BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038P12

Length=373
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010937298.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       87.0    3e-17   Elaeis guineensis
ref|XP_009594847.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            85.5    1e-16   Nicotiana tomentosiformis
gb|ADE77445.1|  unknown                                               84.7    2e-16   Picea sitchensis
ref|XP_008782856.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       84.0    3e-16   Phoenix dactylifera
ref|XP_010692949.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            84.3    3e-16   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006361525.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       84.0    4e-16   Solanum tuberosum [potatoes]
ref|XP_004245205.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            84.0    4e-16   Solanum lycopersicum
ref|XP_009777333.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            83.6    5e-16   Nicotiana sylvestris
ref|XP_009380021.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       82.4    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004291247.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            81.6    2e-15   Fragaria vesca subsp. vesca
ref|XP_007222372.1|  hypothetical protein PRUPE_ppa004011mg           81.6    2e-15   
ref|XP_008377531.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            81.3    3e-15   
ref|XP_008220603.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            81.3    3e-15   Prunus mume [ume]
gb|EPS63712.1|  hypothetical protein M569_11072                       81.3    4e-15   Genlisea aurea
emb|CAC84082.1|  putative beta-ketoacyl-CoA synthase                  80.5    6e-15   Antirrhinum majus [garden snapdragon]
emb|CBI20747.3|  unnamed protein product                              79.3    7e-15   Vitis vinifera
ref|XP_010939879.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       80.5    7e-15   Elaeis guineensis
ref|XP_009359048.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       79.7    1e-14   Pyrus x bretschneideri [bai li]
gb|ABG35745.1|  putative FIDDLEHEAD very long chain fatty acid co...  79.7    1e-14   Hordeum vulgare [barley]
ref|XP_008800450.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       79.3    2e-14   Phoenix dactylifera
ref|XP_002282234.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            79.3    2e-14   Vitis vinifera
gb|KDO73681.1|  hypothetical protein CISIN_1g009313mg                 79.0    2e-14   Citrus sinensis [apfelsine]
ref|XP_006474532.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       79.0    2e-14   Citrus sinensis [apfelsine]
ref|XP_006452943.1|  hypothetical protein CICLE_v10007953mg           79.0    2e-14   Citrus clementina [clementine]
ref|XP_002516167.1|  acyltransferase, putative                        79.0    2e-14   Ricinus communis
ref|XP_008347473.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       76.3    3e-14   
ref|XP_001753137.1|  predicted protein                                78.2    3e-14   
gb|KHN37223.1|  3-ketoacyl-CoA synthase 10                            77.8    3e-14   Glycine soja [wild soybean]
ref|XP_003522322.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       78.2    4e-14   Glycine max [soybeans]
ref|XP_007136914.1|  hypothetical protein PHAVU_009G084500g           78.2    4e-14   Phaseolus vulgaris [French bean]
ref|XP_003526086.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       78.2    5e-14   Glycine max [soybeans]
ref|XP_008351945.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       77.8    5e-14   
emb|CDP17887.1|  unnamed protein product                              77.8    5e-14   Coffea canephora [robusta coffee]
ref|XP_011081956.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            77.8    6e-14   Sesamum indicum [beniseed]
ref|XP_004501406.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       77.4    8e-14   Cicer arietinum [garbanzo]
gb|EYU21968.1|  hypothetical protein MIMGU_mgv1a004214mg              77.4    8e-14   Erythranthe guttata [common monkey flower]
ref|XP_002977865.1|  hypothetical protein SELMODRAFT_443640           77.0    8e-14   Selaginella moellendorffii
ref|XP_002979460.1|  hypothetical protein SELMODRAFT_444233           77.0    8e-14   Selaginella moellendorffii
ref|XP_003603250.1|  3-ketoacyl-CoA synthase                          77.0    9e-14   Medicago truncatula
ref|XP_007012476.1|  3-ketoacyl-CoA synthase 10                       77.0    1e-13   
gb|AAP74371.1|  FAE1                                                  77.0    1e-13   Marchantia polymorpha
ref|XP_008775195.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  76.6    1e-13   
gb|KHG14239.1|  3-ketoacyl-CoA synthase 10 -like protein              76.6    1e-13   Gossypium arboreum [tree cotton]
gb|AAL67993.1|  fiddlehead-like protein                               76.6    1e-13   Gossypium hirsutum [American cotton]
gb|EYU44641.1|  hypothetical protein MIMGU_mgv1a005164mg              76.6    1e-13   Erythranthe guttata [common monkey flower]
ref|XP_010049293.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            76.6    1e-13   Eucalyptus grandis [rose gum]
ref|XP_002282526.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             76.6    1e-13   Vitis vinifera
ref|XP_002969546.1|  hypothetical protein SELMODRAFT_91671            76.3    2e-13   Selaginella moellendorffii
ref|XP_010273876.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            76.3    2e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010098399.1|  3-ketoacyl-CoA synthase 10                       76.3    2e-13   Morus notabilis
ref|XP_010916172.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        76.3    2e-13   Elaeis guineensis
gb|KDP28427.1|  hypothetical protein JCGZ_14198                       76.3    2e-13   Jatropha curcas
gb|AAO47729.1|  fiddlehead-like protein                               76.3    2e-13   Tropaeolum majus
ref|XP_008452803.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  76.3    2e-13   
ref|XP_004168381.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       76.3    2e-13   
ref|XP_004141352.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       76.3    2e-13   Cucumis sativus [cucumbers]
gb|AGK29999.1|  3-ketoacyl-CoA synthase 13                            75.9    2e-13   Gossypium raimondii
ref|XP_007153392.1|  hypothetical protein PHAVU_003G031300g           76.3    2e-13   Phaseolus vulgaris [French bean]
ref|XP_010692961.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        75.5    3e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003549437.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        75.5    3e-13   Glycine max [soybeans]
gb|AGK30000.1|  3-ketoacyl-CoA synthase 5                             75.5    3e-13   Gossypium raimondii
gb|KJB16229.1|  hypothetical protein B456_002G218500                  75.5    4e-13   Gossypium raimondii
ref|XP_009362990.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       75.5    4e-13   Pyrus x bretschneideri [bai li]
dbj|BAJ87894.1|  predicted protein                                    75.5    4e-13   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006344141.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        75.1    4e-13   Solanum tuberosum [potatoes]
ref|XP_002271250.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             75.1    4e-13   Vitis vinifera
emb|CAN63425.1|  hypothetical protein VITISV_040442                   75.1    4e-13   Vitis vinifera
ref|XP_002970815.1|  hypothetical protein SELMODRAFT_94459            75.1    4e-13   Selaginella moellendorffii
ref|XP_006284916.1|  hypothetical protein CARUB_v10006212mg           75.1    5e-13   Capsella rubella
ref|XP_011037520.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        75.1    5e-13   Populus euphratica
ref|XP_010681548.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        74.7    6e-13   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB82945.1|  hypothetical protein B456_013G221500                  74.7    6e-13   Gossypium raimondii
ref|XP_010265150.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        74.7    6e-13   Nelumbo nucifera [Indian lotus]
gb|AGK30017.1|  3-ketoacyl-CoA synthase 8                             74.7    6e-13   Gossypium raimondii
gb|ABU75309.2|  fiddlehead-like protein                               74.7    6e-13   Pisum sativum [garden pea]
ref|XP_009390873.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       74.7    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009115318.1|  PREDICTED: 3-ketoacyl-CoA synthase 5             74.3    7e-13   Brassica rapa
emb|CDY42109.1|  BnaA09g28510D                                        74.3    7e-13   Brassica napus [oilseed rape]
ref|XP_004238923.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        74.3    7e-13   Solanum lycopersicum
ref|XP_009390357.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        74.3    7e-13   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008802438.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        74.3    8e-13   Phoenix dactylifera
ref|NP_001130497.1|  uncharacterized protein LOC100191595             74.3    9e-13   Zea mays [maize]
ref|XP_002465630.1|  hypothetical protein SORBIDRAFT_01g042600        74.3    9e-13   Sorghum bicolor [broomcorn]
ref|XP_008668455.1|  PREDICTED: uncharacterized protein LOC100191...  73.9    1e-12   Zea mays [maize]
gb|AGK29998.1|  3-ketoacyl-CoA synthase 9                             73.9    1e-12   Gossypium raimondii
ref|XP_011097190.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.9    1e-12   Sesamum indicum [beniseed]
ref|XP_009779121.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        73.9    1e-12   Nicotiana sylvestris
ref|XP_007042184.1|  3-ketoacyl-CoA synthase 4                        73.9    1e-12   
ref|XP_006651174.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.9    1e-12   
gb|AAO48425.1|  beta-ketoacyl-CoA-synthase                            73.9    1e-12   Marchantia polymorpha
ref|XP_011076851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.6    1e-12   Sesamum indicum [beniseed]
gb|KDP34003.1|  hypothetical protein JCGZ_07574                       73.9    1e-12   Jatropha curcas
gb|AFK40996.1|  unknown                                               72.8    1e-12   Medicago truncatula
ref|XP_003558474.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.6    1e-12   Brachypodium distachyon [annual false brome]
ref|XP_002869143.1|  3-ketoacyl-CoA synthase 2                        73.6    1e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_010926125.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.6    1e-12   Elaeis guineensis
ref|XP_006412219.1|  hypothetical protein EUTSA_v10025028mg           73.6    2e-12   Eutrema salsugineum [saltwater cress]
gb|ABK24632.1|  unknown                                               73.6    2e-12   Picea sitchensis
gb|EYU32293.1|  hypothetical protein MIMGU_mgv1a004078mg              73.6    2e-12   Erythranthe guttata [common monkey flower]
ref|XP_003531926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.2    2e-12   Glycine max [soybeans]
ref|XP_001769764.1|  predicted protein                                73.2    2e-12   
ref|NP_001049406.1|  Os03g0220100                                     73.2    2e-12   
ref|XP_010054134.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             73.6    2e-12   Eucalyptus grandis [rose gum]
emb|CDX77038.1|  BnaC04g38330D                                        73.2    2e-12   
ref|XP_003637444.1|  3-ketoacyl-CoA synthase                          73.2    2e-12   
gb|KFK32520.1|  hypothetical protein AALP_AA6G253600                  73.2    2e-12   Arabis alpina [alpine rockcress]
ref|NP_195177.1|  3-ketoacyl-CoA synthase 17                          73.2    2e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CDY46243.1|  BnaC03g66040D                                        73.2    2e-12   Brassica napus [oilseed rape]
ref|XP_011088403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...  73.2    2e-12   
ref|XP_003555901.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        73.2    2e-12   Glycine max [soybeans]
ref|XP_009108847.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2    72.8    2e-12   Brassica rapa
emb|CDX76286.1|  BnaA08g11140D                                        72.8    2e-12   
ref|XP_003536684.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             73.2    2e-12   Glycine max [soybeans]
ref|XP_002305431.1|  hypothetical protein POPTR_0004s16290g           73.2    2e-12   Populus trichocarpa [western balsam poplar]
ref|XP_011088405.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like is...  72.8    2e-12   Sesamum indicum [beniseed]
ref|XP_001753229.1|  predicted protein                                73.2    2e-12   
ref|XP_009786212.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.8    2e-12   Nicotiana sylvestris
ref|XP_002992903.1|  hypothetical protein SELMODRAFT_43379            72.4    3e-12   
gb|KHN05569.1|  3-ketoacyl-CoA synthase 6                             72.8    3e-12   Glycine soja [wild soybean]
ref|XP_002980157.1|  hypothetical protein SELMODRAFT_53281            72.4    3e-12   
gb|KHN11421.1|  3-ketoacyl-CoA synthase 6                             72.8    3e-12   Glycine soja [wild soybean]
ref|XP_011048431.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        72.8    3e-12   Populus euphratica
ref|XP_011099559.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.8    3e-12   Sesamum indicum [beniseed]
ref|XP_010477925.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        72.8    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010499108.1|  PREDICTED: 3-ketoacyl-CoA synthase 5             72.8    3e-12   Camelina sativa [gold-of-pleasure]
gb|AGH32920.1|  ketoacyl-CoA synthase                                 72.8    3e-12   Camellia chekiangoleosa
ref|XP_009630522.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        72.8    3e-12   Nicotiana tomentosiformis
gb|ABA01490.1|  3-ketoacyl-CoA synthase                               72.8    3e-12   Gossypium hirsutum [American cotton]
ref|XP_011088406.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        72.8    3e-12   Sesamum indicum [beniseed]
gb|AIE57499.1|  KCS6                                                  72.8    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_004306622.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        72.8    3e-12   Fragaria vesca subsp. vesca
ref|NP_195151.1|  3-ketoacyl-CoA synthase 16                          72.8    3e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232364.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.8    3e-12   
gb|AGK30003.1|  3-ketoacyl-CoA synthase                               72.4    3e-12   Gossypium raimondii
ref|XP_006363119.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.8    3e-12   Solanum tuberosum [potatoes]
gb|ACT21783.1|  CER6                                                  72.8    3e-12   Solanum lycopersicum
ref|XP_002313793.1|  hypothetical protein POPTR_0009s11940g           72.8    3e-12   Populus trichocarpa [western balsam poplar]
gb|AFG67884.1|  hypothetical protein 2_1205_02                        67.4    3e-12   Pinus taeda
emb|CDY11498.1|  BnaA09g40640D                                        72.8    3e-12   Brassica napus [oilseed rape]
ref|XP_006346917.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.4    3e-12   Solanum tuberosum [potatoes]
ref|XP_006408788.1|  hypothetical protein EUTSA_v10001951mg           72.4    3e-12   
ref|XP_006375382.1|  hypothetical protein POPTR_0014s10010g           72.8    3e-12   Populus trichocarpa [western balsam poplar]
ref|XP_010436266.1|  PREDICTED: 3-ketoacyl-CoA synthase 16-like       72.0    3e-12   
ref|XP_006415873.1|  hypothetical protein EUTSA_v10007453mg           72.4    3e-12   Eutrema salsugineum [saltwater cress]
ref|XP_004497096.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.4    3e-12   Cicer arietinum [garbanzo]
ref|XP_003614634.1|  3-ketoacyl-CoA synthase                          72.4    4e-12   Medicago truncatula
gb|KCW55362.1|  hypothetical protein EUGRSUZ_I01277                   72.4    4e-12   Eucalyptus grandis [rose gum]
gb|AGK30016.1|  3-ketoacyl-CoA synthase                               72.4    4e-12   Gossypium raimondii
ref|XP_009117027.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       72.4    4e-12   Brassica rapa
gb|KJB12199.1|  hypothetical protein B456_002G005500                  72.4    4e-12   Gossypium raimondii
ref|XP_011099560.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.4    4e-12   Sesamum indicum [beniseed]
ref|XP_002963631.1|  hypothetical protein SELMODRAFT_79947            72.4    4e-12   
