPPSM++QF+E+AAAASN+++ KKD+RYP+IEE ALQ+ILDS
Sbjct  417  IQITGWPLELMAYAYLAVSPPSMSKQFDEIAAAASNKSTIKKDLRYPDIEEKALQFILDS  476

Query  344  CESGISK  324
            CES ISK
Sbjct  477  CESSISK  483



>ref|XP_010942853.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Elaeis 
guineensis]
Length=434

 Score =   203 bits (517),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG V +EG NP DSVE+S+ + KSDKCYKEK+EAL+K+GLST +RFP
Sbjct  300  SYGKKSNGELLLSYGFVAKEGANPDDSVELSLPLNKSDKCYKEKLEALQKYGLSTPQRFP  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGW LE+ AYAYL V PP+M++ FEEMAAAASN+++SK  I YPE+EE  LQ++LD 
Sbjct  360  LQITGWSLEMKAYAYLVVCPPNMSQHFEEMAAAASNKSTSKAGINYPELEEQTLQFLLDC  419

Query  344  CESGISKYSKFLQAS  300
            CES I+KY+KFL+ S
Sbjct  420  CESSIAKYTKFLEVS  434



>ref|XP_010942854.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X3 [Elaeis 
guineensis]
Length=434

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG V +EG NP DSVE+S+ + KSDKCYKEK+EAL+K+GLST +RFP
Sbjct  300  SYGKKSNGELLLSYGFVAKEGANPDDSVELSLPLNKSDKCYKEKLEALQKYGLSTPQRFP  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +QITGW LE+ AYAYL V PP+M++ FEEMAAAASN+++SK  I YPE+EE  LQ++LD 
Sbjct  360  LQITGWSLEMKAYAYLVVCPPNMSQHFEEMAAAASNKSTSKAGINYPELEEQTLQFLLDC  419

Query  344  CESGISKYSKFLQA  303
            CES I+KY+KFL+ 
Sbjct  420  CESSIAKYTKFLEG  433



>gb|KDO50964.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=397

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 83/90 (92%), Gaps = 0/90 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNPSDSVE+ +S+KKSDKCYKEK+EAL+K+GLS SE FP
Sbjct  305  SYGKKSNGELLLSYGFVPREGTNPSDSVELPLSLKKSDKCYKEKLEALRKYGLSASECFP  364

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEM  435
            +QITGWPLELMAYAYL VSPPSM  +FEE+
Sbjct  365  IQITGWPLELMAYAYLVVSPPSMKGKFEEV  394



>ref|XP_011100518.1| PREDICTED: ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplastic isoform X2 [Sesamum 
indicum]
Length=403

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%), Gaps = 0/90 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGKKSNGELLLSYG VPREGTNP DSVE+S+S+KKSDKCYKEK+EALKKHGLS S+ FP
Sbjct  307  SYGKKSNGELLLSYGFVPREGTNPRDSVELSLSLKKSDKCYKEKLEALKKHGLSASQCFP  366

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEM  435
            +QITGWP+ELMAYAYL VSPPSM  +F+E 
Sbjct  367  IQITGWPVELMAYAYLTVSPPSMKNRFDEW  396



>ref|XP_002974548.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
 gb|EFJ24068.1| hypothetical protein SELMODRAFT_101776 [Selaginella moellendorffii]
Length=467

 Score =   140 bits (353),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 74/189 (39%), Positives = 120/189 (63%), Gaps = 5/189 (3%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGK+SNGELL++YG VP  G N  DSV +++ +  +D+ Y+ K+ ALK+HGLS  + +P
Sbjct  267  SYGKRSNGELLVAYGFVP-SGKNSEDSVSITLGLDPADEMYEAKLGALKEHGLSPQQSYP  325

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSK-KDIRYPEIEEDALQYILD  348
            +++ GWP++L A+A L  SPPS   ++ E+ +AA+ +   + + +   E +  A + IL 
Sbjct  326  IKLKGWPVQLTAFARLITSPPSQLHRYSELTSAATEKQGRRMQPVFTTEEQMKAYEMILS  385

Query  347  SCESGISKYSKFLQA-SGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRR  171
            +C+  I+    +L+   G +   +   K++ R   L +LA  LC SE +IL+R +YILR 
Sbjct  386  ACKQAIAASKNYLEVEQGIVSFQLI--KEVPRHGSLPKLASALCESELKILYRNEYILRS  443

Query  170  RLRDIRSGE  144
             LRD+RSG+
Sbjct  444  ELRDLRSGK  452



>ref|XP_002963244.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
 gb|EFJ35115.1| hypothetical protein SELMODRAFT_80789 [Selaginella moellendorffii]
Length=467

