BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038O08

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009621845.1|  PREDICTED: MLO-like protein 1                      373   1e-123   Nicotiana tomentosiformis
ref|XP_009770323.1|  PREDICTED: MLO-like protein 1                      372   2e-123   Nicotiana sylvestris
ref|XP_011089565.1|  PREDICTED: MLO-like protein 1                      372   4e-123   Sesamum indicum [beniseed]
emb|CDP04006.1|  unnamed protein product                                359   1e-118   Coffea canephora [robusta coffee]
ref|XP_006344359.1|  PREDICTED: MLO-like protein 1-like                 356   2e-117   Solanum tuberosum [potatoes]
gb|EYU36872.1|  hypothetical protein MIMGU_mgv1a004875mg                352   2e-115   Erythranthe guttata [common monkey flower]
ref|XP_008460095.1|  PREDICTED: MLO-like protein 1                      349   4e-114   
ref|XP_004145008.1|  PREDICTED: MLO-like protein 1-like                 348   8e-114   Cucumis sativus [cucumbers]
ref|NP_001284374.1|  MLO-like protein 1                                 346   5e-113   Cucumis melo [Oriental melon]
ref|XP_010052699.1|  PREDICTED: MLO-like protein 1                      342   2e-111   Eucalyptus grandis [rose gum]
ref|XP_003522288.1|  PREDICTED: MLO-like protein 1-like                 341   4e-111   Glycine max [soybeans]
gb|KDP39614.1|  hypothetical protein JCGZ_02634                         342   4e-111   Jatropha curcas
gb|EPS69012.1|  hypothetical protein M569_05755                         338   4e-110   Genlisea aurea
ref|NP_001045040.1|  Os01g0888600                                       337   2e-109   
ref|XP_003527594.1|  PREDICTED: MLO-like protein 1-like                 336   2e-109   Glycine max [soybeans]
ref|XP_006437327.1|  hypothetical protein CICLE_v10031281mg             335   2e-109   
gb|KHN19980.1|  MLO-like protein 1                                      336   3e-109   Glycine soja [wild soybean]
ref|XP_008369123.1|  PREDICTED: MLO-like protein 1                      336   3e-109   
ref|XP_008345263.1|  PREDICTED: MLO-like protein 1                      336   3e-109   
ref|XP_007029886.1|  Seven transmembrane MLO family protein             336   6e-109   
dbj|BAH57094.1|  AT4G02600                                              327   8e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006437326.1|  hypothetical protein CICLE_v10031281mg             335   1e-108   Citrus clementina [clementine]
ref|XP_010528781.1|  PREDICTED: MLO-like protein 1                      333   7e-108   Tarenaya hassleriana [spider flower]
ref|XP_006645146.1|  PREDICTED: MLO-like protein 1-like                 333   8e-108   Oryza brachyantha
gb|KJB82477.1|  hypothetical protein B456_013G197800                    333   8e-108   Gossypium raimondii
ref|XP_002874907.1|  predicted protein                                  333   1e-107   Arabidopsis lyrata subsp. lyrata
ref|XP_008235036.1|  PREDICTED: MLO-like protein 1                      332   1e-107   Prunus mume [ume]
ref|XP_007137327.1|  hypothetical protein PHAVU_009G117900g             332   2e-107   Phaseolus vulgaris [French bean]
ref|XP_010277858.1|  PREDICTED: MLO-like protein 1                      332   2e-107   Nelumbo nucifera [Indian lotus]
ref|XP_003636499.1|  MLO-like protein                                   332   2e-107   
ref|XP_004510198.1|  PREDICTED: MLO-like protein 1-like                 332   2e-107   Cicer arietinum [garbanzo]
dbj|BAH20436.1|  AT4G02600                                              327   6e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007199791.1|  hypothetical protein PRUPE_ppa004508mg             330   7e-107   Prunus persica
ref|XP_003547751.1|  PREDICTED: MLO-like protein 1-like                 330   8e-107   Glycine max [soybeans]
ref|XP_010422570.1|  PREDICTED: MLO-like protein 1                      330   1e-106   Camelina sativa [gold-of-pleasure]
gb|AAU10790.1|  putative seven transmembrane MLO family protein         322   2e-106   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001268003.1|  MLO5 protein                                       327   5e-106   Vitis vinifera
emb|CDY22065.1|  BnaA09g00940D                                          327   7e-106   Brassica napus [oilseed rape]
ref|NP_192169.1|  MLO-like protein 1                                    328   9e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007134284.1|  hypothetical protein PHAVU_010G034400g             327   1e-105   Phaseolus vulgaris [French bean]
ref|NP_001174425.1|  Os05g0418100                                       321   1e-105   
ref|XP_009144550.1|  PREDICTED: MLO-like protein 1                      327   1e-105   Brassica rapa
tpg|DAA56449.1|  TPA: seven transmembrane protein Mlo5                  325   2e-105   
gb|ABK96389.1|  unknown                                                 327   2e-105   Populus trichocarpa x Populus deltoides
ref|XP_010679042.1|  PREDICTED: MLO-like protein 1                      326   3e-105   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA56448.1|  TPA: seven transmembrane protein Mlo5                  324   3e-105   
emb|CDY21899.1|  BnaC09g00050D                                          327   3e-105   Brassica napus [oilseed rape]
ref|XP_004500713.1|  PREDICTED: MLO-like protein 1-like isoform X1      327   3e-105   Cicer arietinum [garbanzo]
ref|XP_010456010.1|  PREDICTED: MLO-like protein 1                      327   4e-105   Camelina sativa [gold-of-pleasure]
emb|CDX91294.1|  BnaC02g27050D                                          326   4e-105   
ref|XP_004290766.1|  PREDICTED: MLO-like protein 1                      326   5e-105   Fragaria vesca subsp. vesca
ref|XP_009111270.1|  PREDICTED: MLO-like protein 1                      326   5e-105   Brassica rapa
gb|KHG28287.1|  MLO-like protein 1                                      325   6e-105   Gossypium arboreum [tree cotton]
gb|ABK95021.1|  unknown                                                 317   6e-105   Populus trichocarpa [western balsam poplar]
ref|XP_008674721.1|  PREDICTED: MLO-like protein 1                      325   9e-105   
gb|KHG28286.1|  MLO-like protein 1                                      325   1e-104   Gossypium arboreum [tree cotton]
ref|XP_006287341.1|  hypothetical protein CARUB_v10000540mg             327   2e-104   
gb|KHG28285.1|  MLO-like protein 1                                      325   2e-104   Gossypium arboreum [tree cotton]
ref|XP_010429895.1|  PREDICTED: MLO-like protein 1                      324   4e-104   Camelina sativa [gold-of-pleasure]
gb|KEH18066.1|  seven transmembrane MLO family protein                  323   5e-104   Medicago truncatula
ref|XP_011011038.1|  PREDICTED: MLO-like protein 1 isoform X2           323   6e-104   Populus euphratica
ref|XP_010907544.1|  PREDICTED: LOW QUALITY PROTEIN: MLO-like pro...    322   7e-104   Elaeis guineensis
gb|EEE63750.1|  hypothetical protein OsJ_18569                          322   8e-104   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105171.1|  barley mlo defense gene homolog8                   322   1e-103   Zea mays [maize]
ref|XP_003636206.1|  MLO-like protein                                   322   1e-103   
ref|XP_008232215.1|  PREDICTED: MLO-like protein 1                      321   1e-103   
ref|XP_011011036.1|  PREDICTED: MLO-like protein 1 isoform X1           322   1e-103   Populus euphratica
ref|XP_006396473.1|  hypothetical protein EUTSA_v10028582mg             322   2e-103   Eutrema salsugineum [saltwater cress]
gb|AIZ94062.1|  Mlo protein                                             321   3e-103   Hevea brasiliensis [jebe]
ref|XP_007217923.1|  hypothetical protein PRUPE_ppa004866mg             320   6e-103   Prunus persica
ref|XP_008812870.1|  PREDICTED: MLO-like protein 1 isoform X3           314   7e-103   
ref|XP_003520359.1|  PREDICTED: MLO-like protein 1-like                 320   2e-102   Glycine max [soybeans]
gb|EAY98072.1|  hypothetical protein OsI_19990                          318   2e-102   Oryza sativa Indica Group [Indian rice]
emb|CAN71629.1|  hypothetical protein VITISV_015579                     331   3e-102   Vitis vinifera
ref|XP_003568437.1|  PREDICTED: MLO-like protein 1                      317   8e-102   Brachypodium distachyon [annual false brome]
ref|XP_003604071.1|  MLO-like protein                                   317   1e-101   Medicago truncatula
ref|XP_003636497.1|  MLO-like protein                                   322   3e-101   
ref|XP_004970844.1|  PREDICTED: MLO-like protein 1-like isoform X1      315   4e-101   Setaria italica
ref|XP_008812868.1|  PREDICTED: MLO-like protein 1 isoform X1           315   8e-101   Phoenix dactylifera
ref|XP_006858689.1|  hypothetical protein AMTR_s00066p00091160          314   1e-100   Amborella trichopoda
emb|CDM85394.1|  unnamed protein product                                313   2e-100   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009600156.1|  PREDICTED: MLO-like protein 1 isoform X2           313   2e-100   Nicotiana tomentosiformis
ref|XP_009399143.1|  PREDICTED: MLO-like protein 1                      314   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376309.1|  PREDICTED: MLO-like protein 1                      312   2e-100   Pyrus x bretschneideri [bai li]
ref|XP_008375689.1|  PREDICTED: MLO-like protein 1                      310   6e-100   
ref|XP_009410722.1|  PREDICTED: MLO-like protein 1 isoform X2           312   7e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410721.1|  PREDICTED: MLO-like protein 1 isoform X1           312   8e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004500714.1|  PREDICTED: MLO-like protein 1-like isoform X2      311   2e-99    
ref|XP_002319210.2|  hypothetical protein POPTR_0013s06680g             306   4e-99    
ref|XP_006375950.1|  hypothetical protein POPTR_0013s06680g             306   4e-99    
ref|XP_006655330.1|  PREDICTED: MLO-like protein 1-like                 310   5e-99    Oryza brachyantha
ref|XP_008344996.1|  PREDICTED: MLO-like protein 1 isoform X1           308   6e-99    
ref|XP_003636203.1|  MLO-like protein                                   309   7e-99    
ref|XP_009361360.1|  PREDICTED: MLO-like protein 1                      309   9e-99    Pyrus x bretschneideri [bai li]
ref|XP_010908317.1|  PREDICTED: MLO-like protein 1 isoform X1           309   1e-98    Elaeis guineensis
ref|XP_008375669.1|  PREDICTED: MLO-like protein 1                      308   1e-98    
ref|XP_008802152.1|  PREDICTED: MLO-like protein 1                      299   2e-98    
ref|XP_008788294.1|  PREDICTED: MLO-like protein 1                      305   2e-97    Phoenix dactylifera
ref|XP_009794450.1|  PREDICTED: MLO-like protein 1 isoform X1           305   3e-97    Nicotiana sylvestris
gb|ABY77906.1|  mildew resistance locus o 15                            305   5e-97    Vitis vinifera
gb|KDP29534.1|  hypothetical protein JCGZ_19247                         305   5e-97    Jatropha curcas
ref|NP_001267997.1|  mildew resistance locus o 15                       305   6e-97    Vitis vinifera
ref|XP_008243092.1|  PREDICTED: MLO-like protein 1                      305   6e-97    Prunus mume [ume]
ref|XP_006478504.1|  PREDICTED: MLO-like protein 1-like                 305   9e-97    Citrus sinensis [apfelsine]
ref|XP_004962062.1|  PREDICTED: MLO-like protein 1-like                 303   2e-96    Setaria italica
dbj|BAJ24148.1|  seven trans-membrane protein                           303   2e-96    Triticum aestivum [Canadian hard winter wheat]
dbj|BAK08220.1|  predicted protein                                      303   2e-96    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006441977.1|  hypothetical protein CICLE_v10019784mg             303   2e-96    Citrus clementina [clementine]
ref|XP_007203635.1|  hypothetical protein PRUPE_ppa004012mg             304   3e-96    Prunus persica
ref|XP_010065113.1|  PREDICTED: MLO-like protein 1                      299   4e-96    Eucalyptus grandis [rose gum]
ref|XP_002441109.1|  hypothetical protein SORBIDRAFT_09g020570          302   6e-96    
gb|ABK93651.1|  unknown                                                 300   9e-96    Populus trichocarpa [western balsam poplar]
ref|XP_006372313.1|  hypothetical protein POPTR_0017s00470g             301   1e-95    