gb|KDP29403.1|  hypothetical protein JCGZ_18324                       72.4    4e-12   Jatropha curcas
ref|XP_009140735.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  72.4    4e-12   Brassica rapa
ref|XP_001759085.1|  predicted protein                                72.4    4e-12   
emb|CDY35309.1|  BnaA04g15380D                                        72.4    4e-12   Brassica napus [oilseed rape]
ref|XP_011039108.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        72.4    4e-12   Populus euphratica
ref|XP_002974719.1|  hypothetical protein SELMODRAFT_101692           72.4    4e-12   
ref|XP_010437646.1|  PREDICTED: 3-ketoacyl-CoA synthase 16            72.4    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002888670.1|  hypothetical protein ARALYDRAFT_894621           72.4    4e-12   Arabidopsis lyrata subsp. lyrata
ref|XP_002869162.1|  hypothetical protein ARALYDRAFT_491244           72.4    4e-12   
ref|XP_010522896.1|  PREDICTED: 3-ketoacyl-CoA synthase 1 isoform X1  72.4    4e-12   Tarenaya hassleriana [spider flower]
gb|KJB12200.1|  hypothetical protein B456_002G005500                  72.4    4e-12   Gossypium raimondii
emb|CDX76724.1|  BnaC08g33100D                                        72.4    4e-12   
emb|CDX69040.1|  BnaC01g04130D                                        72.0    4e-12   
emb|CDX75415.1|  BnaA01g02870D                                        72.0    4e-12   
ref|XP_010028602.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        72.4    4e-12   Eucalyptus grandis [rose gum]
ref|XP_006293899.1|  hypothetical protein CARUB_v10022892mg           72.4    4e-12   
ref|XP_009114823.1|  PREDICTED: 3-ketoacyl-CoA synthase 16            72.0    4e-12   Brassica rapa
gb|AID60137.1|  3-ketoacyl-CoA synthase 16                            72.0    4e-12   Brassica napus [oilseed rape]
ref|XP_006344142.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.0    5e-12   Solanum tuberosum [potatoes]
ref|XP_010447115.1|  PREDICTED: 3-ketoacyl-CoA synthase 16-like       72.0    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_007044356.1|  3-ketoacyl-CoA synthase 6                        72.0    5e-12   
gb|AGK30001.1|  3-ketoacyl-CoA synthase                               72.0    5e-12   Gossypium raimondii
ref|XP_007136167.1|  hypothetical protein PHAVU_009G023600g           72.0    5e-12   Phaseolus vulgaris [French bean]
ref|XP_010415473.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             72.0    5e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010511851.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        72.0    5e-12   Camelina sativa [gold-of-pleasure]
emb|CDP00615.1|  unnamed protein product                              72.0    6e-12   Coffea canephora [robusta coffee]
gb|AAF73979.1|AF214502_1  fiddlehead protein                          72.0    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_180193.1|  3-ketoacyl-CoA synthase 10                          72.0    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009365554.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        72.0    6e-12   Pyrus x bretschneideri [bai li]
ref|XP_006408789.1|  hypothetical protein EUTSA_v10001951mg           72.0    6e-12   Eutrema salsugineum [saltwater cress]
dbj|BAJ34066.1|  unnamed protein product                              72.0    6e-12   Eutrema halophilum
ref|XP_002315942.1|  ECERIFERUM 6 family protein                      72.0    6e-12   Populus trichocarpa [western balsam poplar]
gb|AAF73980.1|AF214504_1  fiddlehead protein                          72.0    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302169.1|  hypothetical protein CARUB_v10020179mg           71.6    6e-12   Capsella rubella
ref|NP_001267518.1|  uncharacterized protein LOC100797855             72.0    6e-12   Glycine max [soybeans]
ref|XP_011007926.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             71.6    6e-12   Populus euphratica
gb|KDP46259.1|  hypothetical protein JCGZ_10099                       71.6    6e-12   Jatropha curcas
ref|XP_010527059.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            72.0    6e-12   Tarenaya hassleriana [spider flower]
ref|XP_006412251.1|  hypothetical protein EUTSA_v10025022mg           71.6    7e-12   Eutrema salsugineum [saltwater cress]
ref|XP_010263648.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        71.6    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010690872.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             71.6    7e-12   
gb|AGK29994.1|  3-ketoacyl-CoA synthase 4                             71.6    7e-12   Gossypium raimondii
ref|XP_010254814.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        71.6    7e-12   Nelumbo nucifera [Indian lotus]
ref|XP_007222962.1|  hypothetical protein PRUPE_ppa006758mg           71.2    7e-12   
ref|XP_008243224.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             71.6    8e-12   Prunus mume [ume]
ref|XP_010690661.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             71.6    8e-12   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009105040.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             71.2    8e-12   Brassica rapa
gb|AAM65060.1|  very-long-chain fatty acid condensing enzyme CUT1     71.2    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002531630.1|  acyltransferase, putative                        71.2    9e-12   
ref|XP_010472653.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       71.6    9e-12   Camelina sativa [gold-of-pleasure]
emb|CDY04232.1|  BnaC06g25830D                                        71.2    9e-12   
gb|AAL50069.1|  At1g68530/T26J14_10                                   71.2    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010417409.1|  PREDICTED: 3-ketoacyl-CoA synthase 10 isofor...  71.6    9e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010417407.1|  PREDICTED: 3-ketoacyl-CoA synthase 10 isofor...  71.6    9e-12   Camelina sativa [gold-of-pleasure]
gb|KFK41273.1|  hypothetical protein AALP_AA2G108700                  71.2    9e-12   Arabis alpina [alpine rockcress]
ref|XP_010429645.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       71.2    9e-12   Camelina sativa [gold-of-pleasure]
ref|NP_177020.1|  3-ketoacyl-CoA synthase 6                           71.2    9e-12   Arabidopsis thaliana [mouse-ear cress]
gb|ACZ51240.1|  3-ketoacyl-CoA synthase                               71.2    9e-12   Arachis hypogaea [goober]
ref|XP_006843898.1|  hypothetical protein AMTR_s00007p00267760        71.2    1e-11   Amborella trichopoda
ref|XP_008444712.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        71.2    1e-11   Cucumis melo [Oriental melon]
ref|XP_004152699.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        71.2    1e-11   Cucumis sativus [cucumbers]
gb|AAP74370.1|  FAE3                                                  71.2    1e-11   Marchantia polymorpha
ref|XP_010670713.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       71.2    1e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003626601.1|  3-ketoacyl-CoA synthase                          71.2    1e-11   Medicago truncatula
gb|ABY82171.2|  3-ketoacyl-CoA synthase I                             71.2    1e-11   Triticum aestivum [Canadian hard winter wheat]
gb|ACN25352.1|  unknown                                               68.6    1e-11   Zea mays [maize]
ref|XP_006581119.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        70.9    1e-11   Glycine max [soybeans]
gb|EMT20723.1|  3-ketoacyl-CoA synthase 6                             70.9    1e-11   
gb|EMS60006.1|  3-ketoacyl-CoA synthase 6                             70.9    1e-11   Triticum urartu
ref|XP_007139008.1|  hypothetical protein PHAVU_009G257100g           71.2    1e-11   Phaseolus vulgaris [French bean]
ref|XP_004135090.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...  70.9    1e-11   Cucumis sativus [cucumbers]
ref|XP_004507452.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        70.9    1e-11   Cicer arietinum [garbanzo]
ref|XP_003567862.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             70.9    1e-11   Brachypodium distachyon [annual false brome]
gb|ACQ41892.1|  3-ketoacyl-CoA synthase                               70.9    1e-11   Camellia oleifera [abura-tsubaki]
ref|XP_008446598.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             70.9    1e-11   Cucumis melo [Oriental melon]
ref|XP_010918296.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             70.9    1e-11   Elaeis guineensis
ref|XP_004985167.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.9    1e-11   Setaria italica
ref|XP_004238922.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             70.9    1e-11   Solanum lycopersicum
emb|CDP00616.1|  unnamed protein product                              70.9    1e-11   Coffea canephora [robusta coffee]
ref|XP_004135091.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like is...  70.5    1e-11   
ref|XP_002880771.1|  predicted protein                                70.9    2e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_009605061.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.9    2e-11   Nicotiana tomentosiformis
ref|XP_010910111.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.5    2e-11   Elaeis guineensis
ref|XP_009390849.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.5    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ98276.1|  predicted protein                                    70.5    2e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEW08011.1|  hypothetical protein 0_16976_02                       65.9    2e-11   Pinus radiata
ref|XP_010088926.1|  3-ketoacyl-CoA synthase 4                        70.5    2e-11   Morus notabilis
gb|KDO69954.1|  hypothetical protein CISIN_1g011007mg                 70.5    2e-11   Citrus sinensis [apfelsine]
ref|XP_006437664.1|  hypothetical protein CICLE_v10031329mg           70.5    2e-11   Citrus clementina [clementine]
emb|CDP08625.1|  unnamed protein product                              70.9    2e-11   Coffea canephora [robusta coffee]
ref|XP_010103772.1|  3-ketoacyl-CoA synthase 6                        70.5    2e-11   
ref|XP_006398946.1|  hypothetical protein EUTSA_v10013296mg           70.5    2e-11   Eutrema salsugineum [saltwater cress]
ref|NP_180232.1|  3-ketoacyl-CoA synthase 11                          70.5    2e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006293527.1|  hypothetical protein CARUB_v10024547mg           70.5    2e-11   Capsella rubella
gb|KHN12706.1|  3-ketoacyl-CoA synthase 4                             69.3    2e-11   Glycine soja [wild soybean]
ref|XP_009758872.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             70.5    2e-11   Nicotiana sylvestris
gb|KHN20068.1|  3-ketoacyl-CoA synthase 4                             70.1    2e-11   Glycine soja [wild soybean]
ref|XP_006851009.1|  hypothetical protein AMTR_s00025p00218830        68.2    2e-11   
ref|XP_002264721.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             70.5    2e-11   Vitis vinifera
ref|XP_009351389.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        70.5    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_001757568.1|  predicted protein                                70.1    2e-11   
ref|XP_009348991.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       70.1    2e-11   Pyrus x bretschneideri [bai li]
ref|XP_008391016.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like i...  70.1    2e-11   
ref|XP_009378513.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        70.1    2e-11   Pyrus x bretschneideri [bai li]
gb|ABG35744.1|  putative very long chain fatty acid condensing en...  70.1    2e-11   Hordeum vulgare [barley]
emb|CDX98800.1|  BnaC09g50350D                                        70.1    2e-11   
ref|XP_006307339.1|  hypothetical protein CARUB_v10008957mg           70.1    2e-11   Capsella rubella
ref|XP_006387087.1|  hypothetical protein POPTR_1902s002001g          66.6    2e-11   
ref|XP_010437605.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2    67.8    2e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010417808.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            70.1    3e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009606335.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             70.1    3e-11   Nicotiana tomentosiformis
ref|XP_010066726.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             70.1    3e-11   Eucalyptus grandis [rose gum]
ref|XP_009349773.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       70.1    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_002311457.1|  hypothetical protein POPTR_0008s11920g           70.1    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_010251878.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             70.1    3e-11   Nelumbo nucifera [Indian lotus]
ref|XP_009762000.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        70.1    3e-11   Nicotiana sylvestris
ref|XP_008363965.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        70.1    3e-11   
ref|XP_009782317.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        70.1    3e-11   Nicotiana sylvestris
ref|XP_009406296.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        70.1    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX70186.1|  BnaA10g25350D                                        70.1    3e-11   
ref|XP_009366618.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             70.1    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_009777704.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        69.7    3e-11   Nicotiana sylvestris
ref|XP_006286166.1|  hypothetical protein CARUB_v10007737mg           69.7    3e-11   Capsella rubella
ref|XP_010473048.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  70.1    3e-11   
ref|XP_009122553.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            70.1    3e-11   Brassica rapa
ref|XP_002283730.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             69.7    3e-11   Vitis vinifera
ref|XP_010539905.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             69.7    3e-11   Tarenaya hassleriana [spider flower]
gb|AGK29997.1|  3-ketoacyl-CoA synthase                               70.1    3e-11   
ref|XP_009392409.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       69.7    3e-11   
ref|XP_009337302.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       70.1    3e-11   
ref|XP_003519009.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       69.7    3e-11   
ref|XP_009119325.1|  PREDICTED: 3-ketoacyl-CoA synthase 17            69.7    3e-11   
ref|XP_010447067.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2    69.7    3e-11   
ref|XP_010475071.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like       69.7    3e-11   
ref|XP_007218983.1|  hypothetical protein PRUPE_ppa003977mg           69.7    3e-11   
emb|CBI38700.3|  unnamed protein product                              70.1    3e-11   
ref|XP_009594431.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  69.7    3e-11   
emb|CCW28736.1|  putative 3-Oxoacyl-[acyl-carrier-protein (ACP)] ...  69.7    4e-11   
ref|XP_002441534.1|  hypothetical protein SORBIDRAFT_09g028860        69.7    4e-11   
ref|XP_008376209.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  69.7    4e-11   
ref|XP_009598968.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             69.3    4e-11   
dbj|BAD94049.1|  beta-ketoacyl-CoA synthase                           65.1    4e-11   
emb|CDP02779.1|  unnamed protein product                              69.3    4e-11   
ref|XP_002878994.1|  hypothetical protein ARALYDRAFT_901443           69.7    4e-11   
ref|XP_010263663.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        69.3    4e-11   
ref|XP_007143888.1|  hypothetical protein PHAVU_007G110500g           69.7    4e-11   
ref|XP_003555524.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       69.7    4e-11   
ref|XP_003536202.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       69.7    4e-11   
ref|XP_002509491.1|  acyltransferase, putative                        69.3    4e-11   
ref|XP_010917638.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       69.3    4e-11   
gb|EYU34398.1|  hypothetical protein MIMGU_mgv1a005204mg              69.3    4e-11   
gb|KHN05051.1|  3-ketoacyl-CoA synthase 11                            69.3    4e-11   
ref|XP_011019306.1|  PREDICTED: 3-ketoacyl-CoA synthase 10            69.3    4e-11   
gb|KFK30058.1|  hypothetical protein AALP_AA7G211400                  68.9    4e-11   
ref|XP_004495403.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       69.3    4e-11   
gb|AGK29993.1|  3-ketoacyl-CoA synthase 10                            69.3    4e-11   
gb|ABX10440.1|  3-ketoacyl-CoA synthase 10                            69.3    4e-11   