 Score =   136 bits (343),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/188 (39%), Positives = 118/188 (63%), Gaps = 3/188 (2%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGK+SNGELL++YG VP  G N  DSV +++ +  +D+ Y+ K+  LK+HGLS  + +P
Sbjct  267  SYGKRSNGELLVAYGFVP-SGKNSEDSVSITLGLDPADEMYEAKLGTLKEHGLSPQQSYP  325

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSK-KDIRYPEIEEDALQYILD  348
            +++ GWP++L A+A L  SPPS   ++ E+A+AA+     + + +   E +  A + IL 
Sbjct  326  IKLKGWPVQLTAFARLITSPPSQLHRYSELASAATEEQGRRMQPVFTTEEQMKAYELILS  385

Query  347  SCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRR  168
            +C+  I+    +L+    + L     K++ R   L +LA  LC SE +IL+R +YILR  
Sbjct  386  ACKQAIAASKNYLEVEQGIVL-FRLIKEVPRHGSLPKLASALCESELKILYRNEYILRSE  444

Query  167  LRDIRSGE  144
            LR++RSG+
Sbjct  445  LRNLRSGK  452



>ref|XP_001754252.1| predicted protein [Physcomitrella patens]
 gb|EDQ80702.1| predicted protein, partial [Physcomitrella patens]
Length=431

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 110/181 (61%), Gaps = 7/181 (4%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYGK+S+GEL L+YG +P E  N  DSVE+ + I   D  ++ K+ A  + GLS+ +RFP
Sbjct  242  SYGKRSSGELFLAYGFIPSE-LNVHDSVELEMEIDSDDPSFEAKLRAANEQGLSSPQRFP  300

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKD------IRYPEIEEDAL  363
            V+  G+P +L+AYA L  S  S   Q   +A AA+   +++KD      +   E E +A 
Sbjct  301  VRKDGFPAQLLAYARLIASRTSDPAQLSRIARAATEANATEKDDSDVIAMLSAEEETNAY  360

Query  362  QYILDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQY  183
            + +L  CE+ I++Y+KFL+ S        +  +++R   L+QLAV LC +E+R+LFR Q+
Sbjct  361  ERVLAVCENSIAEYTKFLEVSPTRINHQKSVTRVSRTRMLQQLAVSLCKNEQRMLFRLQH  420

Query  182  I  180
            +
Sbjct  421  V  421



>gb|KDO50965.1| hypothetical protein CISIN_1g010607mg [Citrus sinensis]
Length=359

 Score = 99.4 bits (246),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLS  543
            SYGKKSNGELLLSYG VPREGTNPSDSVE+ +S+KKSDKCYKEK+EAL+K+GLS
Sbjct  305  SYGKKSNGELLLSYGFVPREGTNPSDSVELPLSLKKSDKCYKEKLEALRKYGLS  358



>ref|XP_002508524.1| set domain protein [Micromonas sp. RCC299]
 gb|ACO69782.1| set domain protein [Micromonas sp. RCC299]
Length=425

 Score = 85.5 bits (210),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 64/208 (31%), Positives = 105/208 (50%), Gaps = 20/208 (10%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG + + ELL+SYG  P  G NP D  EV + I  +D+    K +AL++ GLS  E FP
Sbjct  214  SYGPRPSSELLISYGFAPAVGENPDDEFEVVLGIDPNDRHADAKADALRRIGLSPVEAFP  273

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAA--SNRT-------------SSKKDIR  390
            +++ G+P +L+ YA  A+  P   ++   +A  A   NR               ++ ++ 
Sbjct  274  LKLNGYPKQLLQYASFALCDPDDPKELPGLAEKALIGNRAVGGLLGAITKGKRGTQGEVL  333

Query  389  YPEIEEDALQYIL-DSCESGISKYSKFLQASGEMDL-DVTNP--KQL-NRRVFLKQLAVD  225
                 E A++ +L D     +SKY   L+   E+   D T P  KQ   ++ FL +L   
Sbjct  334  GGVAGEIAVRELLADITSDALSKYPNTLEKDREIATSDPTKPAGKQAKKKKSFLAELRGP  393

Query  224  LCTSERRILFRAQYILRRRLRDIRSGEL  141
            +  SERRIL +    +R +LR +++ ++
Sbjct  394  VRVSERRILAKTDSEVRLQLRKLKASQM  421



>tpg|DAA58352.1| TPA: hypothetical protein ZEAMMB73_556117 [Zea mays]
Length=270

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -3

Query  494  MAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDSCESGI  330
            MAYA+L VSPP M++ FEEMAAA SN+TSSK  + YP +EE  LQ+ILD CES I
Sbjct  1    MAYAFLVVSPPDMSQCFEEMAAAKSNKTSSKPGLNYPGLEEQTLQFILDCCESNI  55



>ref|XP_003057276.1| set domain protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH58921.1| set domain protein, partial [Micromonas pusilla CCMP1545]
Length=308