ref|XP_004244787.1|  PREDICTED: MLO-like protein 1                      301   1e-95    
ref|XP_011014744.1|  PREDICTED: MLO-like protein 1                      301   1e-95    Populus euphratica
ref|XP_011004548.1|  PREDICTED: MLO-like protein 1                      301   1e-95    Populus euphratica
ref|XP_006366803.1|  PREDICTED: MLO-like protein 1-like                 301   1e-95    
ref|XP_006372311.1|  hypothetical protein POPTR_0017s00450g             299   1e-95    
ref|XP_003564808.1|  PREDICTED: MLO-like protein 1                      300   3e-95    Brachypodium distachyon [annual false brome]
ref|XP_006372312.1|  hypothetical protein POPTR_0017s00450g             300   5e-95    
ref|XP_004962063.1|  PREDICTED: MLO-like protein 1-like isoform X1      298   1e-94    Setaria italica
gb|KDO49756.1|  hypothetical protein CISIN_1g0113632mg                  293   1e-94    Citrus sinensis [apfelsine]
ref|XP_010930334.1|  PREDICTED: MLO-like protein 1 isoform X3           295   2e-94    
ref|XP_010040798.1|  PREDICTED: MLO-like protein 1                      298   4e-94    Eucalyptus grandis [rose gum]
ref|XP_006441984.1|  hypothetical protein CICLE_v10020313mg             295   4e-94    
ref|XP_006351085.1|  PREDICTED: MLO-like protein 1-like                 297   6e-94    Solanum tuberosum [potatoes]
gb|KJB28898.1|  hypothetical protein B456_005G074900                    295   7e-94    Gossypium raimondii
ref|XP_010930331.1|  PREDICTED: MLO-like protein 1 isoform X1           296   1e-93    Elaeis guineensis
gb|KHG23854.1|  MLO-like protein 1                                      295   1e-93    Gossypium arboreum [tree cotton]
ref|XP_006478537.1|  PREDICTED: MLO-like protein 1-like                 295   2e-93    Citrus sinensis [apfelsine]
gb|KJB28899.1|  hypothetical protein B456_005G074900                    295   2e-93    Gossypium raimondii
ref|XP_011085087.1|  PREDICTED: MLO-like protein 1 isoform X3           294   7e-93    
ref|XP_011085086.1|  PREDICTED: MLO-like protein 1 isoform X2           293   2e-92    Sesamum indicum [beniseed]
ref|XP_011085085.1|  PREDICTED: MLO-like protein 15 isoform X1          294   2e-92    
ref|XP_008656279.1|  PREDICTED: MLO-like protein 1                      293   2e-92    Zea mays [maize]
ref|XP_010065098.1|  PREDICTED: MLO-like protein 1                      293   2e-92    
gb|EPS69013.1|  hypothetical protein M569_05756                         291   2e-92    Genlisea aurea
ref|XP_002533335.1|  Protein MLO, putative                              292   4e-92    
gb|KHG04571.1|  MLO-like protein 1                                      291   4e-92    Gossypium arboreum [tree cotton]
ref|XP_006295922.1|  hypothetical protein CARUB_v10025059mg             290   1e-91    
ref|XP_010559056.1|  PREDICTED: MLO-like protein 15 isoform X1          291   3e-91    
ref|XP_007020280.1|  Seven transmembrane MLO family protein             290   3e-91    
ref|XP_002441107.1|  hypothetical protein SORBIDRAFT_09g020550          289   5e-91    Sorghum bicolor [broomcorn]
ref|XP_006397586.1|  hypothetical protein EUTSA_v10001415mg             289   6e-91    Eutrema salsugineum [saltwater cress]
ref|XP_010517997.1|  PREDICTED: MLO-like protein 15 isoform X2          288   6e-91    Camelina sativa [gold-of-pleasure]
ref|XP_010508339.1|  PREDICTED: MLO-like protein 15                     289   8e-91    Camelina sativa [gold-of-pleasure]
ref|XP_008383732.1|  PREDICTED: MLO-like protein 1                      290   8e-91    Malus domestica [apple tree]
ref|XP_009757992.1|  PREDICTED: MLO-like protein 1                      288   1e-90    Nicotiana sylvestris
ref|XP_010517996.1|  PREDICTED: MLO-like protein 15 isoform X1          288   2e-90    Camelina sativa [gold-of-pleasure]
ref|XP_009366270.1|  PREDICTED: MLO-like protein 1                      289   2e-90    Pyrus x bretschneideri [bai li]
gb|KFK37229.1|  hypothetical protein AALP_AA4G230500                    286   8e-90    Arabis alpina [alpine rockcress]
ref|XP_010913234.1|  PREDICTED: MLO-like protein 1 isoform X6           281   1e-89    
gb|KDO49761.1|  hypothetical protein CISIN_1g044857mg                   281   3e-89    Citrus sinensis [apfelsine]
ref|XP_010506316.1|  PREDICTED: MLO-like protein 15                     285   3e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009413424.1|  PREDICTED: MLO-like protein 1                      283   7e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009620916.1|  PREDICTED: MLO-like protein 1                      278   8e-89    Nicotiana tomentosiformis
ref|XP_010913230.1|  PREDICTED: MLO-like protein 13 isoform X3          282   1e-88    
ref|NP_181939.1|  MLO-like protein 15                                   283   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|NP_973686.1|  MLO-like protein 15                                   283   1e-88    Arabidopsis thaliana [mouse-ear cress]
gb|ABR16800.1|  unknown                                                 282   1e-88    Picea sitchensis
ref|XP_010913229.1|  PREDICTED: MLO-like protein 13 isoform X2          282   3e-88    Elaeis guineensis
ref|XP_010069191.1|  PREDICTED: MLO-like protein 1 isoform X1           282   3e-88    Eucalyptus grandis [rose gum]
ref|XP_010913228.1|  PREDICTED: MLO-like protein 13 isoform X1          283   4e-88    Elaeis guineensis
ref|XP_007026460.1|  Seven transmembrane MLO family protein             281   5e-88    
gb|KDO49429.1|  hypothetical protein CISIN_1g0104501mg                  277   1e-87    Citrus sinensis [apfelsine]
ref|XP_009615189.1|  PREDICTED: MLO-like protein 1 isoform X2           281   1e-87    Nicotiana tomentosiformis
ref|XP_009615188.1|  PREDICTED: MLO-like protein 1 isoform X1           281   1e-87    Nicotiana tomentosiformis
gb|KDO49428.1|  hypothetical protein CISIN_1g0104501mg                  277   4e-87    Citrus sinensis [apfelsine]
ref|XP_004287195.1|  PREDICTED: MLO-like protein 15                     280   5e-87    Fragaria vesca subsp. vesca
ref|XP_010040938.1|  PREDICTED: MLO-like protein 1                      273   5e-87    
ref|XP_004242449.1|  PREDICTED: MLO-like protein 1                      279   6e-87    Solanum lycopersicum
gb|KGN46257.1|  hypothetical protein Csa_6G078520                       278   6e-87    Cucumis sativus [cucumbers]
ref|XP_002441108.1|  hypothetical protein SORBIDRAFT_09g020560          277   9e-87    
emb|CDP19084.1|  unnamed protein product                                279   1e-86    Coffea canephora [robusta coffee]
ref|XP_007208676.1|  hypothetical protein PRUPE_ppa024581mg             276   4e-86    Prunus persica
ref|XP_011005242.1|  PREDICTED: MLO-like protein 1                      276   4e-86    Populus euphratica
ref|XP_002523965.1|  calmodulin binding protein, putative               275   5e-86    
ref|XP_002309708.1|  hypothetical protein POPTR_0007s00240g             275   6e-86    
gb|EMT27451.1|  MLO-like protein 1                                      278   8e-86    
ref|XP_006857534.1|  hypothetical protein AMTR_s00061p00034560          276   1e-85    
ref|XP_008227254.1|  PREDICTED: MLO-like protein 1                      274   2e-85    Prunus mume [ume]
ref|XP_009794451.1|  PREDICTED: MLO-like protein 1 isoform X2           271   6e-85    Nicotiana sylvestris
ref|XP_010054950.1|  PREDICTED: MLO-like protein 1                      273   1e-84    
ref|XP_010251437.1|  PREDICTED: MLO-like protein 1 isoform X1           271   4e-84    Nelumbo nucifera [Indian lotus]
ref|XP_010251439.1|  PREDICTED: MLO-like protein 1 isoform X2           270   6e-84    Nelumbo nucifera [Indian lotus]
gb|EMT10343.1|  MLO-like protein 1                                      271   1e-83    
ref|XP_009399302.1|  PREDICTED: MLO-like protein 1                      265   2e-81    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008649648.1|  PREDICTED: MLO-like protein 1 isoform X2           263   3e-81    Zea mays [maize]
ref|XP_008649647.1|  PREDICTED: MLO-like protein 1 isoform X1           263   5e-81    Zea mays [maize]
ref|XP_006441978.1|  hypothetical protein CICLE_v10023336mg             262   1e-80    
ref|XP_011460878.1|  PREDICTED: MLO-like protein 1 isoform X2           261   2e-80    Fragaria vesca subsp. vesca
ref|XP_006478540.1|  PREDICTED: MLO-like protein 1-like                 261   4e-80    Citrus sinensis [apfelsine]
ref|XP_010066114.1|  PREDICTED: MLO-like protein 1                      260   5e-80    
ref|XP_004294225.1|  PREDICTED: MLO-like protein 15 isoform X1          261   8e-80    Fragaria vesca subsp. vesca
ref|XP_011469571.1|  PREDICTED: MLO-like protein 1                      259   1e-79    Fragaria vesca subsp. vesca
gb|EMT25264.1|  MLO-like protein 1                                      251   5e-79    
gb|EYU22367.1|  hypothetical protein MIMGU_mgv1a0228202mg               252   9e-79    Erythranthe guttata [common monkey flower]
gb|EAY86311.1|  hypothetical protein OsI_07684                          256   1e-78    Oryza sativa Indica Group [Indian rice]
ref|XP_010930330.1|  PREDICTED: MLO-like protein 1                      254   1e-77    
ref|XP_009142246.1|  PREDICTED: MLO-like protein 15                     254   2e-77    Brassica rapa
emb|CDY23418.1|  BnaC04g49460D                                          254   2e-77    Brassica napus [oilseed rape]
ref|XP_008806171.1|  PREDICTED: MLO-like protein 13 isoform X2          255   3e-77    
gb|EYU36622.1|  hypothetical protein MIMGU_mgv1a005184mg                253   4e-77    Erythranthe guttata [common monkey flower]
gb|EEE57203.1|  hypothetical protein OsJ_07160                          253   4e-77    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008806170.1|  PREDICTED: MLO-like protein 13 isoform X1          254   6e-77    
ref|XP_004970845.1|  PREDICTED: MLO-like protein 1-like isoform X2      251   1e-76    
ref|XP_011460879.1|  PREDICTED: MLO-like protein 1                      242   2e-76    Fragaria vesca subsp. vesca
emb|CDY30455.1|  BnaA04g25560D                                          255   3e-76    Brassica napus [oilseed rape]
ref|XP_008802140.1|  PREDICTED: MLO-like protein 1                      250   5e-76    
ref|XP_006648751.1|  PREDICTED: MLO-like protein 1-like                 250   7e-76    Oryza brachyantha
ref|XP_004952743.1|  PREDICTED: MLO-like protein 1-like                 250   9e-76    Setaria italica
ref|XP_008678707.1|  PREDICTED: MLO-like protein 1                      246   2e-74    Zea mays [maize]
gb|EMT22302.1|  MLO-like protein 1                                      243   6e-74    
dbj|BAJ24153.1|  seven trans-membrane protein                           244   2e-73    Triticum aestivum [Canadian hard winter wheat]
ref|XP_003575162.1|  PREDICTED: MLO-like protein 1                      244   2e-73    Brachypodium distachyon [annual false brome]
ref|XP_002299404.2|  hypothetical protein POPTR_0001s11880g             243   2e-73    
ref|XP_009600155.1|  PREDICTED: MLO-like protein 1 isoform X1           244   3e-73    Nicotiana tomentosiformis
gb|EYU29404.1|  hypothetical protein MIMGU_mgv1a004805mg                243   4e-73    Erythranthe guttata [common monkey flower]
ref|XP_010672534.1|  PREDICTED: MLO-like protein 15                     243   7e-73    Beta vulgaris subsp. vulgaris [field beet]
gb|EMT12340.1|  MLO-like protein 1                                      243   1e-72    
ref|XP_002454019.1|  hypothetical protein SORBIDRAFT_04g023170          242   2e-72    Sorghum bicolor [broomcorn]
dbj|BAJ91124.1|  predicted protein                                      240   3e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAS93431.1|  Mlo3                                                    240   3e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU33241.1|  hypothetical protein MIMGU_mgv1a017858mg                239   5e-72    Erythranthe guttata [common monkey flower]
dbj|BAJ94381.1|  predicted protein                                      239   8e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011026716.1|  PREDICTED: MLO-like protein 13 isoform X2          239   9e-72    Populus euphratica
ref|XP_010913231.1|  PREDICTED: MLO-like protein 13 isoform X4          237   1e-71    
ref|XP_011026715.1|  PREDICTED: MLO-like protein 13 isoform X1          239   2e-71    Populus euphratica
gb|KJB56407.1|  hypothetical protein B456_009G118700                    238   2e-71    Gossypium raimondii