ref|XP_002309451.1|  beta-ketoacyl-CoA synthase family protein        69.3    4e-11   
dbj|BAD94789.1|  very-long-chain fatty acid condensing enzyme (CUT1)  65.1    4e-11   
ref|XP_004233492.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        69.3    4e-11   
ref|XP_010091264.1|  3-ketoacyl-CoA synthase 11                       69.3    5e-11   
ref|XP_007051450.1|  3-ketoacyl-CoA synthase 1                        69.3    5e-11   
ref|XP_007145927.1|  hypothetical protein PHAVU_007G279500g           69.3    5e-11   
gb|AAF73976.1|AF214496_1  fiddlehead protein                          69.3    5e-11   
ref|XP_010432405.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 2    68.9    5e-11   
ref|XP_006647059.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       69.3    5e-11   
ref|XP_006349735.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.6    5e-11   
gb|KHN20977.1|  3-ketoacyl-CoA synthase 4                             69.3    5e-11   
ref|XP_006307251.1|  hypothetical protein CARUB_v10008867mg           69.3    5e-11   
ref|XP_010475069.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like       69.3    5e-11   
ref|XP_010457458.1|  PREDICTED: 3-ketoacyl-CoA synthase 17            69.3    5e-11   
ref|XP_010483273.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like i...  69.3    5e-11   
gb|AAU95453.1|  At1g04220                                             69.3    5e-11   
ref|XP_010255306.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        69.3    5e-11   
ref|XP_003606927.1|  3-ketoacyl-CoA synthase                          68.9    5e-11   
gb|AAL67132.1|  putative beta-ketoacyl-CoA synthase                   69.3    5e-11   
ref|NP_171918.1|  3-ketoacyl-CoA synthase 2                           69.3    5e-11   
ref|XP_008233066.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        69.3    5e-11   
ref|XP_010265151.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        68.9    5e-11   
ref|XP_008339680.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             68.9    6e-11   
ref|XP_007142908.1|  hypothetical protein PHAVU_007G027100g           68.9    6e-11   
emb|CDX94721.1|  BnaC07g17300D                                        68.6    6e-11   
ref|XP_011086329.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.9    6e-11   
ref|XP_010688098.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            68.9    6e-11   
ref|XP_002892201.1|  hypothetical protein ARALYDRAFT_470398           68.9    6e-11   
ref|XP_003536489.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.9    6e-11   
ref|XP_009101767.1|  PREDICTED: 3-ketoacyl-CoA synthase 19            68.9    6e-11   
ref|XP_004296609.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.9    6e-11   
ref|XP_004289669.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        68.9    6e-11   
gb|AET83339.1|  hypothetical protein                                  65.5    6e-11   
ref|XP_010530834.1|  PREDICTED: 3-ketoacyl-CoA synthase 9 isoform X1  68.9    6e-11   
gb|KFK42764.1|  hypothetical protein AALP_AA1G036700                  68.9    6e-11   
gb|AET83309.1|  hypothetical protein                                  65.5    6e-11   
ref|XP_010100669.1|  3-ketoacyl-CoA synthase 1                        68.9    7e-11   
ref|XP_004247207.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.6    7e-11   
ref|XP_009400075.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        68.6    7e-11   
gb|AGK29991.1|  3-ketoacyl-CoA synthase 7                             68.9    7e-11   
ref|XP_008389290.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        68.9    7e-11   
ref|XP_010548056.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like        68.9    7e-11   
ref|XP_004248096.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             68.9    7e-11   
ref|XP_009112385.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  68.9    7e-11   
gb|EYU34550.1|  hypothetical protein MIMGU_mgv1a004667mg              68.9    7e-11   
gb|EAY99068.1|  hypothetical protein OsI_21025                        68.9    7e-11   
gb|ABD77097.1|  putative fatty acid elongase                          68.6    7e-11   
gb|AAL99199.1|  putative fatty acid elongase                          68.6    7e-11   
ref|XP_009597817.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        68.6    7e-11   
ref|XP_010104374.1|  3-ketoacyl-CoA synthase 4                        68.6    7e-11   
ref|XP_008357196.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        68.6    7e-11   
ref|XP_007034920.1|  3-ketoacyl-CoA synthase 2                        68.6    8e-11   
ref|XP_001758798.1|  predicted protein                                68.6    8e-11   
ref|XP_010100962.1|  3-ketoacyl-CoA synthase 7                        68.2    8e-11   
ref|XP_010548057.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like        68.6    8e-11   
ref|XP_010932851.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.6    8e-11   
ref|XP_007222865.1|  hypothetical protein PRUPE_ppa004284mg           68.6    8e-11   
ref|XP_010533183.1|  PREDICTED: 3-ketoacyl-CoA synthase 11 isofor...  68.6    8e-11   
gb|KFK44079.1|  hypothetical protein AALP_AA1G213300                  68.6    8e-11   
gb|AIV98044.1|  3-ketoacyl-CoA synthase                               68.2    8e-11   
ref|XP_004494857.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        68.6    8e-11   
emb|CDX81929.1|  BnaC08g36720D                                        68.6    8e-11   
ref|XP_010460377.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like is...  67.0    8e-11   
gb|KDO49072.1|  hypothetical protein CISIN_1g010687mg                 68.6    8e-11   
ref|XP_009356269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        68.6    8e-11   
ref|XP_009399728.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        68.6    8e-11   
ref|XP_010460376.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like is...  67.0    9e-11   
ref|XP_010093608.1|  3-ketoacyl-CoA synthase 5                        68.2    9e-11   
ref|XP_010542792.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        68.6    9e-11   
gb|ABS18382.1|  3-ketoacyl-CoA synthase                               68.6    9e-11   
ref|XP_009117539.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             68.6    9e-11   
gb|KDP33633.1|  hypothetical protein JCGZ_07204                       67.8    9e-11   
gb|KDO80368.1|  hypothetical protein CISIN_1g008975mg                 68.2    9e-11   
ref|XP_006403195.1|  hypothetical protein EUTSA_v10003358mg           68.6    9e-11   
ref|XP_010249963.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.6    9e-11   
ref|XP_004134106.1|  PREDICTED: 3-ketoacyl-CoA synthase 17-like       68.6    9e-11   
emb|CDX89834.1|  BnaA10g02480D                                        68.6    9e-11   
ref|XP_006423278.1|  hypothetical protein CICLE_v10028243mg           68.6    9e-11   
emb|CDY49290.1|  BnaA03g51030D                                        68.2    9e-11   
ref|XP_004165059.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...  68.6    9e-11   
emb|CDY21665.1|  BnaA09g44160D                                        68.6    9e-11   
ref|XP_009784659.1|  PREDICTED: 3-ketoacyl-CoA synthase 5-like        68.6    9e-11   
gb|KEH42797.1|  3-ketoacyl-CoA synthase-like protein                  68.6    9e-11   
ref|XP_009356268.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             68.2    9e-11   
gb|EMS50435.1|  3-ketoacyl-CoA synthase 4                             68.6    9e-11   
ref|XP_010669633.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       68.6    9e-11   
ref|XP_008660394.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        68.2    1e-10   
ref|XP_008388058.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        68.2    1e-10   
gb|AHX25585.1|  3-ketoacyl-CoA synthase 6                             68.2    1e-10   
ref|XP_009149432.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             68.2    1e-10   
emb|CDP07508.1|  unnamed protein product                              68.2    1e-10   
ref|XP_006655600.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        68.2    1e-10   
gb|KHN13761.1|  3-ketoacyl-CoA synthase 11                            68.2    1e-10   
ref|XP_006475774.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.2    1e-10   
ref|XP_006451014.1|  hypothetical protein CICLE_v10007916mg           68.2    1e-10   
gb|KEH37969.1|  3-ketoacyl-CoA synthase-like protein                  68.2    1e-10   
ref|XP_008368384.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       68.2    1e-10   
gb|KHN46008.1|  3-ketoacyl-CoA synthase 11                            68.2    1e-10   
gb|KHN10089.1|  3-ketoacyl-CoA synthase 11                            67.8    1e-10   
ref|XP_007224573.1|  hypothetical protein PRUPE_ppa1027226mg          67.8    1e-10   
gb|AIE57498.1|  KCS2                                                  68.2    1e-10   
ref|XP_009123908.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       68.2    1e-10   
emb|CDY14892.1|  BnaA02g22340D                                        68.2    1e-10   
ref|XP_003522916.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like i...  68.2    1e-10   
emb|CDX96912.1|  BnaC02g30500D                                        68.2    1e-10   
ref|XP_008801160.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             68.2    1e-10   
ref|XP_009138277.1|  PREDICTED: 3-ketoacyl-CoA synthase 16-like       68.2    1e-10   
ref|XP_001778803.1|  predicted protein                                68.2    1e-10   
ref|XP_007138322.1|  hypothetical protein PHAVU_009G199000g           68.2    1e-10   
gb|AFY98637.1|  beta-ketoacyl-CoA synthase II                         68.2    1e-10   
gb|KDO80366.1|  hypothetical protein CISIN_1g008975mg                 68.2    1e-10   
ref|XP_006451013.1|  hypothetical protein CICLE_v10007916mg           68.2    1e-10   
ref|XP_003631663.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             68.2    1e-10   
ref|XP_009388450.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       68.2    1e-10   
ref|XP_011091085.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            68.2    1e-10   
gb|KHG01499.1|  3-ketoacyl-CoA synthase 11 -like protein              68.2    1e-10   
ref|XP_010477163.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        68.2    1e-10   
ref|XP_006416504.1|  hypothetical protein EUTSA_v10007370mg           68.2    1e-10   
gb|ACC60973.1|  beta-ketoacyl-CoA synthase                            68.2    1e-10   
emb|CDY29431.1|  BnaA06g13650D                                        68.2    1e-10   
ref|XP_009792392.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       68.2    1e-10   
ref|XP_002308642.1|  hypothetical protein POPTR_0006s26530g           68.2    1e-10   
ref|XP_010530833.1|  PREDICTED: 3-ketoacyl-CoA synthase 9-like        68.2    1e-10   
ref|XP_010459615.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        68.2    1e-10   
ref|XP_009414779.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        68.2    1e-10   
gb|EYU26540.1|  hypothetical protein MIMGU_mgv1a006237mg              67.8    1e-10   
ref|NP_173376.1|  3-ketoacyl-CoA synthase 4                           68.2    1e-10   
ref|XP_008438597.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       68.2    1e-10   
emb|CDX72475.1|  BnaC07g44970D                                        67.8    1e-10   
ref|XP_010089997.1|  3-ketoacyl-CoA synthase 11                       68.2    1e-10   
emb|CDO97044.1|  unnamed protein product                              68.2    1e-10   
ref|XP_006450506.1|  hypothetical protein CICLE_v10008045mg           67.8    1e-10   
ref|XP_006304681.1|  hypothetical protein CARUB_v10011929mg           67.8    1e-10   
ref|XP_009336207.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             67.8    1e-10   
ref|XP_010498362.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             67.8    1e-10   
ref|XP_002890341.1|  hypothetical protein ARALYDRAFT_472173           67.8    1e-10   
ref|XP_004513574.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.8    1e-10   
ref|XP_010523834.1|  PREDICTED: 3-ketoacyl-CoA synthase 13            67.8    1e-10   
ref|XP_006483306.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.8    1e-10   
ref|XP_009404183.1|  PREDICTED: 3-ketoacyl-CoA synthase 10-like       67.8    1e-10   
ref|XP_009605059.1|  PREDICTED: 3-ketoacyl-CoA synthase 6-like        67.0    1e-10   
ref|XP_009364915.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        67.8    2e-10   
ref|XP_010255193.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        67.8    2e-10   
ref|XP_006391129.1|  hypothetical protein EUTSA_v10018446mg           67.8    2e-10   
ref|XP_010551269.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             67.8    2e-10   
ref|XP_006356047.1|  PREDICTED: 3-ketoacyl-CoA synthase 19-like       67.8    2e-10   
ref|XP_004234025.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.8    2e-10   
ref|XP_011019752.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            67.8    2e-10   
ref|XP_006409602.1|  hypothetical protein EUTSA_v10022669mg           67.8    2e-10   
ref|XP_011081914.1|  PREDICTED: 3-ketoacyl-CoA synthase 11            67.8    2e-10   
ref|XP_004245214.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.8    2e-10   
ref|XP_001756180.1|  predicted protein                                67.8    2e-10   
ref|XP_010048253.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.8    2e-10   
ref|XP_009102329.1|  PREDICTED: 3-ketoacyl-CoA synthase 8             67.8    2e-10   
emb|CDX71202.1|  BnaC07g04810D                                        67.8    2e-10   
gb|KFK39995.1|  hypothetical protein AALP_AA3G316500                  67.8    2e-10   
ref|XP_010098974.1|  3-ketoacyl-CoA synthase 11                       67.8    2e-10   
gb|ACJ61777.1|  3-ketoacyl-CoA synthase                               67.8    2e-10   
ref|XP_010025862.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.8    2e-10   
ref|XP_010548059.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like i...  67.8    2e-10   
ref|XP_009391408.1|  PREDICTED: 3-ketoacyl-CoA synthase 6             67.8    2e-10   
ref|XP_009614092.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.8    2e-10   
ref|XP_010914511.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.4    2e-10   
ref|NP_001056354.1|  Os05g0568000                                     67.8    2e-10   
dbj|BAD95022.1|  beta-ketoacyl-CoA synthase like protein              65.1    2e-10   
gb|AHE13915.1|  fatty acid elongase 1                                 67.4    2e-10   
ref|XP_002282403.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             67.4    2e-10   
ref|XP_010548058.1|  PREDICTED: 3-ketoacyl-CoA synthase 18-like       67.4    2e-10   
ref|XP_009627040.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             67.4    2e-10   
ref|XP_006361008.1|  PREDICTED: 3-ketoacyl-CoA synthase 1-like        67.4    2e-10   
ref|NP_001168833.1|  uncharacterized protein LOC100382638             67.0    2e-10   
gb|EYU41417.1|  hypothetical protein MIMGU_mgv1a004612mg              67.4    2e-10   
ref|XP_006341948.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        67.4    2e-10   
ref|XP_010925903.1|  PREDICTED: 3-ketoacyl-CoA synthase 4-like        67.0    2e-10   
ref|XP_002529285.1|  acyltransferase, putative                        67.0    2e-10   
gb|EMT25176.1|  3-ketoacyl-CoA synthase 4                             66.2    2e-10   
gb|AGK30005.1|  3-ketoacyl-CoA synthase                               67.0    2e-10   
ref|XP_011100666.1|  PREDICTED: 3-ketoacyl-CoA synthase 1             67.4    3e-10   
ref|XP_010925263.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.0    3e-10   
ref|XP_010547021.1|  PREDICTED: probable 3-ketoacyl-CoA synthase 20   67.0    3e-10   
gb|AFW79234.1|  hypothetical protein ZEAMMB73_025891                  67.0    3e-10   
ref|XP_002890689.1|  hypothetical protein ARALYDRAFT_472828           67.0    3e-10   
ref|XP_008219888.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.0    3e-10   
ref|XP_007223150.1|  hypothetical protein PRUPE_ppa004354mg           67.0    3e-10   
ref|XP_010522508.1|  PREDICTED: 3-ketoacyl-CoA synthase 19            67.0    3e-10   
gb|KEH23437.1|  3-ketoacyl-CoA synthase                               67.4    3e-10   
ref|XP_008797159.1|  PREDICTED: 3-ketoacyl-CoA synthase 11-like       67.0    3e-10   
ref|XP_008224439.1|  PREDICTED: 3-ketoacyl-CoA synthase 19            67.0    3e-10   
emb|CDY22336.1|  BnaA06g36580D                                        65.9    3e-10   
gb|EMT01468.1|  3-ketoacyl-CoA synthase 17                            66.6    3e-10   
ref|XP_009760261.1|  PREDICTED: 3-ketoacyl-CoA synthase 4             67.0    3e-10   