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/94 (38%), Positives = 56/94 (60%), Gaps = 0/94 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG++ + ELL+SYG  P  G NP D  E+++ I  +D+    K  AL+K GL   E FP
Sbjct  215  SYGQRPSAELLISYGFAPEVGENPDDEYEITLGIDPNDRYADAKAAALEKIGLRPVESFP  274

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAA  423
            +++ G+P +L+ YA  A+  P   ++ E +A  A
Sbjct  275  LRLNGYPKQLLQYASFALCDPDDPKELEGLAEKA  308



>ref|XP_005850299.1| hypothetical protein CHLNCDRAFT_142047 [Chlorella variabilis]
 gb|EFN58197.1| hypothetical protein CHLNCDRAFT_142047 [Chlorella variabilis]
Length=485

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/201 (27%), Positives = 101/201 (50%), Gaps = 27/201 (13%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+K++GELLLSYG  P  G+NP D   + + +   D     K  AL++HGL+ S+ FP
Sbjct  288  SYGQKTSGELLLSYGFCPDLGSNPHDGCRLLLELAPGDAARNWKAAALRQHGLAASQLFP  347

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++   P EL+ Y   + +     ++ E++A     R   + DI  P ++  AL+ ++ +
Sbjct  348  LRMAAAPFELVHYTAFSAAVVGSRQEAEQLA----RRLFEEGDI-PPALQTAALEAVVAA  402

Query  344  CESGISKYSK-FLQASGEMD----------------LDVTNPKQLNRRVFLKQLAVDLCT  216
            C++ ++ Y + F     E+D                    +  Q  RR  L+ +      
Sbjct  403  CKAALAAYPRSFDGDRAELDRLQDQASAAAASGGAGDGSADAGQQRRRHALQAV-----V  457

Query  215  SERRILFRAQYILRRRLRDIR  153
             ER++L R  ++L++ L+D++
Sbjct  458  YERQVLSRTVFVLQQELKDVQ  478



>ref|XP_003081307.1| putative methyltransferase (ISS) [Ostreococcus tauri]
Length=505

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG++ + ELL+SYG  P  G NP D   +++ +  +D   + K + L++ GLS  E FP
Sbjct  282  SYGQRPSSELLISYGFAPEVGENPDDEYSLTLGVDVNDPYAQAKADVLRRMGLSPVETFP  341

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAA  423
            +++ G+P +L+ YA   +  P    + E +A  A
Sbjct  342  LRLNGYPRQLLQYASFILCNPDKPSELEGLARTA  375



>emb|CEF99133.1| Rubisco LS methyltransferase, substrate-binding domain [Ostreococcus 
tauri]
Length=531

 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG++ + ELL+SYG  P  G NP D   +++ +  +D   + K + L++ GLS  E FP
Sbjct  308  SYGQRPSSELLISYGFAPEVGENPDDEYSLTLGVDVNDPYAQAKADVLRRMGLSPVETFP  367

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAA  423
            +++ G+P +L+ YA   +  P    + E +A  A
Sbjct  368  LRLNGYPRQLLQYASFILCNPDKPSELEGLARTA  401



>ref|XP_007510589.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18122.1| predicted protein [Bathycoccus prasinos]
Length=543

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 56/105 (53%), Gaps = 0/105 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG++ + ELL+SYG  P  G NP D   +++ I + D     K+ AL    +   E FP
Sbjct  315  SYGQRPSSELLISYGFAPAVGDNPDDEYALNLQIDEEDPFASAKVNALASQNIQAFETFP  374

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIR  390
            +++ G+P +L+ YA  A+  P    + +E+  AA     + K +R
Sbjct  375  LRLNGYPRQLLQYASFAMCTPDDPSKVDELCRAAFVDIQAPKSLR  419



>ref|XP_001419603.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97896.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=524

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/94 (33%), Positives = 53/94 (56%), Gaps = 0/94 (0%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG++ + ELL+SYG  P  G NP D   +++ +  +D     K + L+  GLS  E FP
Sbjct  299  SYGQRPSSELLISYGFAPEVGENPDDEYALTLGVDVNDPLADAKAQVLRDMGLSPVETFP  358

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAA  423
            +++ G+P +L+ YA   +  P    + + +A +A
Sbjct  359  LRLNGYPRQLLQYASFILCNPEKPSELKGLAQSA  392



>gb|KIZ05290.1| hypothetical protein MNEG_2664 [Monoraphidium neglectum]
Length=449

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 91/183 (50%), Gaps = 22/183 (12%)
 Frame = -3

Query  692  KSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFPVQIT  513
            + NGELLL +G V  +  N SD +  + S+ ++DK Y+ K + L+  G+S+ ERFPV   
Sbjct  237  RPNGELLLCFGTV--QDNNLSDFLLFNASLVRADKYYQSKQQLLQAMGMSSEERFPVYAD  294