ref|XP_010913978.1|  PREDICTED: MLO-like protein 13                     236   4e-71    
gb|AFW81913.1|  hypothetical protein ZEAMMB73_691352                    235   9e-71    
ref|XP_011026717.1|  PREDICTED: endoglucanase 25-like isoform X3        244   3e-70    Populus euphratica
gb|ACN35418.1|  unknown                                                 230   6e-70    Zea mays [maize]
ref|XP_010521421.1|  PREDICTED: MLO-like protein 13 isoform X2          233   1e-69    Tarenaya hassleriana [spider flower]
ref|XP_010521420.1|  PREDICTED: MLO-like protein 13 isoform X1          233   1e-69    Tarenaya hassleriana [spider flower]
ref|XP_010247041.1|  PREDICTED: MLO-like protein 13 isoform X2          234   1e-69    Nelumbo nucifera [Indian lotus]
ref|XP_008798739.1|  PREDICTED: MLO-like protein 13                     234   2e-69    Phoenix dactylifera
ref|XP_010247040.1|  PREDICTED: MLO-like protein 13 isoform X1          234   2e-69    Nelumbo nucifera [Indian lotus]
dbj|BAJ97456.1|  predicted protein                                      231   1e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS64374.1|  MLO-like protein 1                                      228   9e-68    Triticum urartu
ref|XP_008345009.1|  PREDICTED: MLO-like protein 1 isoform X2           227   1e-67    
ref|XP_004959126.1|  PREDICTED: MLO-like protein 1-like                 228   2e-67    
gb|KCW71438.1|  hypothetical protein EUGRSUZ_E000081                    221   2e-67    Eucalyptus grandis [rose gum]
ref|XP_011087587.1|  PREDICTED: MLO-like protein 13                     227   4e-67    Sesamum indicum [beniseed]
ref|XP_009392168.1|  PREDICTED: MLO-like protein 13 isoform X3          223   5e-67    
ref|XP_008812869.1|  PREDICTED: MLO-like protein 1 isoform X2           224   8e-67    
ref|XP_007023831.1|  Glycosyl hydrolase 9A1                             233   2e-66    
ref|XP_002266927.3|  PREDICTED: endoglucanase 25                        232   3e-66    
emb|CBI29605.3|  unnamed protein product                                223   4e-66    Vitis vinifera
gb|KDO49759.1|  hypothetical protein CISIN_1g0474502mg                  214   8e-66    Citrus sinensis [apfelsine]
ref|XP_009392166.1|  PREDICTED: MLO-like protein 13 isoform X1          224   9e-66    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010559057.1|  PREDICTED: MLO-like protein 15 isoform X2          222   1e-65    
ref|XP_006283629.1|  hypothetical protein CARUB_v10004686mg             223   1e-65    Capsella rubella
ref|XP_010439065.1|  PREDICTED: MLO-like protein 13                     222   4e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010448588.1|  PREDICTED: MLO-like protein 13                     222   4e-65    Camelina sativa [gold-of-pleasure]
gb|EMT12339.1|  MLO-like protein 1                                      221   5e-65    
gb|EMS49775.1|  MLO-like protein 1                                      221   5e-65    Triticum urartu
emb|CAB45060.1|  Mlo-like protein                                       220   6e-65    Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ24151.1|  seven trans-membrane protein                           221   6e-65    Triticum aestivum [Canadian hard winter wheat]
ref|XP_010433797.1|  PREDICTED: MLO-like protein 13                     221   8e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010908325.1|  PREDICTED: MLO-like protein 1 isoform X2           219   8e-65    
gb|EMT13719.1|  MLO-like protein 1                                      222   1e-64    
ref|NP_567697.1|  MLO-like protein 13                                   219   3e-64    Arabidopsis thaliana [mouse-ear cress]
gb|EPS69181.1|  hypothetical protein M569_05587                         212   5e-64    Genlisea aurea
ref|XP_002867673.1|  hypothetical protein ARALYDRAFT_914165             219   5e-64    Arabidopsis lyrata subsp. lyrata
gb|KJB70716.1|  hypothetical protein B456_011G089600                    218   5e-64    Gossypium raimondii
gb|EMS45065.1|  MLO-like protein 1                                      218   7e-64    Triticum urartu
gb|EAY94273.1|  hypothetical protein OsI_16042                          218   1e-63    Oryza sativa Indica Group [Indian rice]
emb|CDX92627.1|  BnaC07g38850D                                          217   2e-63    
ref|XP_009391802.1|  PREDICTED: MLO-like protein 13                     218   2e-63    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010097666.1|  MLO-like protein 1                                 216   2e-63    
ref|XP_008668644.1|  PREDICTED: barley mlo defense gene homolog3 ...    217   2e-63    Zea mays [maize]
ref|XP_006648422.1|  PREDICTED: MLO-like protein 13-like                215   3e-63    
ref|NP_001105527.1|  barley mlo defense gene homolog3                   216   5e-63    Zea mays [maize]
ref|XP_003571073.1|  PREDICTED: MLO-like protein 13                     216   6e-63    Brachypodium distachyon [annual false brome]
ref|XP_004962064.1|  PREDICTED: MLO-like protein 1-like isoform X2      214   7e-63    
emb|CDY10997.1|  BnaA03g46560D                                          216   7e-63    Brassica napus [oilseed rape]
ref|XP_002447908.1|  hypothetical protein SORBIDRAFT_06g017770          216   8e-63    Sorghum bicolor [broomcorn]
ref|XP_009137434.1|  PREDICTED: MLO-like protein 13                     216   9e-63    Brassica rapa
emb|CAD40974.1|  OSJNBa0027P08.3                                        215   1e-62    
ref|XP_006413455.1|  hypothetical protein EUTSA_v10024937mg             215   2e-62    
ref|XP_009395397.1|  PREDICTED: MLO-like protein 9                      214   8e-62    
ref|XP_008379019.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...    219   1e-61    
emb|CDY03468.1|  BnaC01g16140D                                          212   2e-61    
ref|XP_004975728.1|  PREDICTED: MLO-like protein 1-like                 211   3e-61    
gb|EEC72681.1|  hypothetical protein OsI_06239                          212   3e-61    
ref|XP_008786683.1|  PREDICTED: MLO-like protein 10                     211   3e-61    
ref|XP_006855670.1|  hypothetical protein AMTR_s00044p00123510          213   5e-61    
emb|CDY34270.1|  BnaA01g13730D                                          211   6e-61    
ref|XP_009137855.1|  PREDICTED: MLO-like protein 13                     211   6e-61    
emb|CDP17762.1|  unnamed protein product                                210   9e-61    
ref|XP_008647383.1|  PREDICTED: uncharacterized protein LOC100193...    210   1e-60    
ref|XP_004978312.1|  PREDICTED: MLO-like protein 5-like                 211   1e-60    
ref|XP_008228898.1|  PREDICTED: MLO protein homolog 1-like              211   2e-60    
ref|XP_009386660.1|  PREDICTED: MLO-like protein 9                      210   5e-60    
gb|EMS53724.1|  MLO-like protein 5                                      209   1e-59    
ref|XP_006654121.1|  PREDICTED: MLO-like protein 5-like                 209   1e-59    
emb|CBI40746.3|  unnamed protein product                                208   1e-59    
ref|XP_002273002.1|  PREDICTED: MLO protein homolog 1-like              208   2e-59    
gb|EMT10344.1|  MLO-like protein 1                                      197   4e-59    
gb|KJB23604.1|  hypothetical protein B456_004G106900                    204   5e-59    
gb|KDO49430.1|  hypothetical protein CISIN_1g0104501mg                  203   5e-59    
ref|XP_008237952.1|  PREDICTED: MLO protein homolog 1-like              207   5e-59    
ref|XP_009355375.1|  PREDICTED: MLO-like protein 13                     206   5e-59    
ref|XP_009372684.1|  PREDICTED: MLO protein homolog 1-like              207   9e-59    
ref|NP_001054825.2|  Os05g0183300                                       200   1e-58    
ref|XP_007210822.1|  hypothetical protein PRUPE_ppa020311mg             206   1e-58    
gb|KJB44399.1|  hypothetical protein B456_007G250700                    204   1e-58    
ref|NP_001105170.1|  barley mlo defense gene homolog6                   205   1e-58    
ref|XP_007018110.1|  Seven transmembrane MLO family protein             205   2e-58    
gb|EEC78643.1|  hypothetical protein OsI_18731                          201   2e-58    
ref|XP_004486414.1|  PREDICTED: MLO-like protein 13-like                203   2e-58    
gb|AFW69614.1|  hypothetical protein ZEAMMB73_948296                    206   3e-58    
gb|EEE62569.1|  hypothetical protein OsJ_17368                          201   3e-58    
gb|ACN85209.1|  Mlo family protein                                      202   3e-58    
gb|ACN85176.1|  Mlo family protein                                      202   3e-58    
gb|ACN85192.1|  Mlo family protein                                      202   3e-58    
ref|XP_003568790.1|  PREDICTED: MLO-like protein 9                      205   3e-58    
ref|XP_002439069.1|  hypothetical protein SORBIDRAFT_10g031010          204   4e-58    
ref|XP_010030234.1|  PREDICTED: MLO-like protein 13                     203   4e-58    
gb|AAU44315.1|  hypothetical protein                                    200   4e-58    
gb|ACN85231.1|  Mlo family protein                                      201   5e-58    
ref|XP_002972783.1|  hypothetical protein SELMODRAFT_97970              204   6e-58    
gb|KJB70717.1|  hypothetical protein B456_011G089600                    201   6e-58    
ref|XP_002984361.1|  hypothetical protein SELMODRAFT_120181             204   6e-58    
gb|ACN85224.1|  Mlo family protein                                      201   7e-58    
gb|EMS50279.1|  MLO-like protein 13                                     203   7e-58    
ref|XP_010682204.1|  PREDICTED: MLO-like protein 13                     202   1e-57    
gb|EMT01433.1|  MLO-like protein 5                                      202   1e-57    
ref|XP_009384603.1|  PREDICTED: MLO-like protein 10                     201   1e-57    
gb|KDO53879.1|  hypothetical protein CISIN_1g010805mg                   202   2e-57    
ref|XP_010064954.1|  PREDICTED: MLO-like protein 9                      203   2e-57    
ref|XP_008218604.1|  PREDICTED: endoglucanase 25                        208   2e-57    
gb|ACN85283.1|  Mlo family protein                                      199   2e-57    
gb|ACN85263.1|  Mlo family protein                                      199   2e-57    
ref|XP_007046462.1|  Seven transmembrane MLO family protein             203   3e-57    
ref|XP_008379649.1|  PREDICTED: MLO-like protein 8                      203   3e-57    
gb|ACN85241.1|  Mlo family protein                                      199   3e-57    
ref|XP_002963998.1|  hypothetical protein SELMODRAFT_81494              198   3e-57    
ref|XP_002967927.1|  hypothetical protein SELMODRAFT_88157              200   4e-57    
ref|XP_009601752.1|  PREDICTED: MLO-like protein 8                      202   4e-57    
ref|XP_010663996.1|  PREDICTED: MLO-like protein 9                      202   4e-57    
gb|ACN85251.1|  Mlo family protein                                      199   4e-57    
gb|ACN85338.1|  Mlo family protein                                      199   5e-57    
ref|XP_009359622.1|  PREDICTED: MLO-like protein 8                      202   5e-57    
ref|XP_009395303.1|  PREDICTED: MLO-like protein 6                      202   5e-57    
ref|XP_004232584.1|  PREDICTED: MLO-like protein 8                      202   5e-57    
ref|XP_010270524.1|  PREDICTED: MLO-like protein 9                      202   6e-57    
ref|XP_009772716.1|  PREDICTED: MLO-like protein 10                     201   7e-57    
ref|XP_010693799.1|  PREDICTED: uncharacterized protein LOC104906705    205   7e-57    
emb|CDP07267.1|  unnamed protein product                                201   9e-57    
ref|XP_003560590.1|  PREDICTED: MLO-like protein 13                     200   1e-56    
ref|XP_006587547.1|  PREDICTED: MLO-like protein 10-like isoform X2     199   1e-56    
ref|XP_007156260.1|  hypothetical protein PHAVU_003G271300g             201   1e-56    
dbj|BAA82156.1|  salt-stress responding gene                            188   1e-56    
ref|XP_002276608.1|  PREDICTED: MLO-like protein 10                     200   2e-56    
ref|XP_008237943.1|  PREDICTED: MLO-like protein 9                      199   2e-56    
ref|XP_009390750.1|  PREDICTED: MLO-like protein 9 isoform X1           200   2e-56    
ref|XP_010918343.1|  PREDICTED: MLO protein homolog 1                   200   2e-56    