>ref|XP_010937298.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Elaeis guineensis]
Length=527

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V GGDR+WQ+ FGSGFKCNSAVWRA+RR+R P  NPWL CI  YP
Sbjct  478  GRVRGGDRVWQLAFGSGFKCNSAVWRAMRRVRWPSRNPWLDCIDRYP  524



>ref|XP_009594847.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Nicotiana tomentosiformis]
Length=536

 Score = 85.5 bits (210),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 41/49 (84%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            K+A GDR+WQI FGSGFKCNSAVW+A+RR++ P  NPW+ C+  YP+++
Sbjct  486  KIARGDRVWQIAFGSGFKCNSAVWKAIRRVKKPSTNPWIDCVDMYPQSL  534



>gb|ADE77445.1| unknown [Picea sitchensis]
Length=486

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVW+A+R + +P  NPWL CIH YP
Sbjct  436  GRVKKGDRVWQIAFGSGFKCNSAVWKALRDVEVPLHNPWLDCIHNYP  482



>ref|XP_008782856.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Phoenix dactylifera]
Length=527

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQ+ FGSGFKCNSAVW A+RR+R P  NPWL CIH YP
Sbjct  478  GRVRRGDRVWQLAFGSGFKCNSAVWSAMRRVRRPTRNPWLDCIHRYP  524



>ref|XP_010692949.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Beta vulgaris subsp. vulgaris]
Length=547

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 34/51 (67%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            GK+  GDR+WQ+ FGSGFKCNSAVW+AVRRI+ P + NPWL CI  YP A+
Sbjct  497  GKIHSGDRIWQLAFGSGFKCNSAVWKAVRRIKKPSSRNPWLSCIDRYPVAL  547



>ref|XP_006361525.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Solanum tuberosum]
Length=540

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            K+  GDR+WQI FGSGFKCNSAVW+A+RR++ P  NPWL C+  YP ++
Sbjct  490  KIRRGDRVWQIAFGSGFKCNSAVWKAIRRVKKPSTNPWLGCVDRYPESL  538



>ref|XP_004245205.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Solanum lycopersicum]
Length=535

 Score = 84.0 bits (206),  Expect = 4e-16, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            K+  GDR+WQI FGSGFKCNSAVW+A+RR++ P  NPWL C+  YP ++
Sbjct  485  KIRRGDRVWQIAFGSGFKCNSAVWKAIRRVKKPSTNPWLGCVDRYPESL  533



>ref|XP_009777333.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Nicotiana sylvestris]
Length=541

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 40/49 (82%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            K+  GDR+WQI FGSGFKCNSAVW+A+RR++ P  NPW+ C+  YP+++
Sbjct  491  KITRGDRVWQIAFGSGFKCNSAVWKAIRRVKKPSTNPWIDCVDMYPQSL  539



>ref|XP_009380021.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Musa acuminata subsp. 
malaccensis]
Length=525

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRA  226
            G+V GGDR+WQI FGSGFKCNSAVW+A RR+R P  +PWL C+  YP  
Sbjct  476  GRVRGGDRVWQIAFGSGFKCNSAVWKATRRVRRPNRSPWLDCVDRYPEG  524



>ref|XP_004291247.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Fragaria vesca subsp. 
vesca]
Length=540

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNS VWR++RR+R P  NPWL CI  YP
Sbjct  492  KVKRGDRVWQLAFGSGFKCNSIVWRSMRRVRKPSRNPWLDCIERYP  537



>ref|XP_007222372.1| hypothetical protein PRUPE_ppa004011mg [Prunus persica]
 gb|EMJ23571.1| hypothetical protein PRUPE_ppa004011mg [Prunus persica]
Length=535

 Score = 81.6 bits (200),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNS VWR++RR+R P  NPWL CI  YP
Sbjct  487  KVKRGDRVWQLAFGSGFKCNSLVWRSMRRVRKPSRNPWLECIERYP  532



>ref|XP_008377531.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Malus domestica]
Length=541

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNS VWR++RR+R P  NPWL CI  YP
Sbjct  493  KVKRGDRVWQLSFGSGFKCNSIVWRSMRRVRKPSRNPWLDCIEXYP  538



>ref|XP_008220603.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Prunus mume]
Length=542

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNS VWR++RR+R P  NPWL CI  YP
Sbjct  494  KVKRGDRVWQLAFGSGFKCNSLVWRSMRRVRKPSRNPWLECIERYP  539



>gb|EPS63712.1| hypothetical protein M569_11072 [Genlisea aurea]
Length=535

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 31/49 (63%), Positives = 37/49 (76%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +V  GDR+WQ+ FGSGFKCNS  W+AVRRIR P  NPW+ CI  YP A+
Sbjct  483  RVRRGDRVWQLAFGSGFKCNSVAWKAVRRIRRPERNPWMDCIERYPHAV  531



>emb|CAC84082.1| putative beta-ketoacyl-CoA synthase [Antirrhinum majus]
Length=526

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRA  226
            G++  GDR+WQ+ FGSGFKCN+ VW+AVR+IR P  NPW+ CI  YPR 
Sbjct  476  GQIKRGDRVWQLSFGSGFKCNTPVWKAVRKIRKPERNPWVDCIDGYPRG  524



>emb|CBI20747.3| unnamed protein product [Vitis vinifera]
Length=377

 Score = 79.3 bits (194),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VWRA+RR++ P +NPWL C+  YP
Sbjct  329  RVKRGDRVWQISFGSGFKCNSLVWRAMRRVKKPSSNPWLDCLDRYP  374



>ref|XP_010939879.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Elaeis guineensis]
Length=525

 Score = 80.5 bits (197),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQ+ FGSGFKCNSAVWRA+RR+R P  NPW  C   YP
Sbjct  476  GRVRRGDRVWQLAFGSGFKCNSAVWRAMRRVRPPTQNPWFGCTDRYP  522



>ref|XP_009359048.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Pyrus x bretschneideri]
Length=541

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GD++WQ+ FGSGFKCNS VWR++RR+R P  NPWL CI  YP
Sbjct  493  KVKRGDKVWQLSFGSGFKCNSIVWRSMRRVRKPSRNPWLDCIERYP  538



>gb|ABG35745.1| putative FIDDLEHEAD very long chain fatty acid condensing enzyme 
FDH;1 [Hordeum vulgare]
 gb|ABV22580.1| fiddlehead [Hordeum vulgare subsp. vulgare]
 gb|ABV22581.1| fiddlehead [Hordeum vulgare subsp. vulgare]
 gb|ABV22587.1| fiddlehead [Hordeum vulgare subsp. vulgare]
Length=540

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 32/47 (68%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQ+ FGSGFKCNSAVWRAV R+R P  +PWL CI  YP
Sbjct  489  GRVRRGDRVWQLAFGSGFKCNSAVWRAVGRVRRPSRSPWLDCIDQYP  535



>ref|XP_008800450.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Phoenix dactylifera]
Length=527

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQ+ FGSGFKCNSAVWRA+RR+R P  +PWL C   YP
Sbjct  478  GRVRRGDRVWQLAFGSGFKCNSAVWRAMRRVRPPSRSPWLGCADRYP  524



>ref|XP_002282234.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Vitis vinifera]
Length=530

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VWRA+RR++ P +NPWL C+  YP
Sbjct  482  RVKRGDRVWQISFGSGFKCNSLVWRAMRRVKKPSSNPWLDCLDRYP  527



>gb|KDO73681.1| hypothetical protein CISIN_1g009313mg [Citrus sinensis]
Length=537

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +V  GDR+WQI FGSGFKCNS VW+A+RR++ P  NPWL C+  YP A+
Sbjct  489  RVKRGDRVWQIAFGSGFKCNSVVWQAMRRVKKPARNPWLDCVDRYPVAL  537



>ref|XP_006474532.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Citrus sinensis]
Length=537

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +V  GDR+WQI FGSGFKCNS VW+A+RR++ P  NPWL C+  YP A+
Sbjct  489  RVKRGDRVWQIAFGSGFKCNSVVWQAMRRVKKPARNPWLDCVDRYPVAL  537



>ref|XP_006452943.1| hypothetical protein CICLE_v10007953mg [Citrus clementina]
 gb|ESR66183.1| hypothetical protein CICLE_v10007953mg [Citrus clementina]
Length=537

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +V  GDR+WQI FGSGFKCNS VW+A+RR++ P  NPWL C+  YP A+
Sbjct  489  RVKRGDRVWQIAFGSGFKCNSVVWQAMRRVKKPARNPWLDCVDRYPVAL  537



>ref|XP_002516167.1| acyltransferase, putative [Ricinus communis]
 gb|EEF46169.1| acyltransferase, putative [Ricinus communis]
Length=532

 Score = 79.0 bits (193),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQI +GSGFKCNS VW+A+RR++ P  NPWL CI  YP
Sbjct  484  RVKRGDRVWQIAYGSGFKCNSLVWKAIRRVKKPSRNPWLHCIDRYP  529



>ref|XP_008347473.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Malus domestica]
Length=208

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 31/46 (67%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNS VWR++RR+R P  NPWL CI  YP
Sbjct  160  KVKRGDRVWQLSFGSGFKCNSIVWRSMRRVRKPSRNPWLDCIEQYP  205



>ref|XP_001753137.1| predicted protein [Physcomitrella patens]
 gb|EDQ82178.1| predicted protein [Physcomitrella patens]
Length=519

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPR  229
            G++  G+R+WQI FGSGFKCNSAVW+A+R I+ P  +PW  CIH YP+
Sbjct  463  GRIRRGNRVWQIAFGSGFKCNSAVWQALRNIKPPEKSPWAHCIHEYPQ  510



>gb|KHN37223.1| 3-ketoacyl-CoA synthase 10 [Glycine soja]
Length=420

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            V  GDR+WQ+ FGSGFKCNS VWRA+RR+  P  NPWL CI+ YP
Sbjct  371  VRRGDRVWQLAFGSGFKCNSVVWRAMRRVTKPSRNPWLDCINRYP  415



>ref|XP_003522322.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Glycine max]
 gb|KHN29660.1| 3-ketoacyl-CoA synthase 10 [Glycine soja]
Length=536

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            V  GDR+WQ+ FGSGFKCNS VWRA+RR+  P  NPWL CI+ YP
Sbjct  487  VRRGDRVWQLAFGSGFKCNSVVWRAMRRVTKPSRNPWLDCINRYP  531



>ref|XP_007136914.1| hypothetical protein PHAVU_009G084500g [Phaseolus vulgaris]
 gb|ESW08908.1| hypothetical protein PHAVU_009G084500g [Phaseolus vulgaris]
Length=534

 Score = 78.2 bits (191),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            V  GDR+WQ+ FGSGFKCNS VWRA+RR+  P  NPWL CI+ YP
Sbjct  486  VRRGDRVWQLAFGSGFKCNSVVWRAMRRVTKPSRNPWLDCINRYP  530



>ref|XP_003526086.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Glycine max]
Length=535

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 30/45 (67%), Positives = 35/45 (78%), Gaps = 0/45 (0%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            V  GDR+WQ+ FGSGFKCNS VWRA+RR+  P  NPWL CI+ YP
Sbjct  486  VRRGDRVWQLAFGSGFKCNSVVWRAMRRVTKPSRNPWLDCINRYP  530



>ref|XP_008351945.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Malus domestica]
Length=541

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNS VWR++RR+R    NPWL CI  YP
Sbjct  493  KVKRGDRVWQLSFGSGFKCNSIVWRSMRRVRKSSRNPWLDCIEKYP  538



>emb|CDP17887.1| unnamed protein product [Coffea canephora]
Length=531

 Score = 77.8 bits (190),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            ++  GDR+WQI FGSGFKCNSAVWR++RR+  P  NPWL CI  YP
Sbjct  482  RIKRGDRVWQISFGSGFKCNSAVWRSMRRVWSPSRNPWLDCIDRYP  527



>ref|XP_011081956.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Sesamum indicum]
Length=533

 Score = 77.8 bits (190),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQ+ FGSGFKCNS VW+++R+IR P  NPWL CI  YP
Sbjct  482  RVKRGDRVWQLAFGSGFKCNSVVWKSLRKIRRPSRNPWLDCIDRYP  527



>ref|XP_004501406.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Cicer arietinum]
Length=538

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 40/50 (80%), Gaps = 1/50 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            KV  GDR+WQ+ FGSGFKCNSAVWR++RR+  P + NPWL C++ YP ++
Sbjct  488  KVKRGDRVWQLAFGSGFKCNSAVWRSMRRVTKPSSRNPWLDCVNNYPVSL  537



>gb|EYU21968.1| hypothetical protein MIMGU_mgv1a004214mg [Erythranthe guttata]
Length=539

 Score = 77.4 bits (189),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQ+ FGSGFKCNS VW+++RRIR P  NPWL C+  YP
Sbjct  487  RVKRGDRVWQLGFGSGFKCNSVVWKSMRRIRRPLRNPWLDCVERYP  532



>ref|XP_002977865.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
 gb|EFJ21203.1| hypothetical protein SELMODRAFT_443640 [Selaginella moellendorffii]
Length=510

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G+V  GDR+WQI FGSGFKCNSAVWRA+R I+ P   PW  CI  YP  I
Sbjct  455  GRVKRGDRVWQIAFGSGFKCNSAVWRALRSIKPPSHGPWEDCIDKYPVRI  504



>ref|XP_002979460.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
 gb|EFJ19349.1| hypothetical protein SELMODRAFT_444233 [Selaginella moellendorffii]
Length=510

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 32/50 (64%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G+V  GDR+WQI FGSGFKCNSAVWRA+R I+ P   PW  CI  YP  I
Sbjct  455  GRVKRGDRVWQIAFGSGFKCNSAVWRALRSIKPPSHGPWEDCIDKYPVRI  504



>ref|XP_003603250.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES73501.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=537

 Score = 77.0 bits (188),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            KV  GDR+WQ+ FGSGFKCNSAVWR++RR+  P + NPWL CI  YP ++
Sbjct  487  KVKRGDRVWQLAFGSGFKCNSAVWRSMRRVTKPSSRNPWLDCIDAYPASL  536



>ref|XP_007012476.1| 3-ketoacyl-CoA synthase 10 [Theobroma cacao]
 gb|EOY30095.1| 3-ketoacyl-CoA synthase 10 [Theobroma cacao]
Length=554

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 32/49 (65%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRA  226
            +V  GDR+WQI FGSGFKCNS VWR++RR+R P   NPWL CI  YP A
Sbjct  505  RVKRGDRIWQIAFGSGFKCNSVVWRSMRRVRKPSRNNPWLDCIDRYPVA  553



>gb|AAP74371.1| FAE1 [Marchantia polymorpha]
Length=527

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI FGSGFKCNSAVW+AVR ++ P   PW  CI +YP  I
Sbjct  472  GRMKKGDRVWQIAFGSGFKCNSAVWQAVRTLKPPARGPWTHCIDSYPVKI  521



>ref|XP_008775195.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 6-like 
[Phoenix dactylifera]
Length=496

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CIH YP  I
Sbjct  441  GRMRRGDRVWQIGFGSGFKCNSAVWKCIRTIKTPVDGPWFDCIHHYPVPI  490



>gb|KHG14239.1| 3-ketoacyl-CoA synthase 10 -like protein [Gossypium arboreum]
Length=535

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VWR++RR+R P   NPWL CI  YP
Sbjct  486  RVKRGDRIWQIAFGSGFKCNSVVWRSMRRVRKPSRDNPWLDCIDRYP  532



>gb|AAL67993.1| fiddlehead-like protein [Gossypium hirsutum]
Length=535

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 1/47 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VWR++RR+R P   NPWL CI  YP
Sbjct  486  RVKRGDRIWQIAFGSGFKCNSVVWRSMRRVRKPSRDNPWLDCIDRYP  532



>gb|EYU44641.1| hypothetical protein MIMGU_mgv1a005164mg [Erythranthe guttata]
Length=495

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CIH YP
Sbjct  440  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPADGPWTDCIHRYP  486



>ref|XP_010049293.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Eucalyptus grandis]
 gb|KCW81820.1| hypothetical protein EUGRSUZ_C03177 [Eucalyptus grandis]
Length=530

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +V  GDR+WQI FGSGFKCNS VW+++RR+R P  +PWL C+  YP A+
Sbjct  482  RVRRGDRVWQIAFGSGFKCNSLVWKSMRRVRKPNKSPWLDCVDRYPVAL  530



>ref|XP_002282526.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=496

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSA+W+  R I  P   PWL CIH YP
Sbjct  441  GRMKKGDRIWQIAFGSGFKCNSAIWKCNRSIEPPRDGPWLDCIHRYP  487