Query  512  GWPLELMAYAYLA-VSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEE-DALQYILDSCE  339
             +P++L+AY  L+ +  P++             + S   D+   ++ E + LQ ++  C 
Sbjct  295  KFPIQLLAYLRLSRIQDPAL-----------FAKASFDSDVVVTQMNEYEVLQLLMGDCR  343

Query  338  SGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRLRD  159
              ++ Y    + S E ++       L+      +LA  L   E+RIL +    +RR+L  
Sbjct  344  ERLAAY----KTSMEEEIKALQSPDLSGTA---RLAARLRMGEKRILSQFMDAVRRKLAP  396

Query  158  IRS  150
            +R 
Sbjct  397  VRG  399



>ref|XP_001690988.1| lysine N-methylase [Chlamydomonas reinhardtii]
 gb|EDP05434.1| lysine N-methylase [Chlamydomonas reinhardtii]
Length=563

 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 49/95 (52%), Gaps = 3/95 (3%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKS---DKCYKEKMEALKKHGLSTSE  534
            SYG KS+GELLLSYG  P    NP    ++ V +  S   D     K E L KHGL  S 
Sbjct  323  SYGPKSSGELLLSYGFCPPPAANPHQDYKLLVGVNDSAAADPLAALKAEVLAKHGLPPSL  382

Query  533  RFPVQITGWPLELMAYAYLAVSPPSMNRQFEEMAA  429
             FP+++ G P  L+ Y     + P + ++  ++ +
Sbjct  383  EFPLKLEGLPAGLLNYLAFVEAAPQVPQELHDLGS  417



>ref|XP_005649983.1| ResB-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE25439.1| ResB-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=889

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 85/187 (45%), Gaps = 22/187 (12%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG+KS+ +LLLSYG +P   +NP  +  + +S+++ D C+  K   L++ G S    FP
Sbjct  220  SYGQKSDTQLLLSYGFMPAPLSNPHSACNLRLSLQRDDPCFDAKRALLEEAGHSACMEFP  279

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +++   P +L+ YA    +     R   ++        S++K          A+  I   
Sbjct  280  LRLDSLPQKLINYAAFLCTEAPDRRVVSQIDQTGVVDGSARK---------GAINLITKE  330

Query  344  CESGISKYSKFLQASGE---------MDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFR  192
            C+  ++     L A  E            D+ N   L RR  + ++ ++    ER+IL +
Sbjct  331  CKVALTAIPATLAADQEALNNIMAQLAGKDILNVTSLQRRADILKVRIN----ERKILNK  386

Query  191  AQYILRR  171
              + LR+
Sbjct  387  NLFTLRQ  393



>ref|XP_002947838.1| hypothetical protein VOLCADRAFT_88145 [Volvox carteri f. nagariensis]
 gb|EFJ50826.1| hypothetical protein VOLCADRAFT_88145 [Volvox carteri f. nagariensis]
Length=508

 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/90 (39%), Positives = 50/90 (56%), Gaps = 2/90 (2%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSI-KKSDKCYKEKMEALKKHGLSTSERF  528
            SYG KS+GELLLSYG  P   +NP     + V++ ++ D     K +AL +HGL +   F
Sbjct  265  SYGPKSSGELLLSYGFCPPPASNPHQDCRLRVAVDRQGDPLADLKEQALARHGLPSELEF  324

Query  527  PVQITGWPLELMAY-AYLAVSPPSMNRQFE  441
            P+++ G P  L+ Y A+L   P      FE
Sbjct  325  PLKLEGIPEGLLQYLAFLDARPKVAQETFE  354



>ref|XP_001696900.1| rubisco small subunit N-methyltransferase [Chlamydomonas reinhardtii]
 gb|EDP00592.1| rubisco small subunit N-methyltransferase [Chlamydomonas reinhardtii]
Length=411

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/183 (28%), Positives = 90/183 (49%), Gaps = 22/183 (12%)
 Frame = -3

Query  692  KSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFPVQIT  513
            + NGELLL+ G +  +  N SD +     +  +D+ Y  K + L+  G S +E FPV   
Sbjct  190  RPNGELLLATGTL--QDNNSSDFLSWPAGLVPADRYYMMKSQVLESMGYSAAEEFPVYAD  247

Query  512  GWPLELMAYAYLA-VSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEE-DALQYILDSCE  339
              P++L+AY  L+ V+ P++             + + + D+   ++ E + LQ ++  C 
Sbjct  248  RMPIQLLAYLRLSRVADPAL-----------LAKCTFEADVELSQMNEYEILQILMGDCR  296

Query  338  SGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRLRD  159
              ++ Y+K    S E D+ +     L+ +   ++LAV L   E+RI+      +RRRL  
Sbjct  297  ERLASYTK----SYEEDVKIAQQSDLSPK---ERLAVKLRLGEKRIINATMEAVRRRLAP  349