ref|XP_006599251.1|  PREDICTED: MLO-like protein 8-like                 200   3e-56    
gb|KHN12501.1|  MLO-like protein 8                                      200   3e-56    
emb|CBI40748.3|  unnamed protein product                                199   3e-56    
ref|XP_007147546.1|  hypothetical protein PHAVU_006G133800g             198   3e-56    
ref|XP_007013887.1|  Seven transmembrane MLO family protein, puta...    197   4e-56    
ref|XP_007211108.1|  hypothetical protein PRUPE_ppa024488mg             198   4e-56    
gb|KJB14197.1|  hypothetical protein B456_002G113800                    199   4e-56    
gb|EYU41181.1|  hypothetical protein MIMGU_mgv1a007661mg                196   4e-56    
gb|ACN85293.1|  Mlo family protein                                      196   4e-56    
ref|XP_003534232.1|  PREDICTED: MLO-like protein 10-like isoform X1     200   4e-56    
ref|XP_009779220.1|  PREDICTED: MLO-like protein 13                     197   5e-56    
gb|EMS53781.1|  MLO-like protein 1                                      195   5e-56    
ref|XP_009418888.1|  PREDICTED: MLO-like protein 9                      199   6e-56    
ref|XP_004144292.1|  PREDICTED: MLO-like protein 5-like                 199   6e-56    
ref|XP_008464826.1|  PREDICTED: MLO-like protein 9                      199   7e-56    
gb|KHN35943.1|  MLO-like protein 8                                      199   9e-56    
gb|ABB47940.1|  MLO-like protein 10, putative, expressed                197   1e-55    
ref|XP_006343450.1|  PREDICTED: MLO-like protein 3-like                 197   1e-55    
ref|XP_003517123.1|  PREDICTED: MLO-like protein 8-like isoform 1       199   1e-55    
ref|XP_008352533.1|  PREDICTED: MLO-like protein 3                      194   1e-55    
ref|XP_009603524.1|  PREDICTED: MLO-like protein 13                     196   1e-55    
gb|AES64675.2|  seven transmembrane MLO family protein                  196   1e-55    
dbj|BAD35488.1|  putative seven transmembrane protein Mlo7              197   1e-55    
ref|XP_009382074.1|  PREDICTED: MLO-like protein 9                      198   2e-55    
gb|EYU36580.1|  hypothetical protein MIMGU_mgv1a020678mg                198   2e-55    
ref|NP_001065189.1|  Os10g0541000                                       197   2e-55    
ref|XP_010680631.1|  PREDICTED: MLO-like protein 10 isoform X1          197   2e-55    
ref|XP_006356610.1|  PREDICTED: MLO-like protein 5-like                 197   2e-55    
ref|XP_004500844.1|  PREDICTED: MLO protein homolog 1-like              197   2e-55    
ref|XP_006855658.1|  hypothetical protein AMTR_s00044p00117330          189   3e-55    
gb|AAG46114.1|AC073166_12  putative Mlo (pathogen resistance) pro...    197   3e-55    
ref|XP_004240662.1|  PREDICTED: MLO-like protein 3                      196   3e-55    
ref|XP_010539025.1|  PREDICTED: MLO-like protein 9                      196   3e-55    
gb|EAY79378.1|  hypothetical protein OsI_34504                          197   4e-55    
gb|EMT15554.1|  MLO-like protein 1                                      194   4e-55    
ref|XP_009347039.1|  PREDICTED: MLO-like protein 3                      197   4e-55    
ref|XP_006366656.1|  PREDICTED: MLO-like protein 8-like isoform X2      196   4e-55    
gb|AHF52923.1|  Mlo protein                                             197   4e-55    
ref|XP_008338387.1|  PREDICTED: MLO-like protein 3                      196   5e-55    
ref|XP_008806842.1|  PREDICTED: MLO-like protein 6                      197   5e-55    
ref|XP_008680455.1|  PREDICTED: MLO-like protein 1                      186   6e-55    
ref|XP_002510708.1|  Protein MLO, putative                              196   6e-55    
ref|XP_004301591.2|  PREDICTED: endoglucanase 25                        201   6e-55    
gb|AHF52924.1|  Mlo protein                                             196   6e-55    
gb|ACN85277.1|  Mlo family protein                                      193   7e-55    
ref|XP_008804588.1|  PREDICTED: MLO-like protein 9 isoform X2           195   8e-55    
gb|KDO53881.1|  hypothetical protein CISIN_1g010805mg                   192   8e-55    
ref|XP_006473919.1|  PREDICTED: MLO protein homolog 1-like              194   8e-55    
ref|XP_006366655.1|  PREDICTED: MLO-like protein 8-like isoform X1      196   9e-55    
tpg|DAA46106.1|  TPA: hypothetical protein ZEAMMB73_604520              193   1e-54    
gb|ACN85322.1|  Mlo family protein                                      192   1e-54    
ref|XP_011022136.1|  PREDICTED: MLO-like protein 8                      196   1e-54    
ref|XP_004231310.1|  PREDICTED: MLO-like protein 13                     194   1e-54    
ref|XP_004159746.1|  PREDICTED: MLO-like protein 8-like                 194   2e-54    
ref|XP_010934812.1|  PREDICTED: MLO-like protein 2                      195   2e-54    
gb|KJB10419.1|  hypothetical protein B456_001G200000                    194   2e-54    
gb|KHN33781.1|  MLO protein like 1                                      195   2e-54    
ref|XP_004253244.1|  PREDICTED: MLO-like protein 9                      195   2e-54    
ref|XP_008804580.1|  PREDICTED: MLO-like protein 9 isoform X1           195   2e-54    
ref|XP_011098016.1|  PREDICTED: MLO-like protein 10 isoform X2          194   2e-54    
ref|XP_002465008.1|  hypothetical protein SORBIDRAFT_01g030400          195   2e-54    
ref|XP_006435410.1|  hypothetical protein CICLE_v10003446mg             195   2e-54    
ref|XP_006358492.1|  PREDICTED: MLO-like protein 13-like                193   2e-54    
ref|XP_011077127.1|  PREDICTED: MLO-like protein 12                     193   3e-54    
gb|KEH36350.1|  seven transmembrane MLO family protein                  193   3e-54    
gb|ACN85306.1|  Mlo family protein                                      191   3e-54    
ref|XP_008378938.1|  PREDICTED: MLO-like protein 13                     193   3e-54    
ref|XP_006657125.1|  PREDICTED: MLO-like protein 1-like                 193   4e-54    
gb|EMS61495.1|  MLO-like protein 8                                      193   4e-54    
ref|XP_006431345.1|  hypothetical protein CICLE_v10000909mg             193   4e-54    
gb|KDO53878.1|  hypothetical protein CISIN_1g010805mg                   193   5e-54    
ref|XP_009790030.1|  PREDICTED: MLO-like protein 8                      194   5e-54    
ref|XP_011098015.1|  PREDICTED: MLO-like protein 10 isoform X1          194   5e-54    
gb|KJB10414.1|  hypothetical protein B456_001G200000                    194   5e-54    
ref|XP_004146181.1|  PREDICTED: MLO-like protein 8-like                 194   5e-54    
ref|XP_006431344.1|  hypothetical protein CICLE_v10000909mg             193   5e-54    
ref|XP_004983794.1|  PREDICTED: MLO-like protein 5-like                 194   5e-54    
ref|XP_003527633.1|  PREDICTED: MLO-like protein 5-like                 193   6e-54    
ref|XP_006470774.1|  PREDICTED: MLO-like protein 13-like                192   6e-54    
gb|KHN20092.1|  MLO-like protein 5                                      192   6e-54    
ref|XP_002307201.1|  hypothetical protein POPTR_0005s10210g             194   6e-54    
ref|XP_009619517.1|  PREDICTED: MLO-like protein 8                      194   6e-54    
ref|XP_004147296.1|  PREDICTED: MLO-like protein 3-like                 194   6e-54    
gb|KJB55488.1|  hypothetical protein B456_009G078700                    192   6e-54    
ref|XP_004163965.1|  PREDICTED: MLO-like protein 3-like                 194   6e-54    
gb|EPS69703.1|  hypothetical protein M569_05063                         187   6e-54    
emb|CDP06355.1|  unnamed protein product                                193   6e-54    
ref|XP_008385292.1|  PREDICTED: MLO-like protein 3                      188   7e-54    
gb|KHN20094.1|  MLO protein like 1                                      193   7e-54    
ref|XP_003527634.1|  PREDICTED: MLO protein homolog 1-like              193   7e-54    
gb|KHN33779.1|  MLO-like protein 5                                      192   8e-54    
gb|AAK53798.1|AF369566_1  membrane protein Mlo5                         192   8e-54    
ref|XP_007135969.1|  hypothetical protein PHAVU_009G007000g             193   9e-54    
ref|XP_008225359.1|  PREDICTED: MLO-like protein 3 isoform X2           193   9e-54    
gb|KJB10418.1|  hypothetical protein B456_001G200000                    194   1e-53    
ref|XP_008225351.1|  PREDICTED: MLO-like protein 3 isoform X1           193   1e-53    
ref|NP_001105168.1|  barley mlo defense gene homolog2                   193   1e-53    
ref|XP_010413828.1|  PREDICTED: MLO-like protein 5                      192   1e-53    
ref|XP_003603854.1|  MLO protein-like protein                           192   1e-53    
ref|XP_010686828.1|  PREDICTED: MLO-like protein 9                      191   1e-53    
ref|XP_011074255.1|  PREDICTED: MLO-like protein 9                      192   1e-53    
ref|XP_003523524.1|  PREDICTED: MLO-like protein 5-like                 192   1e-53    
dbj|BAJ96109.1|  predicted protein                                      185   1e-53    
gb|ABD32919.1|  Mlo-related protein                                     192   2e-53    
gb|KJB55487.1|  hypothetical protein B456_009G078700                    192   2e-53    
ref|XP_003594424.1|  MLO-like protein                                   191   2e-53    
ref|XP_007015440.1|  MLO, putative                                      192   2e-53    
ref|XP_008786739.1|  PREDICTED: MLO protein homolog 1                   192   2e-53    
ref|XP_011089886.1|  PREDICTED: MLO-like protein 3                      192   2e-53    
gb|ADV29809.1|  MLO1 protein                                            192   2e-53    
ref|XP_008448446.1|  PREDICTED: MLO-like protein 8 isoform X2           191   2e-53    
ref|XP_010523625.1|  PREDICTED: MLO-like protein 9                      191   2e-53    
gb|KDO73200.1|  hypothetical protein CISIN_1g012859mg                   190   2e-53    
ref|XP_003540745.1|  PREDICTED: MLO-like protein 6-like isoform X1      192   3e-53    
gb|KDP43787.1|  hypothetical protein JCGZ_22414                         192   3e-53    
ref|XP_007015436.1|  Seven transmembrane MLO family protein isofo...    192   3e-53    
ref|XP_007135967.1|  hypothetical protein PHAVU_009G006800g             192   3e-53    
ref|XP_010030238.1|  PREDICTED: MLO-like protein 13                     190   3e-53    
ref|XP_006662559.1|  PREDICTED: MLO-like protein 9-like                 192   3e-53    
ref|XP_009141335.1|  PREDICTED: MLO-like protein 5                      191   3e-53    
ref|XP_011034835.1|  PREDICTED: MLO protein homolog 1-like              192   3e-53    
ref|XP_010935416.1|  PREDICTED: MLO-like protein 9                      191   4e-53    
ref|XP_003581276.1|  PREDICTED: MLO-like protein 1                      190   4e-53    
ref|XP_002282216.1|  PREDICTED: MLO-like protein 6                      192   4e-53    
ref|XP_006296403.1|  hypothetical protein CARUB_v10025579mg             190   5e-53    
ref|XP_006850616.1|  hypothetical protein AMTR_s00034p00158070          192   5e-53    
ref|XP_003574266.1|  PREDICTED: MLO-like protein 9                      191   6e-53    
ref|NP_180923.1|  MLO-like protein 5                                    190   6e-53    
ref|XP_009411538.1|  PREDICTED: MLO-like protein 6                      191   7e-53    
gb|EMS49774.1|  MLO-like protein 1                                      187   7e-53    
gb|AAK53802.1|AF369570_1  membrane protein Mlo9                         186   7e-53    
ref|XP_009586729.1|  PREDICTED: MLO-like protein 9                      190   7e-53    
ref|XP_003538050.1|  PREDICTED: MLO-like protein 6-like                 191   7e-53    
gb|KFK31027.1|  hypothetical protein AALP_AA6G058600                    189   7e-53    
ref|XP_006649324.1|  PREDICTED: MLO protein homolog 1-like              191   8e-53    
gb|EMS51317.1|  MLO-like protein 1                                      187   8e-53    
gb|EYU18859.1|  hypothetical protein MIMGU_mgv1a003503mg                191   8e-53    
ref|XP_010270522.1|  PREDICTED: MLO-like protein 9 isoform X1           190   8e-53    
ref|XP_008448445.1|  PREDICTED: MLO-like protein 10 isoform X1          191   9e-53    
gb|KHG27081.1|  MLO-like protein 3                                      190   9e-53    
emb|CBI16290.3|  unnamed protein product                                192   9e-53    