>ref|XP_002969546.1| hypothetical protein SELMODRAFT_91671 [Selaginella moellendorffii]
 gb|EFJ29634.1| hypothetical protein SELMODRAFT_91671 [Selaginella moellendorffii]
Length=517

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            ++  GDR+WQI FGSGFKCNS VWRA R +  P  NPWL C+H YP
Sbjct  460  RIRRGDRVWQIAFGSGFKCNSVVWRATRNLDKPYRNPWLDCLHRYP  505



>ref|XP_010273876.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Nelumbo nucifera]
Length=526

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 36/49 (73%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            KV  GDR+WQ+ FGSGFKCNS VWR++RR+R    NPW  CI  YP A+
Sbjct  478  KVRRGDRVWQLAFGSGFKCNSVVWRSLRRVRKTNRNPWFDCIDRYPVAL  526



>ref|XP_010098399.1| 3-ketoacyl-CoA synthase 10 [Morus notabilis]
 gb|EXB74923.1| 3-ketoacyl-CoA synthase 10 [Morus notabilis]
Length=542

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            +V  GDR+WQ+ FGSGFKCNS VWR++RR+R P   NPWL CI +YP ++
Sbjct  493  RVKRGDRVWQLSFGSGFKCNSVVWRSLRRVRKPSGNNPWLDCIDSYPVSL  542



>ref|XP_010916172.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=496

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CIH YP
Sbjct  441  GRMRRGDRVWQIGFGSGFKCNSAVWKCIRTIKTPVDGPWADCIHRYP  487



>gb|KDP28427.1| hypothetical protein JCGZ_14198 [Jatropha curcas]
Length=529

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 40/55 (73%), Gaps = 2/55 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRM--PXANPWLXCIHTYPRAI*LG  214
            G+V+GGDR+WQI FGSGFKCNSAVW+A+R I +     NPW   IH YP  + +G
Sbjct  475  GRVSGGDRIWQIAFGSGFKCNSAVWKALRAIPLGEEMGNPWADSIHRYPVKVPVG  529



>gb|AAO47729.1| fiddlehead-like protein [Tropaeolum majus]
 gb|AAP14903.1| fiddlehead-like protein [Tropaeolum majus]
Length=538

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/46 (65%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VWR++RR+R P  NPWL  I  YP
Sbjct  490  RVKRGDRIWQISFGSGFKCNSLVWRSMRRVRKPNRNPWLDWIDRYP  535



>ref|XP_008452803.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 10 [Cucumis 
melo]
Length=531

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQ+ FGSGFKCNS VWR++RR R P  +PWL CI  YP
Sbjct  483  RVKSGDRIWQLAFGSGFKCNSLVWRSMRRNRKPARSPWLDCIDRYP  528



>ref|XP_004168381.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Cucumis sativus]
Length=531

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQ+ FGSGFKCNS VWR++RR R P  +PWL CI  YP
Sbjct  483  RVKSGDRIWQLAFGSGFKCNSLVWRSMRRNRKPARSPWLDCIDRYP  528



>ref|XP_004141352.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Cucumis sativus]
 gb|KGN55394.1| hypothetical protein Csa_4G649640 [Cucumis sativus]
Length=531

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQ+ FGSGFKCNS VWR++RR R P  +PWL CI  YP
Sbjct  483  RVKSGDRIWQLAFGSGFKCNSLVWRSMRRNRKPARSPWLDCIDRYP  528



>gb|AGK29999.1| 3-ketoacyl-CoA synthase 13 [Gossypium raimondii]
Length=492

 Score = 75.9 bits (185),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CIH YP
Sbjct  437  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWADCIHRYP  483



>ref|XP_007153392.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
 gb|ESW25386.1| hypothetical protein PHAVU_003G031300g [Phaseolus vulgaris]
Length=543

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I  P   PW  CIH+YP
Sbjct  488  GRMKRGDRVWQIAFGSGFKCNSAVWKCNRSIETPFDGPWSDCIHSYP  534



>ref|XP_010692961.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=490

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSA+W+  R I+ P   PW  CIH YP
Sbjct  435  GRMKKGDRVWQIAFGSGFKCNSAIWKCNRTIKAPTEGPWDDCIHRYP  481



>ref|XP_003549437.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max]
Length=513

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW+A+R +R     PW  CIH YP  I
Sbjct  462  GRIKKGNRIWQIAFGSGFKCNSAVWQALRNVRPSPNGPWEDCIHKYPVEI  511



>gb|AGK30000.1| 3-ketoacyl-CoA synthase 5 [Gossypium raimondii]
Length=496

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CIH YP
Sbjct  441  GRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKKPTDGPWEDCIHRYP  487



>gb|KJB16229.1| hypothetical protein B456_002G218500 [Gossypium raimondii]
Length=508

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CIH YP
Sbjct  437  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWADCIHRYP  483



>ref|XP_009362990.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Pyrus x bretschneideri]
Length=561

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNS VWR++R +R    NPWL CI  YP
Sbjct  513  KVKRGDRVWQLSFGSGFKCNSIVWRSMRHVRKSSRNPWLDCIEKYP  558



>dbj|BAJ87894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=540

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQ+ FGSGFK NSAVWRAV R+R P  +PWL CI  YP
Sbjct  489  GRVRRGDRVWQLAFGSGFKYNSAVWRAVGRVRRPSRSPWLDCIDQYP  535



>ref|XP_006344141.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=493

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+ P   PW  CIH YP
Sbjct  438  GRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPSDGPWSDCIHKYP  484



>ref|XP_002271250.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Vitis vinifera]
Length=492

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI FGSGFKCNSAVW+  R I  P   PWL CI  YP +I
Sbjct  437  GRMKKGDRIWQIAFGSGFKCNSAVWKCNRTITTPTDGPWLDCIGRYPVSI  486



>emb|CAN63425.1| hypothetical protein VITISV_040442 [Vitis vinifera]
Length=492

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI FGSGFKCNSAVW+  R I  P   PWL CI  YP +I
Sbjct  437  GRMKKGDRIWQIAFGSGFKCNSAVWKCNRTITTPTDGPWLDCIGRYPVSI  486



>ref|XP_002970815.1| hypothetical protein SELMODRAFT_94459 [Selaginella moellendorffii]
 gb|EFJ28141.1| hypothetical protein SELMODRAFT_94459 [Selaginella moellendorffii]
Length=517

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            ++  GDR+WQI FGSGFKCNS VW+A R +  P  NPWL C+H YP
Sbjct  460  RIRRGDRVWQIAFGSGFKCNSVVWKATRNLDKPYRNPWLDCLHRYP  505



>ref|XP_006284916.1| hypothetical protein CARUB_v10006212mg [Capsella rubella]
 gb|EOA17814.1| hypothetical protein CARUB_v10006212mg [Capsella rubella]
Length=481

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G+V  G+R+WQI FGSGFKCNSAVW A+R ++    NPW  CIH YP  I
Sbjct  430  GRVRKGNRVWQIAFGSGFKCNSAVWVALRDVKPSVNNPWQHCIHRYPVKI  479



>ref|XP_011037520.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G+V  GDR+WQI FGSGFKCNSAVW A+R ++   +NPW  CI  YP  I
Sbjct  459  GRVRRGDRVWQIAFGSGFKCNSAVWEALRYVKPSTSNPWEDCIDKYPVQI  508



>ref|XP_010681548.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Beta vulgaris subsp. 
vulgaris]
Length=492

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXAN-PWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ ++ ++ P  + PWL CIH YP
Sbjct  436  GRMNKGDRVWQIAFGSGFKCNSAVWKCLKTVKTPIKDSPWLDCIHKYP  483



>gb|KJB82945.1| hypothetical protein B456_013G221500 [Gossypium raimondii]
Length=548

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VWR++RR+R P   NPWL C   YP
Sbjct  499  RVKRGDRIWQIAFGSGFKCNSVVWRSMRRVRKPSRDNPWLDCTDRYP  545



>ref|XP_010265150.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nelumbo nucifera]
Length=497

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI FGSGFKCNS VW+  R IR P  +PW  CIH YP  I
Sbjct  441  GRMKKGDRIWQIGFGSGFKCNSVVWKCNRNIRPPVDSPWSECIHRYPVKI  490



>gb|AGK30017.1| 3-ketoacyl-CoA synthase 8 [Gossypium raimondii]
Length=535

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VWR++RR+R P   NPWL C   YP
Sbjct  486  RVKRGDRIWQIAFGSGFKCNSVVWRSMRRVRKPSRDNPWLDCTDRYP  532



>gb|ABU75309.2| fiddlehead-like protein [Pisum sativum]
Length=548

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 1/47 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            KV  GDR+WQ+ FGSGFKCNSAVWR++ R+  P + NPWL CI+ YP
Sbjct  498  KVKRGDRVWQLAFGSGFKCNSAVWRSMGRVAKPTSRNPWLDCINAYP  544



>ref|XP_009390873.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Musa acuminata subsp. 
malaccensis]
Length=537

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRI-RMPXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVW+A+RR+ R+   NPWL C   YP
Sbjct  487  GRVRRGDRVWQIAFGSGFKCNSAVWKAMRRVPRLSTNNPWLDCADRYP  534



>ref|XP_009115318.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Brassica rapa]
Length=497

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            GK+  GDR+WQI FGSGFKCNSAVW++ R I+ P   PW  CI  YP
Sbjct  442  GKMKRGDRVWQIAFGSGFKCNSAVWKSNRTIKTPTEGPWSDCIDRYP  488



>emb|CDY42109.1| BnaA09g28510D [Brassica napus]
Length=497

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            GK+  GDR+WQI FGSGFKCNSAVW++ R I+ P   PW  CI  YP
Sbjct  442  GKMKRGDRVWQIAFGSGFKCNSAVWKSNRTIKTPTEGPWSDCIDRYP  488



>ref|XP_004238923.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum lycopersicum]
Length=494

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I  P   PW  CIH YP
Sbjct  439  GRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIETPTDGPWSDCIHKYP  485



>ref|XP_009390357.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score = 74.3 bits (181),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CIH YP
Sbjct  441  GRMRRGDRVWQIGFGSGFKCNSAVWKCMRTVKTPIDGPWSECIHRYP  487



>ref|XP_008802438.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Phoenix dactylifera]
Length=497

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW+ +R I+ P   PW  CIH YP
Sbjct  442  GRMRRGNRVWQIGFGSGFKCNSAVWKCIRTIKTPVDGPWADCIHRYP  488



>ref|NP_001130497.1| uncharacterized protein LOC100191595 [Zea mays]
 gb|ACF78737.1| unknown [Zea mays]
Length=494

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CIH YP
Sbjct  439  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIHRYP  485



>ref|XP_002465630.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
 gb|EER92628.1| hypothetical protein SORBIDRAFT_01g042600 [Sorghum bicolor]
Length=494

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CIH YP
Sbjct  439  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIHRYP  485



>ref|XP_008668455.1| PREDICTED: uncharacterized protein LOC100191595 isoform X1 [Zea 
mays]
 gb|ACF87925.1| unknown [Zea mays]
 gb|ACN34702.1| unknown [Zea mays]
 tpg|DAA44124.1| TPA: hypothetical protein ZEAMMB73_292233 [Zea mays]
Length=494

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CIH YP
Sbjct  439  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIHRYP  485



>gb|AGK29998.1| 3-ketoacyl-CoA synthase 9 [Gossypium raimondii]
 gb|KJB12202.1| hypothetical protein B456_002G005700 [Gossypium raimondii]
Length=504

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQ+ FGSGFKCNSAVW A++ ++    NPW  CIH YP
Sbjct  453  GRMRKGDRIWQVAFGSGFKCNSAVWLALKNVKPSCGNPWEDCIHKYP  499



>ref|XP_011097190.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW+ CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPVDGPWVDCIERYP  487



>ref|XP_009779121.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nicotiana sylvestris]
Length=511

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW+A+R +R    +PW  CIH YP
Sbjct  460  GRIQRGHRIWQIAFGSGFKCNSAVWQALRNVRPSPNSPWEDCIHRYP  506



>ref|XP_007042184.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
 gb|EOX98015.1| 3-ketoacyl-CoA synthase 4 [Theobroma cacao]
Length=507

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW A+R ++    NPW  CIH YP
Sbjct  456  GRMRKGNRVWQIAFGSGFKCNSAVWVAIRNVKPSPNNPWEECIHRYP  502



>ref|XP_006651174.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Oryza brachyantha]
Length=526

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CIH YP
Sbjct  471  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKAPTGGPWDDCIHRYP  517



>gb|AAO48425.1| beta-ketoacyl-CoA-synthase [Marchantia polymorpha]
Length=537

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDRLWQI FGSGFKCNSAVWRA+R ++ P  +PW   I ++P
Sbjct  480  GRVRRGDRLWQIAFGSGFKCNSAVWRALRTVKSPKQSPWADEIDSFP  526



>ref|XP_011076851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=496

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPVEGPWADCIDKYP  487



>gb|KDP34003.1| hypothetical protein JCGZ_07574 [Jatropha curcas]
Length=542

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            +V  GDR+WQI FGSGFKCNS VW+++RR++    NPW  CI  YP
Sbjct  490  RVKRGDRVWQIAFGSGFKCNSLVWKSMRRVKKASTNPWFDCIDRYP  535



>gb|AFK40996.1| unknown [Medicago truncatula]
Length=371

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/50 (62%), Positives = 39/50 (78%), Gaps = 1/50 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            KV  GDR+WQ+ FGSGFKCNSAVWR++RR+  P + NPWL CI  YP ++
Sbjct  321  KVKRGDRVWQLAFGSGFKCNSAVWRSMRRVTKPSSRNPWLDCIDAYPASL  370



>ref|XP_003558474.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Brachypodium distachyon]
Length=497

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CIH YP
Sbjct  442  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPTDGPWDDCIHRYP  488



>ref|XP_002869143.1| 3-ketoacyl-CoA synthase 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45402.1| 3-ketoacyl-CoA synthase 2 [Arabidopsis lyrata subsp. lyrata]
Length=487

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW A+R ++    NPW  CIH YP  I
Sbjct  436  GRMRKGNRVWQIAFGSGFKCNSAVWVALRDVKPSVNNPWEHCIHRYPVKI  485



>ref|XP_010926125.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=497

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CIH YP
Sbjct  442  GRMRRGDRVWQIGFGSGFKCNSAVWKCNRTIKTPVDGPWADCIHRYP  488



>ref|XP_006412219.1| hypothetical protein EUTSA_v10025028mg [Eutrema salsugineum]
 gb|ESQ53672.1| hypothetical protein EUTSA_v10025028mg [Eutrema salsugineum]
Length=489

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW A+R ++    NPW  CIH YP  I
Sbjct  438  GRMRQGNRVWQIAFGSGFKCNSAVWVALRDVKPSVNNPWEHCIHRYPVKI  487



>gb|ABK24632.1| unknown [Picea sitchensis]
Length=530

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            ++  GDR+WQI FGSGFKCNSAVW+ +R ++    NPWL C+  YP  I
Sbjct  476  QIKKGDRVWQIAFGSGFKCNSAVWKTLRTVKRSTKNPWLDCVDRYPVEI  524



>gb|EYU32293.1| hypothetical protein MIMGU_mgv1a004078mg [Erythranthe guttata]
Length=545