Query  158  IRS  150
            IR 
Sbjct  350  IRG  352



>ref|XP_005719244.1| unnamed protein product [Chondrus crispus]
 emb|CDF39333.1| unnamed protein product [Chondrus crispus]
Length=464

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 48/79 (61%), Gaps = 2/79 (3%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            +YG KSNG+LLL YG +     NP DSVE+ V++   D+ ++ K + L + G+ T+  FP
Sbjct  290  TYGPKSNGDLLLLYGFI--TDRNPYDSVELVVALSDEDELFERKKKYLDESGVGTTATFP  347

Query  524  VQITGWPLELMAYAYLAVS  468
            +    +P+EL+ +    V+
Sbjct  348  LYSDRYPMELIEFLRFCVA  366



>ref|XP_005705388.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Galdieria sulphuraria]
 gb|EME28868.1| ribulose-1,5-bisphosphate carboxylase/oxygenase small subunit 
N-methyltransferase I [Galdieria sulphuraria]
Length=490

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 56/108 (52%), Gaps = 4/108 (4%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG +SN ELLL YG       NP D VE+++ + K+D  Y EK   L+ +G S  + FP
Sbjct  326  SYGPRSNQELLLLYGFSLER--NPFDCVEITIGLDKTDPLYLEKCRMLESYGKSPLQSFP  383

Query  524  VQITGWPLELMAYAYLAV--SPPSMNRQFEEMAAAASNRTSSKKDIRY  387
            + +  +P+E+  +       +   +   F  + +A++  ++  K + Y
Sbjct  384  LYMDRYPVEMAEFLRFCCIDTETDLQADFGTIVSASNEESALDKLLNY  431



>ref|XP_001712247.1| met [Hemiselmis andersenii]
 gb|ABW97922.1| met [Hemiselmis andersenii]
Length=464

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 46/159 (29%), Positives = 80/159 (50%), Gaps = 14/159 (9%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            +YG+K+N ELLL YG +     NP DS+E+ +S+   D  +++K + + +   ++   FP
Sbjct  302  TYGQKTNLELLLLYGFILER--NPFDSIELRISLSDKDSFFEKKKQFMIECEKTSEITFP  359

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +    +P EL  +    +S        EE+ +   +  +   +  Y EIE+   + +L S
Sbjct  360  IFYYKYPKELYEFLRFCISNQ------EELGSTDLSDFNFNDENNY-EIEKIIRKLVLFS  412

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQL---NRRVFLKQ  237
            CE  +  YSK  + S E  L+  N   L   N+++ LKQ
Sbjct  413  CEKLLKNYSK--KVSEEKILNSLNSNFLISKNQKMALKQ  449



>gb|EWM24078.1| ribulose- -bisphosphate carboxylase oxygenase small subunit n-methyltransferase 
i [Nannochloropsis gaditana]
Length=647

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 51/187 (27%), Positives = 87/187 (47%), Gaps = 12/187 (6%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG KSN +LLL YG       NP +SV+++V++   D  ++EK   L +      E FP
Sbjct  465  SYGPKSNADLLLLYGFC--LDRNPFNSVDLTVALLPDDPLFEEKRAFLAQAERREKEAFP  522

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEEDALQYILDS  345
            +    +P EL  Y  L      +    E+M   A         I   E E  A+  I  +
Sbjct  523  LFADRYPNELFEYLRL------VYLTKEDMGGRALREMEFTDPISL-ENELAAMASIEGA  575

Query  344  CESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILRRRL  165
            CE  ++ YS   +    +   + + K  N     +++A+    SE+R+L +    ++++L
Sbjct  576  CEEALASYSTKEEDDARL---INDSKLFNMFPKTQRMAIKHRRSEKRLLKKTAAAVKQQL  632

Query  164  RDIRSGE  144
             ++RSG+
Sbjct  633  LNLRSGK  639



>ref|XP_005537343.1| similar to ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplast precursor [Cyanidioschyzon 
merolae strain 10D]
 dbj|BAM81307.1| similar to ribulose-1,5 bisphosphate carboxylase/oxygenase large 
subunit N-methyltransferase, chloroplast precursor [Cyanidioschyzon 
merolae strain 10D]
Length=567

 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 60/193 (31%), Positives = 88/193 (46%), Gaps = 23/193 (12%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTS----  537
            SYG+KSN ELLL YG V     NP +SVEV VS+  S+      ++  +   L+      
Sbjct  388  SYGQKSNAELLLLYGFV--SDRNPYNSVEVCVSLSGSEAAGAGLLDRKRSFLLACGRDPD  445