>ref|XP_009621845.1| PREDICTED: MLO-like protein 1 [Nicotiana tomentosiformis]
Length=490

 Score =   373 bits (957),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 180/213 (85%), Positives = 196/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+PFILLLAVGTKLEHVIIQLAHEVAEKHV
Sbjct  277  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFVPFILLLAVGTKLEHVIIQLAHEVAEKHV  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV PSDEHFWF RPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMG V F
Sbjct  337  AIEGELVVTPSDEHFWFNRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGQVGF  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGVIIQ+LCSYSTLP+YA+VTQMGTHFKKSIFDEHIQVGL+GWA+K K++KGLK
Sbjct  397  IVPRLVIGVIIQILCSYSTLPLYALVTQMGTHFKKSIFDEHIQVGLIGWAEKVKRKKGLK  456

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGST  124
            AA    N G + T+GS+ G+QM G+GRKE  + 
Sbjct  457  AATESSNQGNS-TEGSTVGLQMSGIGRKEPPAN  488



>ref|XP_009770323.1| PREDICTED: MLO-like protein 1 [Nicotiana sylvestris]
Length=492

 Score =   372 bits (956),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 181/213 (85%), Positives = 197/213 (92%), Gaps = 1/213 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLL+N+NGWHTYFWIAF+PFILLLAVGTKLEHVIIQLAHEVAEKHV
Sbjct  279  VVGISWYLWVFVVIFLLVNVNGWHTYFWIAFVPFILLLAVGTKLEHVIIQLAHEVAEKHV  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV PSDEHFWF RPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMG V F
Sbjct  339  AIEGELVVTPSDEHFWFNRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGQVGF  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGVIIQVLCSYSTLP+YA+VTQMGTHFKKSIFDEHIQVGL+GWA+K K++KGLK
Sbjct  399  IVPRLVIGVIIQVLCSYSTLPLYALVTQMGTHFKKSIFDEHIQVGLLGWAEKVKRKKGLK  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGST  124
            AA  G N G + T+GS+ G+QM G+GRKE  + 
Sbjct  459  AATEGSNQGSS-TEGSTVGLQMLGIGRKEPPAN  490



>ref|XP_011089565.1| PREDICTED: MLO-like protein 1 [Sesamum indicum]
Length=498

 Score =   372 bits (954),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 194/210 (92%), Gaps = 1/210 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFV+IFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  278  VVGISWYLWVFVIIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV+PSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMG V++
Sbjct  338  AIEGELVVKPSDNHFWFHRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGQVRY  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YA+VTQMGT+FKKSIFDEH+QVGLVGWAQKAK+RKGLK
Sbjct  398  IVPRLIIGVFIQVLCSYSTLPLYALVTQMGTYFKKSIFDEHVQVGLVGWAQKAKKRKGLK  457

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKES  133
            A  GG   GG+ T+G S G+QM  +GRKE 
Sbjct  458  ATLGGSTQGGS-TNGPSIGIQMAAIGRKEE  486



>emb|CDP04006.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   359 bits (922),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 187/205 (91%), Gaps = 1/205 (0%)
 Frame = -2

Query  750  SWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEG  571
            +WYLW+FVV+FLLLN+NGWHTYFWIAFIPFILLLAVGTKLEH+I QLAHEVAEKHVAIEG
Sbjct  261  NWYLWIFVVVFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHIISQLAHEVAEKHVAIEG  320

Query  570  ELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPR  391
            EL VQPSD+HFWF RPQIVLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V++I+PR
Sbjct  321  ELAVQPSDDHFWFHRPQIVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRYIVPR  380

Query  390  LVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFG  211
            L+IGV IQVLCSYSTLP+YAIVTQMGTHFKKSIFDEH+QVGL+GWAQK KQ+KGLK   G
Sbjct  381  LIIGVFIQVLCSYSTLPLYAIVTQMGTHFKKSIFDEHVQVGLLGWAQKVKQKKGLKGPLG  440

Query  210  GINHGGALTDGSSTGVQMGGVGRKE  136
            G N   + T+G S GVQMGG GRKE
Sbjct  441  GSNQRNS-TEGPSAGVQMGGTGRKE  464



>ref|XP_006344359.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=477

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 190/213 (89%), Gaps = 4/213 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFL LN+NGWHTYFWIAFIPF+LL+AVGTKLEHVIIQLAHEVAEKHV
Sbjct  269  VVGISWYLWVFVVIFLFLNVNGWHTYFWIAFIPFVLLIAVGTKLEHVIIQLAHEVAEKHV  328

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RPQIVL LIHFILFQNAFEIAFFFWILVQYGF+SCIMG V F
Sbjct  329  AIEGELVVQPSDDHFWFKRPQIVLILIHFILFQNAFEIAFFFWILVQYGFNSCIMGQVGF  388

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGVIIQVLCSYSTLP+YA+VTQMGTHFKKSIFDEHIQVGL+GWA KAK ++GLK
Sbjct  389  IVPRLVIGVIIQVLCSYSTLPLYALVTQMGTHFKKSIFDEHIQVGLLGWASKAKMKRGLK  448

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGST  124
            AA       G   +GS+  +QM G+ +KE+  T
Sbjct  449  AA----TDAGTSIEGSTVRLQMSGINQKETTPT  477



>gb|EYU36872.1| hypothetical protein MIMGU_mgv1a004875mg [Erythranthe guttata]
Length=506

 Score =   352 bits (903),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 191/219 (87%), Gaps = 9/219 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNINGWHTYFWIAF PF+LLLAVG KLEH+I QLAHEVAEKH+
Sbjct  276  VVGISWYLWVFVVLFLLLNINGWHTYFWIAFFPFVLLLAVGAKLEHIISQLAHEVAEKHI  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWI VQYGF+SCIMG V++
Sbjct  336  AIEGELVVQPSDDHFWFRRPRIVLILIHFILFQNAFEIAFFFWIWVQYGFNSCIMGKVRY  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YA+VTQMGTHFKKSIF+EH+QVGLVGWAQK K+++GLK
Sbjct  396  IVPRLIIGVFIQVLCSYSTLPLYALVTQMGTHFKKSIFEEHVQVGLVGWAQKVKKKQGLK  455

Query  222  AAFGGINHGGAL---------TDGSSTGVQMGGVGRKES  133
            AA GG    G+          T GSS G+QM G+ R+E+
Sbjct  456  AALGGSTQAGSTQGGSTQAGSTGGSSLGIQMAGIARRET  494



>ref|XP_008460095.1| PREDICTED: MLO-like protein 1 [Cucumis melo]
Length=514

 Score =   349 bits (895),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 171/230 (74%), Positives = 195/230 (85%), Gaps = 10/230 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  292  VVGISWYLWIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHV  351

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++
Sbjct  352  AIEGDLVVQPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRY  411

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV +QVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+QVGLVGWAQK K+RKGL+
Sbjct  412  IIPRLIIGVFVQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQVGLVGWAQKVKKRKGLR  471

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            AA  G +  G    GS+ G+Q+G V RK S         A Q++  D SK
Sbjct  472  AAADGSSQ-GVKEGGSTVGIQLGNVMRKAS---------APQEIKPDDSK  511



>ref|XP_004145008.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
 ref|XP_004154026.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
 ref|XP_004160672.1| PREDICTED: MLO-like protein 1-like [Cucumis sativus]
Length=516

 Score =   348 bits (894),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 195/230 (85%), Gaps = 10/230 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  292  VVGISWYLWIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHI  351

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++
Sbjct  352  AIEGDLVVQPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRY  411

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV +QVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+QVGLVGWAQK K+RKGL+
Sbjct  412  IIPRLIIGVFVQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQVGLVGWAQKVKKRKGLR  471

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            AA  G +  G    GS+ G+Q+G V RK S         A Q++  D SK
Sbjct  472  AAADGSSQ-GVKEGGSTVGIQLGNVMRKAS---------APQEIKPDDSK  511



>ref|NP_001284374.1| MLO-like protein 1 [Cucumis melo]
 gb|ACX55085.1| Mlo1 [Cucumis melo]
Length=516

 Score =   346 bits (888),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 170/230 (74%), Positives = 194/230 (84%), Gaps = 10/230 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  292  VVGISWYLWIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHV  351

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++
Sbjct  352  AIEGDLVVQPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRY  411

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV +QVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+QVGLVGWAQK K+RKGL+
Sbjct  412  IIPRLIIGVFVQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQVGLVGWAQKVKKRKGLR  471

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            AA  G +  G    GS+ G+Q+G V RK           A Q++  D SK
Sbjct  472  AAADGSSQ-GVKEGGSTVGIQLGNVMRK---------AFAPQEIKPDDSK  511



>ref|XP_010052699.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
 gb|KCW76769.1| hypothetical protein EUGRSUZ_D01126 [Eucalyptus grandis]
 gb|KCW76770.1| hypothetical protein EUGRSUZ_D01126 [Eucalyptus grandis]
Length=514

 Score =   342 bits (878),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 196/234 (84%), Gaps = 11/234 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  288  VVGISWYLWIFVVVFLLLNVNGWHTYFWIAFLPCILLLAVGTKLEHVITQLAHEVAEKHI  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGELVVQPSDEHFWF RP+IVL+LIHFILFQ AFEIAFFFWI  QYGFDSCIMG V++
Sbjct  348  AVEGELVVQPSDEHFWFQRPRIVLYLIHFILFQIAFEIAFFFWIWFQYGFDSCIMGKVRY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV IQVLCSYSTLP+YAIVTQMG+ FKK+IFD+H+QVGLV WA+KAK++KGL+
Sbjct  408  IIPRLIIGVFIQVLCSYSTLPLYAIVTQMGSSFKKAIFDDHLQVGLVNWAEKAKKKKGLR  467

Query  222  AAFGGINHGGALT--DGSSTGVQMGGVGRKES--GSTDGASVRALQQMGGDGSK  73
            AA G  +  G  +  DGS+  VQ+G V RK S  G T   S       G +GSK
Sbjct  468  AAAGDGSGSGQASSHDGSTIRVQLGRVFRKASAPGETQPTS-------GPEGSK  514



>ref|XP_003522288.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHN33659.1| MLO-like protein 1 [Glycine soja]
Length=506

 Score =   341 bits (875),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 162/217 (75%), Positives = 190/217 (88%), Gaps = 2/217 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAFIP ILLLAVGTKLEH+I QLAHEVAEKH 
Sbjct  282  VVGISWYLWLFVVIFLLLNINGWHTYFWIAFIPVILLLAVGTKLEHIITQLAHEVAEKHA  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  342  AIEGDLVVQPSDDHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMGTH+K++IF++H+Q  +VGWAQKAK+RKGLK
Sbjct  402  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTHYKRAIFNDHLQQNIVGWAQKAKKRKGLK  461

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            A   G    G+  + ++TG+Q+G + +K +   D +S
Sbjct  462  A--DGNPGQGSSQESANTGIQLGSIFKKATAPGDSSS  496



>gb|KDP39614.1| hypothetical protein JCGZ_02634 [Jatropha curcas]
Length=536

 Score =   342 bits (877),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 159/202 (79%), Positives = 184/202 (91%), Gaps = 0/202 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVIIQLAH+VAEKHV
Sbjct  287  VVGISWYLWIFVIIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIIQLAHDVAEKHV  346

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L+V+PSD+HFWFGRP IVLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V++
Sbjct  347  AIEGDLIVKPSDDHFWFGRPHIVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRY  406

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGVIIQ+LCSYSTLP+YAIVTQMG+ FK++IFD+HIQ G+VGWAQKAK++KGL+
Sbjct  407  IVPRLIIGVIIQILCSYSTLPLYAIVTQMGSSFKRAIFDDHIQAGIVGWAQKAKKKKGLR  466

Query  222  AAFGGINHGGALTDGSSTGVQM  157
            AA        A +  SS G+Q+
Sbjct  467  AAAATDGSNQASSHESSVGIQL  488



>gb|EPS69012.1| hypothetical protein M569_05755 [Genlisea aurea]
Length=477

 Score =   338 bits (866),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 170/211 (81%), Positives = 181/211 (86%), Gaps = 14/211 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  272  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHV  331

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGELVVQPSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWI VQYGFDSCIMG V+F
Sbjct  332  AVEGELVVQPSDDHFWFSRPKIVLVLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGRVRF  391

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL-  226
            I+PRL+I VIIQ LCSYSTLP+YA+VTQMGTHFKKSIFDEH+Q GLVGWAQK K+RKGL 
Sbjct  392  IVPRLIIAVIIQTLCSYSTLPLYALVTQMGTHFKKSIFDEHVQAGLVGWAQKVKKRKGLG  451