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 36/50 (72%), Gaps = 3/50 (6%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRI---RMPXANPWLXCIHTYP  232
            G+V+ G+R+WQI FGSGFKCNSAVW+A+R I     P  NPW  CI  YP
Sbjct  485  GRVSRGNRVWQIAFGSGFKCNSAVWKALRDIPAKDCPSTNPWFDCIDNYP  534



>ref|XP_003531926.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
 gb|KHN14249.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=496

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVWR  R I+ P   PW  CI  YP
Sbjct  441  GRMKRGDRVWQIAFGSGFKCNSAVWRCNRSIQTPFDGPWADCIDRYP  487



>ref|XP_001769764.1| predicted protein [Physcomitrella patens]
 gb|EDQ65326.1| predicted protein [Physcomitrella patens]
Length=528

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVWRA+R I  P  NPW   I  YP
Sbjct  447  GRVKKGDRIWQIAFGSGFKCNSAVWRALRTIAPPALNPWDGIIDQYP  493



>ref|NP_001049406.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|ABF94686.1| very-long-chain fatty acid condensing enzyme, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF11320.1| Os03g0220100 [Oryza sativa Japonica Group]
 gb|EAY89070.1| hypothetical protein OsI_10556 [Oryza sativa Indica Group]
 gb|EAZ26093.1| hypothetical protein OsJ_09950 [Oryza sativa Japonica Group]
 dbj|BAG90041.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96897.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97602.1| unnamed protein product [Oryza sativa Japonica Group]
Length=494

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CIH YP
Sbjct  439  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPADGPWDDCIHRYP  485



>ref|XP_010054134.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Eucalyptus grandis]
 gb|KCW78506.1| hypothetical protein EUGRSUZ_D02646 [Eucalyptus grandis]
Length=557

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/50 (62%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA---NPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVW+A+R          NPWL CIH YP
Sbjct  486  GRVRSGDRVWQIAFGSGFKCNSAVWKALRGTSASDCGPNNPWLHCIHRYP  535



>emb|CDX77038.1| BnaC04g38330D [Brassica napus]
Length=532

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 38/49 (78%), Gaps = 1/49 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP A+
Sbjct  484  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCINRYPVAL  532



>ref|XP_003637444.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|KEH44222.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPIDGPWTDCIDRYP  487



>gb|KFK32520.1| hypothetical protein AALP_AA6G253600 [Arabis alpina]
Length=547

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  499  VRSGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYP  544



>ref|NP_195177.1| 3-ketoacyl-CoA synthase 17 [Arabidopsis thaliana]
 sp|O65677.1|KCS2_ARATH RecName: Full=Probable 3-ketoacyl-CoA synthase 2; Short=KCS-2; 
AltName: Full=Very long-chain fatty acid condensing enzyme 
2; Short=VLCFA condensing enzyme 2 [Arabidopsis thaliana]
 emb|CAA18830.1| putative ketoacyl-CoA synthase [Arabidopsis thaliana]
 emb|CAB80168.1| putative ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AEE86387.1| 3-ketoacyl-CoA synthase 17 [Arabidopsis thaliana]
Length=487

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW A+R +     NPW  CIH YP  I
Sbjct  436  GRMRKGNRVWQIAFGSGFKCNSAVWVALRNVEPSVNNPWEHCIHRYPVKI  485



>emb|CDY46243.1| BnaC03g66040D [Brassica napus]
Length=474

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW A+R +     NPW  CIH YP  I
Sbjct  423  GRMRKGNRVWQIAFGSGFKCNSAVWVALRDVEPSVKNPWEYCIHRYPVKI  472



>ref|XP_011088403.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like isoform X1 [Sesamum 
indicum]
Length=506

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW+A+R ++   ++PWL C+  YP
Sbjct  455  GRIKKGQRVWQIAFGSGFKCNSAVWQALRNVKPSASSPWLDCVDRYP  501



>ref|XP_003555901.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Glycine max]
Length=496

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYP  487



>ref|XP_009108847.1| PREDICTED: probable 3-ketoacyl-CoA synthase 2 [Brassica rapa]
Length=474

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW A+R +     NPW  CIH YP  I
Sbjct  423  GRMRKGNRVWQIAFGSGFKCNSAVWVALRDVEPSVKNPWEHCIHRYPVKI  472



>emb|CDX76286.1| BnaA08g11140D [Brassica napus]
Length=474

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW A+R +     NPW  CIH YP  I
Sbjct  423  GRMRKGNRVWQIAFGSGFKCNSAVWVALRDVEPSVKNPWEHCIHRYPVKI  472



>ref|XP_003536684.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Glycine max]
Length=496

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYP  487



>ref|XP_002305431.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
 gb|EEE85942.1| hypothetical protein POPTR_0004s16290g [Populus trichocarpa]
Length=510

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G+V  G+R+WQI FGSGFKCNSAVW A+R ++   +NPW  CI  YP  I
Sbjct  459  GRVRRGNRVWQIAFGSGFKCNSAVWEALRYVKPSTSNPWEDCIDKYPVQI  508



>ref|XP_011088405.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like isoform X2 [Sesamum 
indicum]
Length=452

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW+A+R ++   ++PWL C+  YP
Sbjct  401  GRIKKGQRVWQIAFGSGFKCNSAVWQALRNVKPSASSPWLDCVDRYP  447



>ref|XP_001753229.1| predicted protein [Physcomitrella patens]
 gb|EDQ81858.1| predicted protein [Physcomitrella patens]
Length=532

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW+A+R I+ P  +PW  CI  YP
Sbjct  473  GRMKKGHRVWQIAFGSGFKCNSAVWQALRSIKPPKQSPWAHCIDQYP  519



>ref|XP_009786212.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Nicotiana sylvestris]
Length=496

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWQDCIDRYP  487



>ref|XP_002992903.1| hypothetical protein SELMODRAFT_43379, partial [Selaginella moellendorffii]
 gb|EFJ05992.1| hypothetical protein SELMODRAFT_43379, partial [Selaginella moellendorffii]
Length=434

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            G+V  GDRLWQ+  GSGFKCNSAVWRA+R I  P + NPWL CI  YP
Sbjct  383  GRVRYGDRLWQLGVGSGFKCNSAVWRAIRDIDRPKSMNPWLDCIDEYP  430



>gb|KHN05569.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=461

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  406  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYP  452



>ref|XP_002980157.1| hypothetical protein SELMODRAFT_53281, partial [Selaginella moellendorffii]
 gb|EFJ19027.1| hypothetical protein SELMODRAFT_53281, partial [Selaginella moellendorffii]
Length=434

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            G+V  GDRLWQ+  GSGFKCNSAVWRA+R I  P + NPWL CI  YP
Sbjct  383  GRVRYGDRLWQLGVGSGFKCNSAVWRAIRDIDRPKSMNPWLDCIDEYP  430



>gb|KHN11421.1| 3-ketoacyl-CoA synthase 6 [Glycine soja]
Length=460

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  405  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVDGPWADCIDRYP  451



>ref|XP_011048431.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Populus euphratica]
Length=510

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +V  GDR+WQI FGSGFKCNSA+W A+R ++   +NPW  CI  YP  I
Sbjct  460  RVRRGDRVWQIAFGSGFKCNSAIWEALRHVKPSSSNPWQDCIDRYPVQI  508



>ref|XP_011099559.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Sesamum indicum]
Length=496

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWQDCIDRYP  487



>ref|XP_010477925.1| PREDICTED: 3-ketoacyl-CoA synthase 5-like [Camelina sativa]
Length=492

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++   DR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CI  YP
Sbjct  437  GRMKRSDRVWQIAFGSGFKCNSAVWKCIRTIKTPTDGPWSDCIERYP  483



>ref|XP_010499108.1| PREDICTED: 3-ketoacyl-CoA synthase 5 [Camelina sativa]
Length=492

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++   DR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CI  YP
Sbjct  437  GRMKRSDRVWQIAFGSGFKCNSAVWKCIRTIKTPTDGPWSDCIERYP  483



>gb|AGH32920.1| ketoacyl-CoA synthase [Camellia chekiangoleosa]
Length=517

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW+A+R ++ P   PW  CI  YP
Sbjct  466  GRMRKGHRVWQIAFGSGFKCNSAVWKALRNVKQPRNGPWEDCIDKYP  512



>ref|XP_009630522.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nicotiana tomentosiformis]
Length=512

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW A+R +R    +PW  CIH YP
Sbjct  461  GRIQRGHRIWQIAFGSGFKCNSAVWLALRNVRPSPNSPWEDCIHRYP  507



>gb|ABA01490.1| 3-ketoacyl-CoA synthase [Gossypium hirsutum]
Length=492

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP  I
Sbjct  437  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWADCIQGYPAHI  486



>ref|XP_011088406.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Sesamum indicum]
Length=498

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G R+WQI FGSGFKCNSAVW+A+R ++    +PWL CI  YP  I
Sbjct  447  GRIRKGQRVWQIAFGSGFKCNSAVWQALRNVKPSANSPWLDCIDRYPVKI  496



>gb|AIE57499.1| KCS6 [Camelina sativa]
Length=492

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++   DR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CI  YP
Sbjct  437  GRMKRNDRVWQIAFGSGFKCNSAVWKCIRTIKTPTDGPWSDCIERYP  483



>ref|XP_004306622.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Fragaria vesca subsp. 
vesca]
Length=536

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRM--PXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVWRA+R +       NPW+ CI  YP
Sbjct  481  GRVGRGDRIWQIAFGSGFKCNSAVWRAIRPVVEGDQLGNPWMDCIDRYP  529



>ref|NP_195151.1| 3-ketoacyl-CoA synthase 16 [Arabidopsis thaliana]
 sp|Q9SYZ0.1|KCS16_ARATH RecName: Full=3-ketoacyl-CoA synthase 16; Short=KCS-16; AltName: 
Full=Very long-chain fatty acid condensing enzyme 16; Short=VLCFA 
condensing enzyme 16; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB36702.1| fatty acid elongase-like protein [Arabidopsis thaliana]
 emb|CAB80142.1| fatty acid elongase-like protein [Arabidopsis thaliana]
 dbj|BAF01126.1| fatty acid elongase - like protein [Arabidopsis thaliana]
 gb|ABP88112.1| At4g34250 [Arabidopsis thaliana]
 gb|AEE86348.1| 3-ketoacyl-CoA synthase 16 [Arabidopsis thaliana]
Length=493

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  438  GRMTKGDRIWQIALGSGFKCNSSVWVALRNVKPSTNNPWEQCLHKYPVEI  487



>ref|XP_004232364.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=496

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWDDCIDRYP  487



>gb|AGK30003.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=418

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW A++ ++    +PW  CIH YP
Sbjct  367  GRMRKGDRVWQIAFGSGFKCNSAVWLALKNVKPSYNSPWEGCIHRYP  413



>ref|XP_006363119.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
 gb|ACF17125.1| CER6 [Solanum tuberosum]
Length=496

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWDDCIDRYP  487



>gb|ACT21783.1| CER6 [Solanum lycopersicum]
Length=496

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWDDCIDRYP  487



>ref|XP_002313793.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
 gb|EEE87748.1| hypothetical protein POPTR_0009s11940g [Populus trichocarpa]
Length=510

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 34/49 (69%), Gaps = 0/49 (0%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +V  GDR+WQI FGSGFKCNSA+W A+R I+    NPW  CI  YP  I
Sbjct  460  RVRRGDRIWQIAFGSGFKCNSAIWEALRHIKPSSNNPWQDCIDRYPVQI  508



>gb|AFG67884.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67885.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67886.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67887.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67888.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67889.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67890.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67891.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67892.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67893.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67894.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67895.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67896.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67897.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67898.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
 gb|AFG67899.1| hypothetical protein 2_1205_02, partial [Pinus taeda]
Length=54

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            +  GDR+WQI FGSGFKCNSAVW+ +R ++    NPWL C+  YP  I
Sbjct  1    IKKGDRVWQIAFGSGFKCNSAVWKTLRTVKRSTKNPWLDCVDRYPVEI  48



>emb|CDY11498.1| BnaA09g40640D [Brassica napus]
Length=548

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI  YP A+
Sbjct  500  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCISRYPVAL  548



>ref|XP_006346917.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=496

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWQHCIDKYP  487



>ref|XP_006408788.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
 gb|ESQ50241.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
Length=421

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  373  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCINRYP  418



>ref|XP_006375382.1| hypothetical protein POPTR_0014s10010g [Populus trichocarpa]
 gb|ERP53179.1| hypothetical protein POPTR_0014s10010g [Populus trichocarpa]
Length=525

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRM--PXANPWLXCIHTYP  232
            G+V+GGDR+WQI FGSGFKCNSAVW+A+R+I       NPW+  I  YP
Sbjct  471  GRVSGGDRVWQIAFGSGFKCNSAVWKALRKIPAGESKGNPWIDSIDRYP  519



>ref|XP_010436266.1| PREDICTED: 3-ketoacyl-CoA synthase 16-like [Camelina sativa]
Length=404

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  343  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEECLHRYPVEI  392



>ref|XP_006415873.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
 gb|ESQ34226.1| hypothetical protein EUTSA_v10007453mg [Eutrema salsugineum]
Length=496

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKRGDRVWQIAFGSGFKCNSAVWKCNRTIKSPTEGPWSDCIDRYP  487



>ref|XP_004497096.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Cicer arietinum]
Length=496

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P    W  CIH YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPVDGAWSDCIHRYP  487



>ref|XP_003614634.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|AES97592.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=496

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKRGDRVWQIAFGSGFKCNSAVWKCNRSIKTPVNGPWEDCIDRYP  487



>gb|KCW55362.1| hypothetical protein EUGRSUZ_I01277 [Eucalyptus grandis]
Length=462

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW+A+R +    ++PW  CIH YP
Sbjct  411  GRMRRGNRVWQIAFGSGFKCNSAVWQALRNVTPSPSSPWEDCIHKYP  457



>gb|AGK30016.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
Length=493

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW A++ ++    +PW  CIH YP
Sbjct  442  GRMRKGDRIWQIAFGSGFKCNSAVWLALKNVKPSCNSPWEGCIHRYP  488



>ref|XP_009117027.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Brassica rapa]
Length=547

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI  YP A+
Sbjct  499  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCISRYPVAL  547



>gb|KJB12199.1| hypothetical protein B456_002G005500 [Gossypium raimondii]
Length=493

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW A++ ++    +PW  CIH YP
Sbjct  442  GRMRKGDRIWQIAFGSGFKCNSAVWLALKNVKPSCNSPWEGCIHRYP  488



>ref|XP_011099560.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Sesamum indicum]
Length=497

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWQDCIDRYP  488



>ref|XP_002963631.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
 gb|EFJ35502.1| hypothetical protein SELMODRAFT_79947 [Selaginella moellendorffii]
Length=534

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVWRA+R I+     PW  CI  +P AI
Sbjct  478  GRMRKGNRVWQIAFGSGFKCNSAVWRALRTIKASEKGPWADCIDQFPVAI  527



>gb|KDP29403.1| hypothetical protein JCGZ_18324 [Jatropha curcas]
Length=496

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRSIKTPLDGPWADCIDRYP  487



>ref|XP_009140735.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA synthase 10-like 
[Brassica rapa]
Length=549

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI  YP A+
Sbjct  501  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCIDRYPVAL  549



>ref|XP_001759085.1| predicted protein [Physcomitrella patens]
 gb|EDQ76154.1| predicted protein [Physcomitrella patens]
Length=536