Query  536  --ERFPVQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYP---EIEE  372
              E FP+    +PLELM     A    S+  Q      AA      + D+  P   E E 
Sbjct  446  KPECFPLYADRYPLELMQLLRFA----SLTEQ-----DAAGYSDLEQIDVAQPVNRENEI  496

Query  371  DALQYILDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFR  192
             A   +L +C+  +  Y            D +  + L+R+   ++L+V L  SE+RIL R
Sbjct  497  AAKSALLQACKIALQAYPTSADEDDAALKDKSMAQLLSRK---QRLSVRLRRSEKRILER  553

Query  191  AQYILRRRLRDIR  153
                L R ++D+R
Sbjct  554  TIAGLEREIQDLR  566



>gb|AFW65498.1| hypothetical protein ZEAMMB73_874532 [Zea mays]
Length=450

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = -3

Query  539  SERFPVQITGWPLELMAYAYLAVSPPSMNRQFEE  438
            SE FP+ +TGW +ELMAYA+L VSPP M++ FE+
Sbjct  201  SESFPLWVTGWSVELMAYAFLVVSPPDMSQCFED  234



>gb|KDO67843.1| hypothetical protein CISIN_1g0127291mg, partial [Citrus sinensis]
Length=199

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 56/189 (30%), Positives = 82/189 (43%), Gaps = 28/189 (15%)
 Frame = -3

Query  704  SYGKKSNGELLLSYG-XVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGL------  546
            +YGK SN  LLL +G  +P    N  D V++ + +   D   + K+E L+ H L      
Sbjct  4    TYGKFSNSTLLLDFGFSLP---YNSHDEVQIQIKVPDHDPLLEVKLEVLQSHCLPRARDV  60

Query  545  ----STSERFPVQIT--------GWPLELMAYA-YLAVSPPSMNRQFEEMAAAASNRTSS  405
                S+++ F ++          G P  L A+A  L  + P         AA    R + 
Sbjct  61   NGFKSSNDSFTIKEVRSARGRGKGLPQSLRAFARVLCCTSPQELCDLATEAAQNDGRLA-  119

Query  404  KKDIRYPEIEEDALQYILDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVD  225
            ++  R    E  A Q +L    S I + +K   AS E+   VT+P    R  F KQ+A D
Sbjct  120  RRPFRNSRQEILAHQILL----SHIIQLTKEYSASIELLEPVTSPSICKRLAFRKQMARD  175

Query  224  LCTSERRIL  198
            L   E RIL
Sbjct  176  LLIGELRIL  184



>ref|XP_011449702.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Crassostrea 
gigas]
Length=504

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 82/179 (46%), Gaps = 19/179 (11%)
 Frame = -3

Query  701  YGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFPV  522
            YG +SN ELL+  G V  E  N  D + + + I K D  Y++K E LKK GLS    F +
Sbjct  318  YGARSNAELLIHNGFVYPE--NELDRIAIRLGISKGDPLYEQKNELLKKLGLSVLRNFYI  375

Query  521  QITGWPLELMAYAYLAVSPPSMNRQFE----EMAAAASNRTSSKKDIRYP---EIEEDAL  363
                 P++    A+L V   S     E    E++ A ++R     DI  P   E EE A 
Sbjct  376  HTGMIPVDPQLMAFLRVFCMSEENLKELNSKELSEADADRLG---DIDVPVSEENEEKAW  432

Query  362  QYILDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQ  186
             ++       +  Y    + S E D+++   + +N     ++LAV L   E+RIL   Q
Sbjct  433  AFLQTRTALLLRAY----ETSEEEDIELLKKEDMN---IHERLAVQLRMCEKRILKATQ  484



>ref|XP_006609971.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X2 [Apis dorsata]
 ref|XP_006609972.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X3 [Apis dorsata]
Length=332

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 85/172 (49%), Gaps = 16/172 (9%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG ++N +  +  G V  E  N  D  ++ + I K+D   KE++E L K  L T   F 
Sbjct  161  SYGPRTNSDFFVHSGFVYME--NKQDGFKLRLGISKADSLQKERIELLNKLDLPTVGEFL  218

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYP---EIEEDALQYI  354
            +++   P+  +  A+L V   SM R+ E      S+R +  K +       +EE+  +++
Sbjct  219  LKLGTEPISDLLLAFLRVF--SM-RKAELAHWIRSDRVNDLKHMDCALETVVEENVRKFL  275

Query  353  LDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRIL  198
            L   +  I+ Y   L+   ++ L+ T P+       +K+LA+ L  +E+RIL
Sbjct  276  LTRLQLLIANYPTTLKEDLQL-LETTLPQ-------IKKLAIQLRVTEKRIL  319



>ref|XP_006609970.1| PREDICTED: histone-lysine N-methyltransferase setd3-like isoform 
X1 [Apis dorsata]
Length=483