Query  225  -------KAAFG-GINHGGALTDGSSTGVQM  157
                    A  G G NHG A     S G Q+
Sbjct  452  SGSGSGSAAVTGEGSNHGAA-----SAGTQV  477



>ref|NP_001045040.1| Os01g0888600 [Oryza sativa Japonica Group]
 dbj|BAB92639.1| putative seven transmembrane protein Mlo8 [Oryza sativa Japonica 
Group]
 dbj|BAD82145.1| putative seven transmembrane protein Mlo8 [Oryza sativa Japonica 
Group]
 dbj|BAF06954.1| Os01g0888600 [Oryza sativa Japonica Group]
 dbj|BAH00453.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC71925.1| hypothetical protein OsI_04724 [Oryza sativa Indica Group]
 gb|EEE55778.1| hypothetical protein OsJ_04347 [Oryza sativa Japonica Group]
Length=502

 Score =   337 bits (864),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 161/226 (71%), Positives = 190/226 (84%), Gaps = 5/226 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWHTYFWI+F+P +LLLAVGTKLEHVI QLAHEVAEKH 
Sbjct  278  VVGISWYLWIFVMIFLLLNVNGWHTYFWISFVPLLLLLAVGTKLEHVITQLAHEVAEKHS  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSDEHFWFGRP+++L+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV F
Sbjct  338  AIEGDLVVNPSDEHFWFGRPKVILYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPF  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+ RL+IG I+Q+LCSYSTLPIYAIVTQMG+ FKK IFDEH+Q GLVGWAQKAK+RKGLK
Sbjct  398  ILTRLIIGAIVQILCSYSTLPIYAIVTQMGSFFKKEIFDEHVQQGLVGWAQKAKKRKGLK  457

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK----ESGSTDGASVRALQ  97
             + G +   G+ T+GSS    +  + R+    E GS++G  +R  Q
Sbjct  458  ESNGAMAGAGS-TNGSSQPSSILQMVRRAAASEEGSSNGGDMRTNQ  502



>ref|XP_003527594.1| PREDICTED: MLO-like protein 1-like [Glycine max]
Length=488

 Score =   336 bits (862),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 190/228 (83%), Gaps = 4/228 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAFIP +LLLAVGTKL HVI QLA EVAEKH 
Sbjct  264  VVGISWYLWLFVVIFLLLNINGWHTYFWIAFIPVVLLLAVGTKLGHVITQLAQEVAEKHA  323

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSDEHFWF RP +VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  324  AIEGDLVVQPSDEHFWFHRPHVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  383

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMGTH+K++IF+EH+Q  +VGWAQKAK+RKGLK
Sbjct  384  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTHYKRAIFNEHLQQNIVGWAQKAKKRKGLK  443

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDG  79
            A   G    G+  + ++TG+Q+G + +K   S  G S  A +  G + 
Sbjct  444  A--DGNPGQGSSQESANTGIQLGSIFKK--ASAPGGSSSATKADGTNS  487



>ref|XP_006437327.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
 gb|ESR50567.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
Length=448

 Score =   335 bits (859),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 188/230 (82%), Gaps = 9/230 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+
Sbjct  228  VVGISWYLWIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHI  287

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +
Sbjct  288  AIEGELVVQPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCY  347

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIVTQMG+ FKK+IF+E++QVG+VGWA+K +++K  K
Sbjct  348  IVPRLIIGVFIQVLCSYSTLPLYAIVTQMGSSFKKAIFEENVQVGIVGWAEKVRRKKDPK  407

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            AA       G+    S  GVQ+G   RK S   +          G +GSK
Sbjct  408  AA-----KDGSTQSSSHQGVQLGRAFRKSSTPEEIQP----STHGSEGSK  448



>gb|KHN19980.1| MLO-like protein 1 [Glycine soja]
Length=488

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 165/228 (72%), Positives = 190/228 (83%), Gaps = 4/228 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAFIP +LLLAVGTKL HVI QLA EVAEKH 
Sbjct  264  VVGISWYLWLFVVIFLLLNINGWHTYFWIAFIPVVLLLAVGTKLGHVITQLAQEVAEKHA  323

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSDEHFWF RP +VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  324  AIEGDLVVQPSDEHFWFHRPHVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  383

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMGTH+K++IF+EH+Q  +VGWAQKAK+RKGLK
Sbjct  384  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTHYKRAIFNEHLQQNIVGWAQKAKKRKGLK  443

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDG  79
            A   G    G+  + ++TG+Q+G + +K   S  G S  A +  G + 
Sbjct  444  A--DGNPGQGSSQESANTGIQLGSIFKK--ASAPGGSSSATKADGTNS  487



>ref|XP_008369123.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=504

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 190/220 (86%), Gaps = 3/220 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLL+NINGWHTYFWIAF+PF+LLLAVGTKLEH+I QLAHEVAEKH+
Sbjct  279  VVGISWYLWIFVVIFLLMNINGWHTYFWIAFVPFLLLLAVGTKLEHIINQLAHEVAEKHI  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVVQPSD+HFWFG+P++VLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG VK+
Sbjct  339  AVEGDLVVQPSDDHFWFGKPRLVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVKY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIVTQMGTHFKK+IFD+H+QVGLVGWAQK K++K ++
Sbjct  399  IVPRLIIGVFIQVLCSYSTLPLYAIVTQMGTHFKKAIFDDHVQVGLVGWAQKVKKKKAMQ  458

Query  222  AAFGGINHGGALTDGSS-TGVQMGGVGRKESGSTDGASVR  106
            AA    N       GSS  G   G VG + +   + A+ +
Sbjct  459  AA--NANDASDSGQGSSHEGSAAGSVGIQMAKFMNKATKK  496



>ref|XP_008345263.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=504

 Score =   336 bits (862),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 161/220 (73%), Positives = 190/220 (86%), Gaps = 3/220 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLL+NINGWHTYFWIAF+PF+LLLAVGTKLEH+I QLAHEVAEKH+
Sbjct  279  VVGISWYLWIFVVIFLLMNINGWHTYFWIAFVPFLLLLAVGTKLEHIINQLAHEVAEKHI  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVVQPSD+HFWFG+P++VLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG VK+
Sbjct  339  AVEGDLVVQPSDDHFWFGKPRLVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVKY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIVTQMGTHFKK+IFD+H+QVGLVGWAQK K++K ++
Sbjct  399  IVPRLIIGVFIQVLCSYSTLPLYAIVTQMGTHFKKAIFDDHVQVGLVGWAQKVKKKKAMQ  458

Query  222  AAFGGINHGGALTDGSS-TGVQMGGVGRKESGSTDGASVR  106
            AA    N       GSS  G   G VG + +   + A+ +
Sbjct  459  AA--NANDASDSGQGSSHEGSAAGSVGIQMAKFMNKATKK  496



>ref|XP_007029886.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY10388.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=510

 Score =   336 bits (861),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 168/214 (79%), Positives = 186/214 (87%), Gaps = 4/214 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV
Sbjct  289  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  348

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG + +
Sbjct  349  AIEGELVVQPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQIGY  408

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV IQVLCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWAQKAK++KGL+
Sbjct  409  IIPRLVIGVFIQVLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQAGLVGWAQKAKKKKGLR  468

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
            AA        A  +  S  +QMG V R  +   +
Sbjct  469  AATEAA----AQEERPSVAIQMGRVLRNAAAPEE  498



>dbj|BAH57094.1| AT4G02600 [Arabidopsis thaliana]
Length=265

 Score =   327 bits (838),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 185/231 (80%), Gaps = 16/231 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  27   VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHV  86

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  87   AIEGDLVVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  146

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK
Sbjct  147  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLK  206

Query  222  AAFGGINHGGALTDGSST----------------GVQMGGVGRKESGSTDG  118
            AA    + G +                       G+Q+  V R  +G T+ 
Sbjct  207  AAASNGDEGSSQAGPGPDSGSGSAPAAGPGAGFAGIQLSRVTRNNAGDTNN  257



>ref|XP_006437326.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
 ref|XP_006484761.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
 gb|ESR50566.1| hypothetical protein CICLE_v10031281mg [Citrus clementina]
Length=510

 Score =   335 bits (859),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 165/230 (72%), Positives = 188/230 (82%), Gaps = 9/230 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+
Sbjct  290  VVGISWYLWIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHI  349

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +
Sbjct  350  AIEGELVVQPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCY  409

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIVTQMG+ FKK+IF+E++QVG+VGWA+K +++K  K
Sbjct  410  IVPRLIIGVFIQVLCSYSTLPLYAIVTQMGSSFKKAIFEENVQVGIVGWAEKVRRKKDPK  469

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
            AA       G+    S  GVQ+G   RK S   +          G +GSK
Sbjct  470  AA-----KDGSTQSSSHQGVQLGRAFRKSSTPEEIQP----STHGSEGSK  510



>ref|XP_010528781.1| PREDICTED: MLO-like protein 1 [Tarenaya hassleriana]
Length=510

 Score =   333 bits (854),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 166/215 (77%), Positives = 184/215 (86%), Gaps = 1/215 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  288  VVGISWYLWMFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVIAQLAHEVAEKHI  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV+PSDEHFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  348  AIEGELVVKPSDEHFWFDRPHIVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMG+ FKK+IFDE IQVGLVGWAQK K +KGL+
Sbjct  408  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGSSFKKAIFDESIQVGLVGWAQKVKNKKGLR  467

Query  222  AAFGGINHGGALT-DGSSTGVQMGGVGRKESGSTD  121
            AA        A+   G++ G+Q+    R  S + D
Sbjct  468  AAAATTTSSQAVPGGGAAAGIQLSTALRNNSHNPD  502



>ref|XP_006645146.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=507

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 185/229 (81%), Gaps = 9/229 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLLNI+GWHTYFWI+F+P +LLLAVGTKLEHVI QLAHEVAEKH 
Sbjct  278  VVGISWYLWIFVMVFLLLNIHGWHTYFWISFVPLLLLLAVGTKLEHVITQLAHEVAEKHS  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L V PSDEHFWFGRP++VLFLIHFILFQNAFEIAFFFWIL  YG +SCIM H+ F
Sbjct  338  AIEGDLAVNPSDEHFWFGRPKVVLFLIHFILFQNAFEIAFFFWILTSYGINSCIMDHIPF  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGVIIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q GLVGWAQKAK+RKGLK
Sbjct  398  ILPRLIIGVIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQGLVGWAQKAKKRKGLK  457

Query  222  AAFGGINHGGALTDGSS-------TGVQMGGVGRKESGSTDGASVRALQ  97
                G   G   T+GSS         +       +E GS++G  +R  Q
Sbjct  458  EGSSGSTAGA--TNGSSHSQPSSLLAMVRRAAATEEEGSSNGGDMRTDQ  504



>gb|KJB82477.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82478.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82479.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82480.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
 gb|KJB82481.1| hypothetical protein B456_013G197800 [Gossypium raimondii]
Length=504

 Score =   333 bits (853),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 169/214 (79%), Positives = 186/214 (87%), Gaps = 1/214 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAFIPFILLL+VGTKLEHVI QLAHEVAEKHV
Sbjct  285  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFIPFILLLSVGTKLEHVITQLAHEVAEKHV  344

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RP+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++
Sbjct  345  AIEGELVVQPSDDHFWFNRPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRY  404

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KG+K
Sbjct  405  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGVK  464

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
            AA G      +     S  +QMG V R  S   +
Sbjct  465  AATGSAAQENS-EPNPSVAIQMGRVLRNASAPEE  497



>ref|XP_002874907.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51166.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=526

 Score =   333 bits (853),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 163/231 (71%), Positives = 188/231 (81%), Gaps = 16/231 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  288  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHV  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  348  AIEGDLVVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK
Sbjct  408  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLK  467

Query  222  AAFGGINHGGALT-DGSSTG---------------VQMGGVGRKESGSTDG  118
            AA    N G +    G  +G               +Q+G + R  +G T+ 
Sbjct  468  AAASNGNEGSSQAGPGPDSGSGSVPAAGPGAGFAGIQLGRLTRNNAGDTNN  518



>ref|XP_008235036.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=504

 Score =   332 bits (851),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 188/224 (84%), Gaps = 12/224 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLL+NINGWHTYFWIAF PF+LLLAVGTKLEH+I QLAHEVAEKH+
Sbjct  276  VVGISWYLWIFVVIFLLMNINGWHTYFWIAFAPFVLLLAVGTKLEHIITQLAHEVAEKHI  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWFG+P+IVLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG V++
Sbjct  336  AIEGDLVVQPSDDHFWFGKPKIVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVRY  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV IQVLCSYSTLP+YAIV QMGT+FK +IF+EH+QVGLVGWAQK K++K L+
Sbjct  396  IIPRLIIGVFIQVLCSYSTLPLYAIVAQMGTNFKAAIFNEHVQVGLVGWAQKVKKKKSLE  455