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/47 (64%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVWRA+R I+ P  NPW   I   P
Sbjct  467  GRVQRGDRVWQIAFGSGFKCNSAVWRAMRTIQPPALNPWNDVIDKLP  513



>emb|CDY35309.1| BnaA04g15380D [Brassica napus]
Length=549

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI  YP A+
Sbjct  501  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCIDRYPVAL  549



>ref|XP_011039108.1| PREDICTED: 3-ketoacyl-CoA synthase 1-like [Populus euphratica]
Length=526

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/49 (61%), Positives = 37/49 (76%), Gaps = 2/49 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRM--PXANPWLXCIHTYP  232
            G+V+GGDR+WQI FGSGFKCNSAVW+A+R+I       NPW+  I  YP
Sbjct  472  GRVSGGDRVWQIAFGSGFKCNSAVWKALRKIPAGESKGNPWIDSIDRYP  520



>ref|XP_002974719.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
 gb|EFJ24239.1| hypothetical protein SELMODRAFT_101692 [Selaginella moellendorffii]
Length=534

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVWRA+R I+     PW  CI  +P AI
Sbjct  478  GRMRKGNRVWQIAFGSGFKCNSAVWRALRTIKASEKGPWADCIDQFPVAI  527



>ref|XP_010437646.1| PREDICTED: 3-ketoacyl-CoA synthase 16 [Camelina sativa]
Length=484

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  423  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEECLHKYPVEI  472



>ref|XP_002888670.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64929.1| hypothetical protein ARALYDRAFT_894621 [Arabidopsis lyrata subsp. 
lyrata]
Length=497

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            GK+  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GKMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>ref|XP_002869162.1| hypothetical protein ARALYDRAFT_491244 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45421.1| hypothetical protein ARALYDRAFT_491244 [Arabidopsis lyrata subsp. 
lyrata]
Length=493

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  438  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEHCLHKYPVEI  487



>ref|XP_010522896.1| PREDICTED: 3-ketoacyl-CoA synthase 1 isoform X1 [Tarenaya hassleriana]
 ref|XP_010522897.1| PREDICTED: 3-ketoacyl-CoA synthase 1 isoform X2 [Tarenaya hassleriana]
Length=526

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 30/52 (58%), Positives = 36/52 (69%), Gaps = 2/52 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMP--XANPWLXCIHTYPRAI  223
            G+V+ GDRLWQI FGSGFKCNSAVWRA+R +       NPW+  +  YP  I
Sbjct  475  GRVSAGDRLWQIAFGSGFKCNSAVWRALRAVSATEMKGNPWVGSVENYPVKI  526



>gb|KJB12200.1| hypothetical protein B456_002G005500 [Gossypium raimondii]
Length=493

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW A++ ++    +PW  CIH YP
Sbjct  442  GRMRKGDRVWQIAFGSGFKCNSAVWLALKNVKPSYNSPWEGCIHRYP  488



>emb|CDX76724.1| BnaC08g33100D [Brassica napus]
Length=547

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI  YP A+
Sbjct  499  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCISRYPVAL  547



>emb|CDX69040.1| BnaC01g04130D [Brassica napus]
Length=464

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  413  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEDCLHKYPVEI  462



>emb|CDX75415.1| BnaA01g02870D [Brassica napus]
Length=464

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  413  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEDCLHKYPVEI  462



>ref|XP_010028602.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Eucalyptus grandis]
Length=513

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW+A+R +    ++PW  CIH YP
Sbjct  462  GRMRRGNRVWQIAFGSGFKCNSAVWQALRNVTPSPSSPWEDCIHKYP  508



>ref|XP_006293899.1| hypothetical protein CARUB_v10022892mg, partial [Capsella rubella]
 gb|EOA26797.1| hypothetical protein CARUB_v10022892mg, partial [Capsella rubella]
Length=579

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  531  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYP  576



>ref|XP_009114823.1| PREDICTED: 3-ketoacyl-CoA synthase 16 [Brassica rapa]
Length=476

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  425  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEDCLHKYPVEI  474



>gb|AID60137.1| 3-ketoacyl-CoA synthase 16 [Brassica napus]
Length=476

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  425  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEDCLHKYPVEI  474



>ref|XP_006344142.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Solanum tuberosum]
Length=494

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 29/49 (59%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPX--ANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I++P    NPW  CI  YP
Sbjct  437  GRMKKGDRIWQIAFGSGFKCNSAVWKCNRTIKLPVDDHNPWADCIDRYP  485



>ref|XP_010447115.1| PREDICTED: 3-ketoacyl-CoA synthase 16-like [Camelina sativa]
Length=484

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  423  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSANNPWEECLHRYPVEI  472



>ref|XP_007044356.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
 gb|EOY00188.1| 3-ketoacyl-CoA synthase 6 [Theobroma cacao]
Length=496

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  441  GRMKRGDRIWQIAFGSGFKCNSAVWKCNRTIKTPTDGPWADCIDRYP  487



>gb|AGK30001.1| 3-ketoacyl-CoA synthase [Gossypium raimondii]
 gb|KJB12201.1| hypothetical protein B456_002G005600 [Gossypium raimondii]
Length=504

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 26/42 (62%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  357  GDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            GDR+WQ+ FGSGFKCNSAVW A++ ++    NPW  CIH YP
Sbjct  458  GDRIWQVAFGSGFKCNSAVWLALKNVKPSCGNPWEDCIHKYP  499



>ref|XP_007136167.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
 gb|ESW08161.1| hypothetical protein PHAVU_009G023600g [Phaseolus vulgaris]
Length=512

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW A+R +     +PW  CIH YP  I
Sbjct  462  GRMRKGNRVWQIAFGSGFKCNSAVWEALRHVNPSPKSPWEDCIHKYPVQI  511



>ref|XP_010415473.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
 ref|XP_010470803.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Camelina sativa]
Length=497

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>ref|XP_010511851.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Camelina sativa]
Length=497

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>emb|CDP00615.1| unnamed protein product [Coffea canephora]
Length=492

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  437  GRMKKGDRVWQIAFGSGFKCNSAVWKCNRTIKAPTKGPWEDCIDRYP  483



>gb|AAF73979.1|AF214502_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYP  547



>ref|NP_180193.1| 3-ketoacyl-CoA synthase 10 [Arabidopsis thaliana]
 sp|Q570B4.2|KCS10_ARATH RecName: Full=3-ketoacyl-CoA synthase 10; Short=KCS-10; AltName: 
Full=Protein FIDDLEHEAD; AltName: Full=Very long-chain fatty 
acid condensing enzyme 10; Short=VLCFA condensing enzyme 
10 [Arabidopsis thaliana]
 gb|AAF73973.1|AF214490_1 fiddlehead protein [Arabidopsis thaliana]
 gb|AAG60062.1|AF337910_1 putative beta-ketoacyl-CoA synthase FIDDLEHEAD [Arabidopsis thaliana]
 gb|AAC14526.1| beta-ketoacyl-CoA synthase (FIDDLEHEAD) [Arabidopsis thaliana]
 emb|CAA09311.1| fiddlehead protein [Arabidopsis thaliana]
 gb|AAK62618.1| At2g26250/T1D16.11 [Arabidopsis thaliana]
 gb|AAN31115.1| At2g26250/T1D16.11 [Arabidopsis thaliana]
 gb|AAN86193.1| putative beta-ketoacyl-CoA synthase FIDDLEHEAD [Arabidopsis thaliana]
 gb|AEC07813.1| 3-ketoacyl-CoA synthase 10 [Arabidopsis thaliana]
Length=550

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYP  547



>ref|XP_009365554.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Pyrus x bretschneideri]
Length=516

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW A+R ++     PW  CI TYP
Sbjct  465  GRIRRGNRIWQIAFGSGFKCNSAVWEALRNVKASRNGPWEDCIDTYP  511



>ref|XP_006408789.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
 gb|ESQ50242.1| hypothetical protein EUTSA_v10001951mg [Eutrema salsugineum]
Length=547

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  499  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCINRYP  544



>dbj|BAJ34066.1| unnamed protein product [Thellungiella halophila]
Length=547

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  499  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPARNNPWVDCINRYP  544



>ref|XP_002315942.1| ECERIFERUM 6 family protein [Populus trichocarpa]
 gb|ABK94727.1| unknown [Populus trichocarpa]
 gb|EEF02113.1| ECERIFERUM 6 family protein [Populus trichocarpa]
Length=496

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P  +PW  CI  YP
Sbjct  441  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDSPWADCIDRYP  487



>gb|AAF73980.1|AF214504_1 fiddlehead protein [Arabidopsis thaliana]
Length=550

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/46 (61%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ CI+ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCINRYP  547



>ref|XP_006302169.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
 gb|EOA35067.1| hypothetical protein CARUB_v10020179mg [Capsella rubella]
Length=498

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  443  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  489



>ref|NP_001267518.1| uncharacterized protein LOC100797855 [Glycine max]
 gb|AFY23861.1| 3-ketoacyl-CoA synthase [Glycine max]
Length=510

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW+A+R +R     PW  CI  YP  I
Sbjct  459  GRIKKGNRIWQIAFGSGFKCNSAVWQALRNVRPSPNGPWEDCIDKYPVEI  508



>ref|XP_011007926.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Populus euphratica]
Length=495

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P  +PW  CI  YP
Sbjct  441  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPTDSPWADCIDRYP  487



>gb|KDP46259.1| hypothetical protein JCGZ_10099 [Jatropha curcas]
Length=510

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW+A+R I+    NPW  CI  YP
Sbjct  459  GRMRRGNRVWQIAFGSGFKCNSAVWQALRNIKPSTNNPWEDCIDRYP  505



>ref|XP_010527059.1| PREDICTED: 3-ketoacyl-CoA synthase 10 [Tarenaya hassleriana]
Length=542

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 37/50 (74%), Gaps = 1/50 (2%)
 Frame = -2

Query  369  KVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYPRAI  223
            +V  GDR+WQI FGSGFKCNS VW+A+++++ P   NPW+ CI  YP  I
Sbjct  493  RVKRGDRVWQIAFGSGFKCNSVVWKAMKKVKKPARDNPWVDCIDRYPTDI  542



>ref|XP_006412251.1| hypothetical protein EUTSA_v10025022mg [Eutrema salsugineum]
 gb|ESQ53704.1| hypothetical protein EUTSA_v10025022mg [Eutrema salsugineum]
Length=491

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI  GSGFKCNS+VW A+R ++    NPW  C+H YP  I
Sbjct  440  GRMKKGDRIWQIALGSGFKCNSSVWVALRNVKPSPNNPWEDCLHKYPVEI  489



>ref|XP_010263648.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=515

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 30/50 (60%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G RLWQI FGSGFKCNSAVW AVR  +    +PWL CI  YP  I
Sbjct  464  GRMRKGHRLWQIAFGSGFKCNSAVWEAVRNAKPSPNSPWLHCIDRYPVEI  513



>ref|XP_010690872.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Beta vulgaris subsp. vulgaris]
Length=508

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G R+WQI FGSGFKCNSAVW+A+R ++    +PWL CI  YP  I
Sbjct  457  GRMKKGHRVWQIAFGSGFKCNSAVWQALRNVKPSPKSPWLDCIDRYPVEI  506



>gb|AGK29994.1| 3-ketoacyl-CoA synthase 4 [Gossypium raimondii]
 gb|KJB32512.1| hypothetical protein B456_005G244100 [Gossypium raimondii]
Length=504

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNS VW A+R ++    NPW  CIH YP
Sbjct  453  GRMRKGNRVWQIAFGSGFKCNSTVWVALRNVKPSPNNPWEDCIHRYP  499



>ref|XP_010254814.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Nelumbo nucifera]
Length=506

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G RLWQI FGSGFKCNSAVW A+R ++    +PW+ CI  YP  I
Sbjct  455  GRMRKGHRLWQIAFGSGFKCNSAVWEALRNVKASPNSPWMQCIDRYPVEI  504



>ref|XP_007222962.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
 gb|EMJ24161.1| hypothetical protein PRUPE_ppa006758mg [Prunus persica]
Length=396

 Score = 71.2 bits (173),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I  P   PW  CI  YP
Sbjct  341  GRMRKGDRVWQIAFGSGFKCNSAVWKCNRNIETPSEGPWADCIDRYP  387



>ref|XP_008243224.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Prunus mume]
Length=496

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I  P   PW  CI  YP
Sbjct  441  GRMRKGDRVWQIAFGSGFKCNSAVWKCNRSIEKPSEGPWADCIDRYP  487



>ref|XP_010690661.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Beta vulgaris subsp. vulgaris]
Length=528

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 29/52 (56%), Positives = 37/52 (71%), Gaps = 2/52 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRM--PXANPWLXCIHTYPRAI  223
            G+V  GDR+WQI FGSGFKCNSAVWRA+R +++     NPW+  +  YP  I
Sbjct  474  GRVKAGDRIWQIAFGSGFKCNSAVWRALREVQVGKSRTNPWIDSMDKYPVKI  525



>ref|XP_009105040.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Brassica rapa]
 emb|CDY07381.1| BnaA07g24600D [Brassica napus]
Length=497

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>gb|AAM65060.1| very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
Length=492

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  437  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  483



>ref|XP_002531630.1| acyltransferase, putative [Ricinus communis]
 gb|EEF30758.1| acyltransferase, putative [Ricinus communis]
Length=488

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+ P   PW  CI  YP
Sbjct  433  GRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTPTDGPWADCIDRYP  479



>ref|XP_010472653.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Camelina sativa]
Length=550

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ C++ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYP  547



>emb|CDY04232.1| BnaC06g25830D [Brassica napus]
Length=497

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>gb|AAL50069.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
 gb|AAM16230.1| At1g68530/T26J14_10 [Arabidopsis thaliana]
Length=497

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>ref|XP_010417409.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X3 [Camelina sativa]
Length=550

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ C++ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYP  547



>ref|XP_010417407.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X1 [Camelina sativa]
 ref|XP_010417408.1| PREDICTED: 3-ketoacyl-CoA synthase 10 isoform X2 [Camelina sativa]
Length=550

 Score = 71.6 bits (174),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ C++ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYP  547



>gb|KFK41273.1| hypothetical protein AALP_AA2G108700 [Arabis alpina]
Length=497

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>ref|XP_010429645.1| PREDICTED: 3-ketoacyl-CoA synthase 10-like [Camelina sativa]
Length=550

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+R+++ P   NPW+ C++ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMRKVKKPTRNNPWVDCVNRYP  547



>ref|NP_177020.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
 sp|Q9XF43.1|KCS6_ARATH RecName: Full=3-ketoacyl-CoA synthase 6; Short=KCS-6; AltName: 
Full=Cuticular protein 1; AltName: Full=Very long-chain fatty 
acid condensing enzyme 6; Short=VLCFA condensing enzyme 
6 [Arabidopsis thaliana]
 gb|AAD37122.1|AF129511_1 very-long-chain fatty acid condensing enzyme CUT1 [Arabidopsis 
thaliana]
 gb|AAG52390.1|AC011915_4 very-long-chain fatty acid condensing enzyme (CUT1); 56079-54227 
[Arabidopsis thaliana]
 gb|AEE34804.1| 3-ketoacyl-CoA synthase 6 [Arabidopsis thaliana]
Length=497

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  R I+ P   PW  CI  YP
Sbjct  442  GRMRRGDRVWQIAFGSGFKCNSAVWKCNRTIKTPKDGPWSDCIDRYP  488