 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 48/172 (28%), Positives = 85/172 (49%), Gaps = 16/172 (9%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG ++N +  +  G V  E  N  D  ++ + I K+D   KE++E L K  L T   F 
Sbjct  312  SYGPRTNSDFFVHSGFVYME--NKQDGFKLRLGISKADSLQKERIELLNKLDLPTVGEFL  369

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYP---EIEEDALQYI  354
            +++   P+  +  A+L V   SM R+ E      S+R +  K +       +EE+  +++
Sbjct  370  LKLGTEPISDLLLAFLRVF--SM-RKAELAHWIRSDRVNDLKHMDCALETVVEENVRKFL  426

Query  353  LDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRIL  198
            L   +  I+ Y   L+   ++ L+ T P+       +K+LA+ L  +E+RIL
Sbjct  427  LTRLQLLIANYPTTLKEDLQL-LETTLPQ-------IKKLAIQLRVTEKRIL  470



>emb|CBJ29688.1| putative ribulose-1,5-bisphosphate carboxylase/oxygenase small 
subunit N-methyltransferase I [Ectocarpus siliculosus]
Length=521

 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 46/74 (62%), Gaps = 4/74 (5%)
 Frame = -3

Query  704  SYGKKSNGELLLSYG-XVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERF  528
            SYG K N +LLL YG  + R   NP +SV+V+VS+ ++D+ Y+ K   L + GL  ++ F
Sbjct  342  SYGPKGNSDLLLLYGFSLDR---NPYNSVDVTVSLDENDELYERKKAFLSEAGLPPTKAF  398

Query  527  PVQITGWPLELMAY  486
            P+    +P EL+ Y
Sbjct  399  PLYNDRYPDELLQY  412



>gb|EZA62035.1| Histone-lysine N-methyltransferase setd3, partial [Cerapachys 
biroi]
Length=474

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 85/175 (49%), Gaps = 16/175 (9%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG ++N +  +  G V  +  N  DS ++ + I K+D   KE++E L K  L +   FP
Sbjct  303  SYGPRTNSDFFVHSGFVDMD--NKQDSFKLRLGISKADPLQKERIELLNKLYLPSVGEFP  360

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYP---EIEEDALQYI  354
            ++    P+     A+L V   SM R+ E      S++ S  K I       +EE+  +++
Sbjct  361  LKPGTEPISNTLLAFLRVF--SM-RKAELAHWLRSDKVSDLKHIDCALETVVEENVRKFL  417

Query  353  LDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRA  189
            L   +   + Y   L+   E+ L+ T P+       +K++AV L  +E+RIL  A
Sbjct  418  LTRLQLLTANYPTTLKEDLEL-LETTLPQ-------MKRMAVQLRVTEKRILLGA  464



>ref|XP_011338544.1| PREDICTED: histone-lysine N-methyltransferase setd3 [Cerapachys 
biroi]
Length=483

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/175 (29%), Positives = 85/175 (49%), Gaps = 16/175 (9%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG ++N +  +  G V  +  N  DS ++ + I K+D   KE++E L K  L +   FP
Sbjct  312  SYGPRTNSDFFVHSGFVDMD--NKQDSFKLRLGISKADPLQKERIELLNKLYLPSVGEFP  369

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYP---EIEEDALQYI  354
            ++    P+     A+L V   SM R+ E      S++ S  K I       +EE+  +++
Sbjct  370  LKPGTEPISNTLLAFLRVF--SM-RKAELAHWLRSDKVSDLKHIDCALETVVEENVRKFL  426

Query  353  LDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRA  189
            L   +   + Y   L+   E+ L+ T P+       +K++AV L  +E+RIL  A
Sbjct  427  LTRLQLLTANYPTTLKEDLEL-LETTLPQ-------MKRMAVQLRVTEKRILLGA  473



>ref|XP_006436151.1| hypothetical protein CICLE_v10032643mg [Citrus clementina]
 gb|ESR49391.1| hypothetical protein CICLE_v10032643mg [Citrus clementina]
Length=231

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 56/191 (29%), Positives = 88/191 (46%), Gaps = 32/191 (17%)
 Frame = -3

Query  704  SYGKKSNGELLLSYG-XVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGL------  546
            +YGK SN  LLL +G  +P    N  D V++ + +   D   + K+E L+ H L      
Sbjct  36   TYGKFSNSTLLLDFGFSLP---YNSHDEVQIQIKVPDHDPLLEVKLEVLQSHCLPRARDV  92

Query  545  ----STSERFPVQIT--------GWPLELMAYA-YLAVSPPSMNRQFEEMA--AAASNRT  411
                S+++ F ++          G P  L A+A  L  + P   ++  ++A  AA ++  
Sbjct  93   NGFKSSNDSFTIKEVRSARGRGKGLPQSLRAFARVLCCTSP---QELCDLATEAAQNDGR  149