Query  222  AAFG----------GINHGGALTDGSSTGVQMGGVGRKESGSTD  121
            AA              +HGG L   S+ G+Q+G    K +   +
Sbjct  456  AANDASGSGSGQGQASSHGGGL--ASNMGIQLGKFINKATKQEE  497



>ref|XP_007137327.1| hypothetical protein PHAVU_009G117900g [Phaseolus vulgaris]
 gb|ESW09321.1| hypothetical protein PHAVU_009G117900g [Phaseolus vulgaris]
Length=513

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 189/219 (86%), Gaps = 3/219 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAFIP ILLL+VGTKLEHVI QLAH+VAEKH 
Sbjct  290  VVGISWYLWLFVVIFLLLNINGWHTYFWIAFIPVILLLSVGTKLEHVITQLAHDVAEKHA  349

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSDEHFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  350  AIEGDLVVQPSDEHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  409

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV IQVLCSYSTLP+YA+VTQMGTH+K++IF++H+Q  +VGWAQKAK+RK  +
Sbjct  410  IIPRLVIGVFIQVLCSYSTLPLYALVTQMGTHYKRAIFNDHLQQNIVGWAQKAKRRKE-Q  468

Query  222  AAFGGINHGGALTDGSSTGVQMGGV-GRKESGSTDGASV  109
             A G    G +  +G +TG+Q+G +  +K SG  + +S 
Sbjct  469  NADGNPGQGSSQENG-NTGIQLGSIFPKKASGPGNSSSA  506



>ref|XP_010277858.1| PREDICTED: MLO-like protein 1 [Nelumbo nucifera]
Length=498

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 185/219 (84%), Gaps = 11/219 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  277  VVGISWYLWLFVVIFLLLNVDGWHTYFWIAFIPFILLLAVGTKLEHVIAQLAHEVAEKHV  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGEL+VQPSD+HFWF RPQIVLFLIH ILFQNAFEIAFFFWI VQYGFDSCIMG V +
Sbjct  337  AVEGELIVQPSDDHFWFHRPQIVLFLIHIILFQNAFEIAFFFWIWVQYGFDSCIMGQVCY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV IQ+LCSYSTLP+YAIVTQMG+ FKKSIFDEH+Q GLVGWA+ AK++ G K
Sbjct  397  IIPRLVIGVFIQILCSYSTLPLYAIVTQMGSSFKKSIFDEHVQEGLVGWARNAKKKMGAK  456

Query  222  AAFGGINHGGALTDGSSTGVQMG-GVGRKESGSTDGASV  109
            A             GS  G+Q+G  V ++ES   +G +V
Sbjct  457  AG----------AKGSIAGIQLGEKVRQRESAMEEGKAV  485



>ref|XP_003636499.1| MLO-like protein [Medicago truncatula]
 gb|KEH18068.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=520

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 163/220 (74%), Positives = 187/220 (85%), Gaps = 6/220 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  298  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPVILLLAVGTKLEHVIIQLAHEVAEKHS  357

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+GEL+VQPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWI +QYGF+SCIMG VKF
Sbjct  358  AIQGELIVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWIWIQYGFNSCIMGQVKF  417

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I PRLV+GV IQVLCSYSTLP+YAIVTQMGTHFK+SIFD+ +Q  L+GWAQKAK +KGL+
Sbjct  418  IYPRLVMGVFIQVLCSYSTLPLYAIVTQMGTHFKRSIFDDQVQTRLIGWAQKAK-KKGLR  476

Query  222  AAFGGINHG--GALTDGSSTGVQMGGVGRKESGSTDGASV  109
               G  NH   G+  +G ST +Q+G + R+     + A V
Sbjct  477  ---GDSNHSVQGSSHNGGSTNIQLGSMFRRGPAPENNAFV  513



>ref|XP_004510198.1| PREDICTED: MLO-like protein 1-like [Cicer arietinum]
Length=513

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 162/225 (72%), Positives = 185/225 (82%), Gaps = 2/225 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWV+VV+FLLLNINGWHTYFWIAFIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  291  VVGISWYLWVYVVLFLLLNINGWHTYFWIAFIPLILLLAVGTKLEHVIIQLAHEVAEKHT  350

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+GELVVQPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV YGFDSCIMG +++
Sbjct  351  AIQGELVVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTYGFDSCIMGRIRY  410

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV IQ+LCSYSTLP+YA+VTQMGTHFK  IFDE +Q  LVGWAQKAK +KGL+
Sbjct  411  IIPRLIIGVFIQLLCSYSTLPLYALVTQMGTHFKSVIFDEQVQARLVGWAQKAK-KKGLR  469

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
                  N   A   GSS  +Q+G + R+ S   +   V   ++ G
Sbjct  470  GDNNQSNQESA-HHGSSVNIQLGSIFRRGSVPENNTIVSRDEESG  513



>dbj|BAH20436.1| AT4G02600 [Arabidopsis thaliana]
Length=400

 Score =   327 bits (838),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 185/231 (80%), Gaps = 16/231 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  162  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHV  221

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  222  AIEGDLVVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  281

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK
Sbjct  282  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLK  341

Query  222  AAFGGINHGGALTDGSST----------------GVQMGGVGRKESGSTDG  118
            AA    + G +                       G+Q+  V R  +G T+ 
Sbjct  342  AAASNGDEGSSQAGPGPDSGSGSAPAAGPGAGFAGIQLSRVTRNNAGDTNN  392



>ref|XP_007199791.1| hypothetical protein PRUPE_ppa004508mg [Prunus persica]
 gb|EMJ00990.1| hypothetical protein PRUPE_ppa004508mg [Prunus persica]
Length=506

 Score =   330 bits (847),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 161/215 (75%), Positives = 185/215 (86%), Gaps = 14/215 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLL+NINGWHTYFWIAF PF+LLLAVGTKLEH+I QLAHEVAEKHV
Sbjct  276  VVGISWYLWVFVVIFLLMNINGWHTYFWIAFAPFVLLLAVGTKLEHIITQLAHEVAEKHV  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWFG+P+IVLFLIHFILFQNAFEIAFFFWI +QYGFDSCIMG V++
Sbjct  336  AIEGDLVVQPSDDHFWFGKPKIVLFLIHFILFQNAFEIAFFFWIWLQYGFDSCIMGQVRY  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIV QMGT+FK +IF+EH+QVGLVGWAQK K++K L+
Sbjct  396  IVPRLIIGVFIQVLCSYSTLPLYAIVAQMGTNFKAAIFNEHVQVGLVGWAQKVKKKKALE  455

Query  222  AAFG------------GINHGGALTDGSSTGVQMG  154
            AA                +HGG L   S+ G+Q+G
Sbjct  456  AANDASGSGSGSGQGQASSHGGGL--ASNMGIQLG  488



>ref|XP_003547751.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHM99994.1| MLO-like protein 1 [Glycine soja]
Length=515

 Score =   330 bits (847),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 163/230 (71%), Positives = 185/230 (80%), Gaps = 9/230 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+LLN++GWH YFWI+FIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  295  VVGISWYLWIFVVIFMLLNVHGWHAYFWISFIPLILLLAVGTKLEHVIIQLAHEVAEKHS  354

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQP D+HFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  355  AIEGELVVQPRDDHFWFNRPHIVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGRVRY  414

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQ+LCSYSTLP+YAIVTQMGTHFKK+IFDE +Q  LVGWAQKAK+    K
Sbjct  415  IVPRLIIGVFIQLLCSYSTLPLYAIVTQMGTHFKKAIFDEQVQARLVGWAQKAKK----K  470

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
               G  +  G  +  +  G+Q+G V R+ES S D   V        DGS+
Sbjct  471  GQRGDNSLSGQESSRAGAGIQLGSVFRRESASEDNVIVPR-----NDGSE  515



>ref|XP_010422570.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=530

 Score =   330 bits (847),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 162/215 (75%), Positives = 182/215 (85%), Gaps = 3/215 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  288  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHV  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  348  AIEGDLVVKPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK
Sbjct  408  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRELK  467

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDG  118
            A+ G      A  D  S      G G   SG   G
Sbjct  468  ASNGTEGGSQAGPDSGSGSAPAPGAG---SGPAPG  499



>gb|AAU10790.1| putative seven transmembrane MLO family protein [Oryza sativa 
Japonica Group]
 gb|AAV25638.1| putative MLO family protein [Oryza sativa Japonica Group]
 dbj|BAH00439.1| unnamed protein product [Oryza sativa Japonica Group]
Length=287

 Score =   322 bits (825),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 180/226 (80%), Gaps = 7/226 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ 
Sbjct  62   VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNS  121

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V F
Sbjct  122  AIEGDLVVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFSSCIMGQVSF  181

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK
Sbjct  182  IVPRLVIGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLK  241

Query  222  AAFGGI-------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
                G        N GG  T G S  ++M     +E     G S+ 
Sbjct  242  EGSAGAGVAAEPSNGGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  287



>ref|NP_001268003.1| MLO5 protein [Vitis vinifera]
 gb|ACF25909.1| MLO-like protein 1 [Vitis vinifera]
 emb|CBI25680.3| unnamed protein product [Vitis vinifera]
Length=482

 Score =   327 bits (839),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 179/214 (84%), Gaps = 12/214 (6%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN++GWHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH 
Sbjct  270  VVGISWYLWIFVVVFLLLNVDGWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHA  329

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RP+IVLFLIH ILFQN+FE+AFFFWIL  YGFDSCIMG V++
Sbjct  330  AIEGELVVQPSDDHFWFHRPRIVLFLIHIILFQNSFEMAFFFWILFTYGFDSCIMGKVQY  389

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGVIIQVLCSYSTLP+YAIVTQMGTHFKK+IFDEH+Q GLVGWAQKA++    K
Sbjct  390  IIPRLVIGVIIQVLCSYSTLPLYAIVTQMGTHFKKAIFDEHVQAGLVGWAQKARK----K  445

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
               G  N G          +Q+G V R E+   +
Sbjct  446  TTTGNANRGPT--------IQLGRVVRSENAKEE  471



>emb|CDY22065.1| BnaA09g00940D [Brassica napus]
Length=467

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  225  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  284

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQ+VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  285  AIEGDLVVKPSDEHFWFSKPQVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  344

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YA+V+QMG++FKK+IF+E++QVGLVGWAQK K ++ LK
Sbjct  345  IVPRLVIGVFIQVLCSYSTLPLYALVSQMGSNFKKAIFEENVQVGLVGWAQKVKNKRELK  404

Query  222  AAFGGIN  202
            AA    N
Sbjct  405  AAAAASN  411



>ref|NP_192169.1| MLO-like protein 1 [Arabidopsis thaliana]
 ref|NP_001031578.1| MLO-like protein 1 [Arabidopsis thaliana]
 sp|O49621.1|MLO1_ARATH RecName: Full=MLO-like protein 1; Short=AtMlo1; AltName: Full=MLO 
protein homolog 1; Short=AtMlo-H1 [Arabidopsis thaliana]
 emb|CAB08605.1| AtMlo-h1 [Arabidopsis thaliana]
 gb|AAC78258.1| AtMlo-h1 [Arabidopsis thaliana]
 emb|CAB80753.1| AtMlo-h1-like protein [Arabidopsis thaliana]
 gb|AAL59957.1| putative AtMlo-h1 protein [Arabidopsis thaliana]
 gb|AAM45040.1| putative AtMlo-h1 protein [Arabidopsis thaliana]
 gb|AEE82202.1| MLO-like protein 1 [Arabidopsis thaliana]
 gb|AEE82203.1| MLO-like protein 1 [Arabidopsis thaliana]
Length=526

 Score =   328 bits (841),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  288  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVIAQLAHEVAEKHV  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  348  AIEGDLVVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK
Sbjct  408  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLK  467

Query  222  AAFGGINHGGA  190
            AA    + G +
Sbjct  468  AAASNGDEGSS  478



>ref|XP_007134284.1| hypothetical protein PHAVU_010G034400g [Phaseolus vulgaris]
 gb|ESW06278.1| hypothetical protein PHAVU_010G034400g [Phaseolus vulgaris]
Length=507

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 183/214 (86%), Gaps = 3/214 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+LLN++GWHTYFWI+FIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  293  VVGISWYLWIFVVIFMLLNVHGWHTYFWISFIPLILLLAVGTKLEHVIIQLAHEVAEKHS  352

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQP D+HFWF RP IVLFLIHFILFQNAFEIAFFFWIL  YGFDSCIMG V++
Sbjct  353  AIEGELVVQPRDDHFWFHRPHIVLFLIHFILFQNAFEIAFFFWILFTYGFDSCIMGRVRY  412