>gb|ACZ51240.1| 3-ketoacyl-CoA synthase [Arachis hypogaea]
Length=496

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTPIDGPWTDCIDRYP  487



>ref|XP_006843898.1| hypothetical protein AMTR_s00007p00267760 [Amborella trichopoda]
 gb|ERN05573.1| hypothetical protein AMTR_s00007p00267760 [Amborella trichopoda]
Length=529

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQ+ FGSGFKCNSAVW A+R  R    +PWL CI  YP
Sbjct  480  GRVKRGDRVWQLAFGSGFKCNSAVWHALRGARPAPHSPWLDCIDRYP  526



>ref|XP_008444712.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis melo]
Length=514

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW A+R +R   ++PW  CI  YP
Sbjct  463  GRMHKGNRVWQIAFGSGFKCNSAVWEALRNVRPSQSSPWEDCIDNYP  509



>ref|XP_004152699.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cucumis sativus]
 gb|KGN62598.1| hypothetical protein Csa_2G361630 [Cucumis sativus]
Length=514

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW A+R +R   ++PW  CI  YP
Sbjct  463  GRMHKGNRVWQIAFGSGFKCNSAVWEALRNVRPSQSSPWEDCIDNYP  509



>gb|AAP74370.1| FAE3 [Marchantia polymorpha]
Length=529

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/47 (62%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDRLWQI FGSGFKCNSAVWRA+R ++ P  N W   I  +P
Sbjct  477  GRVKRGDRLWQIAFGSGFKCNSAVWRALRTVKPPVNNAWSDVIDRFP  523



>ref|XP_010670713.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010670714.1| PREDICTED: 3-ketoacyl-CoA synthase 11-like [Beta vulgaris subsp. 
vulgaris]
Length=515

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 29/48 (60%), Positives = 36/48 (75%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIR-MPXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVWRA++R+      NPW+  IH +P
Sbjct  455  GRVNSGDRIWQIAFGSGFKCNSAVWRALQRVNPAKEKNPWMDEIHLFP  502



>ref|XP_003626601.1| 3-ketoacyl-CoA synthase [Medicago truncatula]
 gb|ABD32702.1| Chalcone and stilbene synthases, N-terminal; Chalcone and stilbene 
synthases, C-terminal; Very-long-chain 3-ketoacyl-CoA 
synthase [Medicago truncatula]
 gb|AES82819.1| 3-ketoacyl-CoA synthase-like protein [Medicago truncatula]
Length=534

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 38/53 (72%), Gaps = 3/53 (6%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMP---XANPWLXCIHTYPRAI  223
            G+VA GDR+WQI FGSGFKCNSAVW+AVR + +      NPW   +H YP ++
Sbjct  476  GRVAKGDRVWQIAFGSGFKCNSAVWKAVRDLPVVGDWRGNPWDDSVHKYPVSV  528



>gb|ABY82171.2| 3-ketoacyl-CoA synthase I [Triticum aestivum]
Length=496

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CI  YP
Sbjct  441  GRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVKTPTDGPWDDCIQRYP  487



>gb|ACN25352.1| unknown [Zea mays]
Length=231

 Score = 68.6 bits (166),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CIH YP
Sbjct  176  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIHRYP  222



>ref|XP_006581119.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Glycine max]
Length=443

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW A+R +      PW  CIH YP
Sbjct  392  GRIRKGHRVWQIAFGSGFKCNSAVWEALRHVNPSPNTPWENCIHRYP  438



>gb|EMT20723.1| 3-ketoacyl-CoA synthase 6 [Aegilops tauschii]
Length=496

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CI  YP
Sbjct  441  GRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVKTPTDGPWDDCIQRYP  487



>gb|EMS60006.1| 3-ketoacyl-CoA synthase 6 [Triticum urartu]
Length=445

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CI  YP
Sbjct  390  GRMRKGDRVWQIGFGSGFKCNSAVWKCLRTVKTPTDGPWEDCIQRYP  436



>ref|XP_007139008.1| hypothetical protein PHAVU_009G257100g [Phaseolus vulgaris]
 gb|ESW11002.1| hypothetical protein PHAVU_009G257100g [Phaseolus vulgaris]
Length=525

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/52 (63%), Positives = 36/52 (69%), Gaps = 7/52 (13%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMP-----XANPWLXCIHTYP  232
            G+VA GDR+WQI FGSGFKCNSAVW+AVR I  P       NPW   IH YP
Sbjct  467  GRVAKGDRVWQIAFGSGFKCNSAVWKAVRDI--PELTEWRGNPWDDSIHNYP  516



>ref|XP_004135090.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 ref|XP_004159295.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 1 [Cucumis 
sativus]
 gb|KGN52079.1| hypothetical protein Csa_5G609650 [Cucumis sativus]
Length=496

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+ P   PW  CI  YP
Sbjct  441  GRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPIDGPWADCIDRYP  487



>ref|XP_004507452.1| PREDICTED: 3-ketoacyl-CoA synthase 4-like [Cicer arietinum]
Length=505

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/50 (54%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW+A++ +R    +PW  CI  YP  I
Sbjct  454  GRMRKGNRIWQIAFGSGFKCNSAVWQAMKHVRASSKSPWEDCIDRYPVEI  503



>ref|XP_003567862.1| PREDICTED: 3-ketoacyl-CoA synthase 4 [Brachypodium distachyon]
Length=518

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVW A+R ++    +PW  CI  YP
Sbjct  457  GRVRRGDRIWQIAFGSGFKCNSAVWHALRNVKPAANSPWEDCIDRYP  503



>gb|ACQ41892.1| 3-ketoacyl-CoA synthase [Camellia oleifera]
Length=525

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G ++WQI FGSGFKCNSAVW+A+R ++ P   PW  CI  YP
Sbjct  474  GRIRKGHQVWQIAFGSGFKCNSAVWKALRNVKHPRNGPWEDCIDKYP  520



>ref|XP_008446598.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Cucumis melo]
Length=496

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+ P   PW  CI  YP
Sbjct  441  GRMRKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPVDGPWADCIDRYP  487



>ref|XP_010918296.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Elaeis guineensis]
Length=525

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/57 (56%), Positives = 37/57 (65%), Gaps = 10/57 (18%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRI----------RMPXANPWLXCIHTYP  232
            G+VA GDR+WQI FGSGFKCNSAVWRA+R +          R    NPW  CI +YP
Sbjct  467  GRVARGDRVWQIGFGSGFKCNSAVWRAIRDVPPLGSAVGGRRGGGCNPWADCIDSYP  523



>ref|XP_004985167.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Setaria italica]
Length=494

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R I+ P   PW  CI  YP
Sbjct  439  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRSIKTPTNGPWDDCIDRYP  485



>ref|XP_004238922.1| PREDICTED: 3-ketoacyl-CoA synthase 6 [Solanum lycopersicum]
Length=494

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 28/49 (57%), Positives = 35/49 (71%), Gaps = 2/49 (4%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPX--ANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I++P    NPW  CI  YP
Sbjct  437  GRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKLPVDDHNPWADCIDRYP  485



>emb|CDP00616.1| unnamed protein product [Coffea canephora]
Length=496

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW+ ++ I +P   PW  CI  YP
Sbjct  441  GRMRKGNRVWQIAFGSGFKCNSAVWKCIKSIEIPTDGPWSDCIDRYP  487



>ref|XP_004135091.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
 ref|XP_004159296.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like isoform 2 [Cucumis 
sativus]
Length=450

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+ P   PW  CI  YP
Sbjct  395  GRMKKGDRIWQIAFGSGFKCNSAVWKCNKTIKTPIDGPWADCIDRYP  441



>ref|XP_002880771.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH57030.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=550

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/46 (59%), Positives = 36/46 (78%), Gaps = 1/46 (2%)
 Frame = -2

Query  366  VAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXA-NPWLXCIHTYP  232
            V  GDR+WQI FGSGFKCNS VW+A+++++ P   NPW+ CI+ YP
Sbjct  502  VRRGDRVWQIAFGSGFKCNSVVWKAMKKVKKPTRNNPWVDCINRYP  547



>ref|XP_009605061.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Nicotiana tomentosiformis]
Length=530

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+     PW  CIH YP
Sbjct  475  GRIKKGDRIWQIAFGSGFKCNSAVWKCNKTIKNLSDGPWSDCIHKYP  521



>ref|XP_010910111.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Elaeis guineensis]
Length=498

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+W I FGSGFKCNSAVW+ +R IR P   PW   IH YP
Sbjct  442  GRMRRGDRVWMIGFGSGFKCNSAVWKCLRTIRTPVEGPWSGSIHRYP  488



>ref|XP_009390849.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Musa acuminata subsp. 
malaccensis]
Length=496

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CI  YP
Sbjct  441  GRMRRGDRVWQIGFGSGFKCNSAVWKCLRTVKTPVDGPWSDCIDRYP  487



>dbj|BAJ98276.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=517

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/47 (60%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G+V  GDR+WQI FGSGFKCNSAVW A+R ++     PW  CI  YP
Sbjct  458  GRVRRGDRIWQIAFGSGFKCNSAVWHALRNVKPSPTTPWDDCIDRYP  504



>gb|AEW08011.1| hypothetical protein 0_16976_02, partial [Pinus radiata]
 gb|AFG50669.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50670.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50671.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50672.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50673.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50674.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50675.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50676.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50677.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50678.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50679.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50680.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50681.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50682.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50683.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
 gb|AFG50684.1| hypothetical protein 0_16976_02, partial [Pinus taeda]
Length=73

 Score = 65.9 bits (159),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 35/50 (70%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  GDR+WQI FGSGFKCNSAVW+ +R ++ P   PW  CI  YP  I
Sbjct  18   GRMRRGDRVWQIAFGSGFKCNSAVWKCLRTVKTPTQGPWSDCILRYPVVI  67



>ref|XP_010088926.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
 gb|EXB37130.1| 3-ketoacyl-CoA synthase 4 [Morus notabilis]
Length=503

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 26/47 (55%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G+R+WQI FGSGFKCNSAVW+A+R ++    +PW  CI  YP
Sbjct  453  GRMRKGNRIWQIAFGSGFKCNSAVWQALRNVKPSSNSPWADCIDMYP  499



>gb|KDO69954.1| hypothetical protein CISIN_1g011007mg [Citrus sinensis]
Length=496

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+    NPW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTTTDNPWSDCIDRYP  487



>ref|XP_006437664.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
 ref|XP_006484467.1| PREDICTED: 3-ketoacyl-CoA synthase 6-like [Citrus sinensis]
 gb|ESR50904.1| hypothetical protein CICLE_v10031329mg [Citrus clementina]
Length=496

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNSAVW+  + I+    NPW  CI  YP
Sbjct  441  GRMKKGDRVWQIAFGSGFKCNSAVWKCNKTIKTTTDNPWSDCIDRYP  487



>emb|CDP08625.1| unnamed protein product [Coffea canephora]
Length=643

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/59 (56%), Positives = 37/59 (63%), Gaps = 9/59 (15%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPX---------ANPWLXCIHTYPRAI  223
            G+V+ G R+WQI FGSGFKCNSAVWRA+R I             ANPW  CIH YP  I
Sbjct  420  GRVSKGHRVWQIAFGSGFKCNSAVWRALRPISSVTAAGDDDDCKANPWADCIHRYPVKI  478



>ref|XP_010103772.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
 gb|EXB97050.1| 3-ketoacyl-CoA synthase 6 [Morus notabilis]
Length=482

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSG KCNSAVW+  R I+ P   PW  CI  YP
Sbjct  427  GRMKRGDRIWQIAFGSGLKCNSAVWKCNRTIKTPTDGPWADCIDRYP  473



>ref|XP_006398946.1| hypothetical protein EUTSA_v10013296mg [Eutrema salsugineum]
 gb|ESQ40399.1| hypothetical protein EUTSA_v10013296mg [Eutrema salsugineum]
Length=508

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIR-MPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNS+VWRAVR +      NPW+  IH +P
Sbjct  452  GRIKKGDRIWQIAFGSGFKCNSSVWRAVRSVNPKKEKNPWMDEIHEFP  499



>ref|NP_180232.1| 3-ketoacyl-CoA synthase 11 [Arabidopsis thaliana]
 sp|O48780.1|KCS11_ARATH RecName: Full=3-ketoacyl-CoA synthase 11; Short=KCS-11; AltName: 
Full=Very long-chain fatty acid condensing enzyme 11; Short=VLCFA 
condensing enzyme 11 [Arabidopsis thaliana]
 gb|AAB95298.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AAO41904.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AAO64112.1| putative beta-ketoacyl-CoA synthase [Arabidopsis thaliana]
 gb|AEC07869.1| 3-ketoacyl-CoA synthase 11 [Arabidopsis thaliana]
Length=509

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIR-MPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNS+VWRAVR +      NPW+  IH +P
Sbjct  453  GRIKKGDRIWQIAFGSGFKCNSSVWRAVRSVNPKKEKNPWMDEIHEFP  500



>ref|XP_006293527.1| hypothetical protein CARUB_v10024547mg [Capsella rubella]
 gb|EOA26425.1| hypothetical protein CARUB_v10024547mg [Capsella rubella]
Length=509

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 28/48 (58%), Positives = 35/48 (73%), Gaps = 1/48 (2%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIR-MPXANPWLXCIHTYP  232
            G++  GDR+WQI FGSGFKCNS+VWRAVR +      NPW+  IH +P
Sbjct  453  GRIKKGDRIWQIAFGSGFKCNSSVWRAVRSVNPKKEKNPWMDEIHEFP  500



>gb|KHN12706.1| 3-ketoacyl-CoA synthase 4 [Glycine soja]
Length=327

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/50 (58%), Positives = 36/50 (72%), Gaps = 0/50 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYPRAI  223
            G++  G+R+WQI FGSGFKCNSAVW+A+R +R     PW  CIH YP  I
Sbjct  276  GRIKKGNRIWQIAFGSGFKCNSAVWQALRNVRPSPNGPWEDCIHKYPVEI  325



>ref|XP_009758872.1| PREDICTED: 3-ketoacyl-CoA synthase 1 [Nicotiana sylvestris]
Length=532

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 29/51 (57%), Positives = 35/51 (69%), Gaps = 4/51 (8%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMP----XANPWLXCIHTYP  232
            G+V+ GDR+WQI FGSGFKCNSAVW+++R I         NPW  CI  YP
Sbjct  474  GRVSKGDRIWQIAFGSGFKCNSAVWKSLREIDCNEVNRNGNPWADCIQRYP  524



>gb|KHN20068.1| 3-ketoacyl-CoA synthase 4 [Glycine soja]
Length=435

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 27/47 (57%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            G++  G R+WQI FGSGFKCNSAVW A+R +      PW  CIH YP
Sbjct  384  GRIRKGHRVWQIAFGSGFKCNSAVWEALRHVNPSSNTPWENCIHRYP  430



>ref|XP_006851009.1| hypothetical protein AMTR_s00025p00218830 [Amborella trichopoda]
 gb|ERN12590.1| hypothetical protein AMTR_s00025p00218830 [Amborella trichopoda]
Length=254

 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  372  GKVAGGDRLWQIVFGSGFKCNSAVWRAVRRIRMPXANPWLXCIHTYP  232
            GK+   DR+WQ+ FGSGFKCNS VWRA++R+R     PW+ CI  YP
Sbjct  203  GKIKRDDRIWQVAFGSGFKCNSVVWRALKRVRRSPYGPWIDCIDHYP  249



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555214126005