Query  410  SSKKDIRYPEIEEDALQYILDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLA  231
             +++  R    E  A Q +L    S I + +K   AS E+   VT+P    R  F KQ+A
Sbjct  150  LARRPFRNSCQEILAHQILL----SHIIQLTKEYSASIELLEPVTSPSICKRLAFRKQMA  205

Query  230  VDLCTSERRIL  198
             DL   E RIL
Sbjct  206  RDLLIGELRIL  216



>ref|XP_002286075.1| rubisco small subunit small subunit n-methyltransferase [Thalassiosira 
pseudonana CCMP1335]
 gb|EED95716.1| rubisco small subunit small subunit n-methyltransferase, partial 
[Thalassiosira pseudonana CCMP1335]
Length=434

 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 53/185 (29%), Positives = 88/185 (48%), Gaps = 27/185 (15%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIK-------------KSDKCYKEKMEA  564
            SYG+KSN ELLL YG       NP +SV+V+VSI              + D   +EK+E 
Sbjct  261  SYGQKSNAELLLLYGFALER--NPYNSVDVTVSIAPRTAALAAANEGIEVDPLAQEKVEF  318

Query  563  LKKHGLSTSERFPVQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYP  384
            L   G   +  FP     +P+E++ +  L +  P   R  + +A    +RT S      P
Sbjct  319  LASVGRDQTVDFPCYADRYPVEMLEFLRLMMMTPEDTRG-KPLADFDYSRTIS------P  371

Query  383  EIEEDALQYILDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRV-FLKQLAVDLCTSER  207
              E   L  ++++ +  ++ Y +    S E D ++   K L R + + +++AV    +E+
Sbjct  372  ANEAAVLSSVVEAVKYQLNLYPQ----SEEDDANIIKDKALFRLLSYNQRMAVRHRRNEK  427

Query  206  RILFR  192
            R+L R
Sbjct  428  RLLKR  432



>ref|XP_001754113.1| predicted protein [Physcomitrella patens]
 gb|EDQ81014.1| predicted protein [Physcomitrella patens]
Length=638

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 46/188 (24%), Positives = 93/188 (49%), Gaps = 23/188 (12%)
 Frame = -3

Query  704  SYGK-KSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERF  528
            SYG+ +SN +LL++YG V  +  N  D +++ V +   D+    K + L++  L + + F
Sbjct  307  SYGRERSNADLLITYGFV--DENNAMDYLDLEVGLVDGDRLLVLKQQILQQAMLDSPQTF  364

Query  527  PVQITGWPLELMAYAYLA-VSPPSMNRQFEEMAAAASNRTSSKKDIRYPEIEE-DALQYI  354
            P+ +  +P +L+ Y  L+ +  P++   F ++           KDI   +  E + LQ +
Sbjct  365  PLYLDRFPTQLLTYMRLSRLQDPAL---FPKIVF--------DKDIMLDQANEYECLQLL  413

Query  353  LDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRILFRAQYILR  174
            +  C + +  Y    +   + ++ +   K++++R   +++A  L   E++IL      LR
Sbjct  414  MGECRTKLGNY----EGGVDDEIRLLKNKKISQR---ERVAAQLRLCEKKILTSTMTALR  466

Query  173  RRLRDIRS  150
             RL  IR 
Sbjct  467  NRLAPIRG  474



>ref|XP_003691619.1| PREDICTED: histone-lysine N-methyltransferase setd3-like [Apis 
florea]
Length=483

 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 47/172 (27%), Positives = 84/172 (49%), Gaps = 16/172 (9%)
 Frame = -3

Query  704  SYGKKSNGELLLSYGXVPREGTNPSDSVEVSVSIKKSDKCYKEKMEALKKHGLSTSERFP  525
            SYG ++N +  +  G V  E  N  D  ++ + I K+D   KE++E L K  L T   F 
Sbjct  312  SYGPRTNSDFFVHSGFVYME--NKQDGFKLRLGISKADSLQKERIELLNKLDLPTVGEFL  369

Query  524  VQITGWPLELMAYAYLAVSPPSMNRQFEEMAAAASNRTSSKKDIRYP---EIEEDALQYI  354
            +++   P+  +  A+L V   SM R+ E      S+R +  K +       +EE+  +++
Sbjct  370  LKLGTEPISDLLLAFLRVF--SM-RKAELAHWIRSDRVNDLKHMDCALETVVEENVRKFL  426

Query  353  LDSCESGISKYSKFLQASGEMDLDVTNPKQLNRRVFLKQLAVDLCTSERRIL  198
            L   +  I+ Y   L+   ++ L+ T P+       +K+L + L  +E+RIL
Sbjct  427  LTRLQLLIANYPTTLKEDLQL-LETTLPQ-------IKKLTIQLRVTEKRIL  470



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350