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIG+ IQVLCSYSTLP+YAIVTQMGTHFKK+IFD+ +Q  LVGWAQKAK +KGL+
Sbjct  413  IVPRLVIGIFIQVLCSYSTLPLYAIVTQMGTHFKKAIFDDQVQARLVGWAQKAK-KKGLR  471

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
                G +  G+   G+  G+Q+G V RK S   D
Sbjct  472  GDNNGQSVQGSPHVGA--GIQLGPVFRKPSPPED  503



>ref|NP_001174425.1| Os05g0418100 [Oryza sativa Japonica Group]
 dbj|BAH93153.1| Os05g0418100, partial [Oryza sativa Japonica Group]
Length=325

 Score =   321 bits (823),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 180/226 (80%), Gaps = 7/226 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ 
Sbjct  100  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNS  159

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V F
Sbjct  160  AIEGDLVVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFSSCIMGQVSF  219

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK
Sbjct  220  IVPRLVIGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLK  279

Query  222  AAFGGI-------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
                G        N GG  T G S  ++M     +E     G S+ 
Sbjct  280  EGSAGAGVAAEPSNGGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  325



>ref|XP_009144550.1| PREDICTED: MLO-like protein 1 [Brassica rapa]
Length=516

 Score =   327 bits (839),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 157/217 (72%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  287  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHV  346

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV+PSDEHFWF +P+ VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  347  AIEGELVVKPSDEHFWFSKPEFVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  406

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+++KK+IF+E++QVGLVGWAQK K ++   
Sbjct  407  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSNYKKAIFEENVQVGLVGWAQKVKNKRASN  466

Query  222  AAFGGINHGGALTDGSS----TGVQMGGVGRKESGST  124
               G  N G   +   +     G+Q+  + R  +G T
Sbjct  467  GNEGSSNAGTTPSPPGAGAGFAGIQLSRLTRNNAGET  503



>tpg|DAA56449.1| TPA: seven transmembrane protein Mlo5 [Zea mays]
Length=475

 Score =   325 bits (834),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 179/223 (80%), Gaps = 3/223 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH 
Sbjct  241  VVGISWYLWIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHS  300

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV F
Sbjct  301  AVEGDLVVNPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPF  360

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLV+G IIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q  L+GWAQKAK+RK L+
Sbjct  361  IVPRLVVGAIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALR  420

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK---ESGSTDGASVRA  103
                G N   A +   S   ++  + R    E GS  G    A
Sbjct  421  NNGNGSNGAAAGSSHPSATARLELMRRAVALEEGSAGGNGSEA  463



>gb|ABK96389.1| unknown [Populus trichocarpa x Populus deltoides]
Length=527

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/224 (72%), Positives = 183/224 (82%), Gaps = 6/224 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHV
Sbjct  289  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHV  348

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+
Sbjct  349  AIEGELVVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKY  408

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K
Sbjct  409  IVPRLIIGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQK  468

Query  222  AAFGGINH------GGALTDGSSTGVQMGGVGRKESGSTDGASV  109
             +  G +        G L  G   G++    G  +S S +G+++
Sbjct  469  GSTEGSSEASSHVSAGGLQLGRLKGLKEANEGSAQSSSHEGSTL  512



>ref|XP_010679042.1| PREDICTED: MLO-like protein 1 [Beta vulgaris subsp. vulgaris]
Length=497

 Score =   326 bits (835),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 187/213 (88%), Gaps = 0/213 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFV+IFLLLN++GWHTYFWIAFIPFILLLAVGTKLEH+I +LAHEVAEKHV
Sbjct  276  VVGISWYLWVFVIIFLLLNVDGWHTYFWIAFIPFILLLAVGTKLEHIITELAHEVAEKHV  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF RPQI LFLIHFILFQNAFEIA+FFWI VQYGF SCIMG V++
Sbjct  336  AIEGDLVVKPSDEHFWFSRPQITLFLIHFILFQNAFEIAYFFWIWVQYGFSSCIMGQVRY  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGVIIQVLCSYSTLP+YAIVTQMG++FKK+IFDEH+Q G++GW  K K++K LK
Sbjct  396  IVPRLIIGVIIQVLCSYSTLPLYAIVTQMGSNFKKAIFDEHVQAGILGWRDKVKKKKALK  455

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGST  124
             A  G    G  T+G +T +QM  + +KE+G+ 
Sbjct  456  DAVNGSTASGTSTEGPTTRIQMARLIQKENGNA  488



>tpg|DAA56448.1| TPA: seven transmembrane protein Mlo5 [Zea mays]
Length=449

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 179/223 (80%), Gaps = 3/223 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH 
Sbjct  215  VVGISWYLWIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHS  274

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV F
Sbjct  275  AVEGDLVVNPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPF  334

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLV+G IIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q  L+GWAQKAK+RK L+
Sbjct  335  IVPRLVVGAIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALR  394

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK---ESGSTDGASVRA  103
                G N   A +   S   ++  + R    E GS  G    A
Sbjct  395  NNGNGSNGAAAGSSHPSATARLELMRRAVALEEGSAGGNGSEA  437



>emb|CDY21899.1| BnaC09g00050D [Brassica napus]
Length=529

 Score =   327 bits (837),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  287  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  346

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQ+VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  347  AIEGDLVVKPSDEHFWFSKPQVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  406

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YA+V+QMG++FKK+IF+E++QVGLVGWAQK K ++ LK
Sbjct  407  IVPRLVIGVFIQVLCSYSTLPLYALVSQMGSNFKKAIFEENVQVGLVGWAQKVKNKRELK  466

Query  222  AAFGGIN  202
            AA    N
Sbjct  467  AAAAASN  473



>ref|XP_004500713.1| PREDICTED: MLO-like protein 1-like isoform X1 [Cicer arietinum]
Length=533

 Score =   327 bits (838),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 164/214 (77%), Positives = 188/214 (88%), Gaps = 5/214 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAF+P ILLLAVGTKL HVI QLAHEVAEKH 
Sbjct  282  VVGISWYLWLFVVIFLLLNINGWHTYFWIAFVPLILLLAVGTKLGHVITQLAHEVAEKHA  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSDEHFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMGH+++
Sbjct  342  AIEGDLVVQPSDEHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGHIRY  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YA+VTQMGTHFK+ IF+EH+Q GLVGWAQK K++K +K
Sbjct  402  IVPRLVIGVFIQVLCSYSTLPLYALVTQMGTHFKRVIFNEHVQDGLVGWAQKVKKKKVVK  461

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
            A   G +H     +GSSTGVQ+G V +K + + +
Sbjct  462  ADGQGSSH-----EGSSTGVQLGSVFQKRASAHE  490



>ref|XP_010456010.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=532

 Score =   327 bits (837),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 177/191 (93%), Gaps = 2/191 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  288  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHV  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  348  AIEGDLVVKPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK
Sbjct  408  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRELK  467

Query  222  AAFGGINHGGA  190
            A+ G    GG+
Sbjct  468  ASNG--TEGGS  476



>emb|CDX91294.1| BnaC02g27050D [Brassica napus]
Length=506

 Score =   326 bits (835),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  277  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +P+ VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  337  AIEGDLVVKPSDEHFWFSKPEFVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+++KK+IF+E++QVGLVGWAQK K ++   
Sbjct  397  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSNYKKAIFEENVQVGLVGWAQKVKNKRASN  456

Query  222  AAFGGINHGGALTDGSS----TGVQMGGVGRKESGST  124
               G  N G   +   +     G+Q+  + R  +G T
Sbjct  457  GNEGSSNAGTTPSPPGAGAGFAGIQLSRLTRNNAGET  493



>ref|XP_004290766.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=514

 Score =   326 bits (835),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/236 (69%), Positives = 194/236 (82%), Gaps = 15/236 (6%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFW+AF+PF LL+AVGTKLEHVI QLAHEVAEKH+
Sbjct  278  VVGISWYLWVFVVIFLLLNVNGWHTYFWVAFLPFFLLVAVGTKLEHVITQLAHEVAEKHI  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSD HFWFG+P++VLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V+F
Sbjct  338  AIEGDLVVTPSDGHFWFGKPKLVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRF  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAI+TQMG+ FKK+IFDEH+QVGLVGWAQK K++K   
Sbjct  398  IVPRLVIGVFIQVLCSYSTLPLYAIITQMGSSFKKAIFDEHVQVGLVGWAQKVKKKKAAA  457

Query  222  AAFGGI-------------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
            AA                 +HGG+++  S+ G+QMG +G+K +   +  S +  Q+
Sbjct  458  AADASGSGSGSGSGSVQPSSHGGSIS--SAFGIQMGKLGKKTTKPEENNSDQKKQE  511



>ref|XP_009111270.1| PREDICTED: MLO-like protein 1 [Brassica rapa]
Length=529

 Score =   326 bits (836),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 174/187 (93%), Gaps = 0/187 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  287  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  346

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQ+VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  347  AIEGDLVVKPSDEHFWFSKPQVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  406

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YA+V+QMG++FKK+IF+E++QVGLVGWAQK K ++ LK
Sbjct  407  IVPRLVIGVFIQVLCSYSTLPLYALVSQMGSNFKKAIFEENVQVGLVGWAQKVKNKRELK  466

Query  222  AAFGGIN  202
            AA    N
Sbjct  467  AAAAASN  473



>gb|KHG28287.1| MLO-like protein 1 [Gossypium arboreum]
Length=503

 Score =   325 bits (834),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = -2

Query  747  WYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGE  568
            WYLWVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGE
Sbjct  288  WYLWVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGE  347

Query  567  LVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRL  388
            LVVQPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRL
Sbjct  348  LVVQPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRL  407

Query  387  VIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGG  208
            VIGV IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G 
Sbjct  408  VIGVFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGS  467

Query  207  INHGGALTDGSSTGVQMGGVGRKESGSTD  121
                 +     S  +QMG V R  S   +
Sbjct  468  AAQENS-EQNPSVAIQMGRVLRNASAPEE  495



>gb|ABK95021.1| unknown [Populus trichocarpa]
Length=265

 Score =   317 bits (812),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 169/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHV
Sbjct  27   VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHV  86

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+
Sbjct  87   AIEGELVVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKY  146

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K
Sbjct  147  IVPRLIIGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQK  206

Query  222  AAFGGINHGGA  190
             +  G +   +
Sbjct  207  GSTEGSSEASS  217



>ref|XP_008674721.1| PREDICTED: MLO-like protein 1 [Zea mays]
 gb|ACF84059.1| unknown [Zea mays]
 tpg|DAA56450.1| TPA: seven transmembrane protein Mlo5 [Zea mays]
Length=514

 Score =   325 bits (833),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 156/223 (70%), Positives = 179/223 (80%), Gaps = 3/223 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH 
Sbjct  280  VVGISWYLWIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHS  339

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV F
Sbjct  340  AVEGDLVVNPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPF  399

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLV+G IIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q  L+GWAQKAK+RK L+
Sbjct  400  IVPRLVVGAIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLLGWAQKAKKRKALR  459

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK---ESGSTDGASVRA  103
                G N   A +   S   ++  + R    E GS  G    A
Sbjct  460  NNGNGSNGAAAGSSHPSATARLELMRRAVALEEGSAGGNGSEA  502



>gb|KHG28286.1| MLO-like protein 1 [Gossypium arboreum]
Length=516

 Score =   325 bits (832),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = -2

Query  747  WYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGE  568
            WYLWVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGE
Sbjct  301  WYLWVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGE  360

Query  567  LVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRL  388
            LVVQPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRL
Sbjct  361  LVVQPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRL  420

Query  387  VIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGG  208
            VIGV IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G 
Sbjct  421  VIGVFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGS  480

Query  207  INHGGALTDGSSTGVQMGGVGRKESGSTD  121
                 +     S  +QMG V R  S   +
Sbjct  481  AAQENS-EQNPSVAIQMGRVLRNASAPEE  508



>ref|XP_006287341.1| hypothetical protein CARUB_v10000540mg, partial [Capsella rubella]
 gb|EOA20239.1| hypothetical protein CARUB_v10000540mg, partial [Capsella rubella]
Length=590

 Score =   327 bits (837),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  348  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  407

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQIVL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  408  AIEGDLVVKPSDEHFWFSKPQIVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  467

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++ LK
Sbjct  468  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRDLK  527

Query  222  AAFGGINHGGA  190
             A    + G +
Sbjct  528  TAASNGSEGDS  538



>gb|KHG28285.1| MLO-like protein 1 [Gossypium arboreum]
Length=537

 Score =   325 bits (832),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = -2

Query  747  WYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGE  568
            WYLWVFVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGE
Sbjct  322  WYLWVFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGE  381

Query  567  LVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRL  388
            LVVQPSD+HFWF +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRL
Sbjct  382  LVVQPSDDHFWFNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRL  441

Query  387  VIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGG  208
            VIGV IQVLCSYSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G 
Sbjct  442  VIGVFIQVLCSYSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGS  501

Query  207  INHGGALTDGSSTGVQMGGVGRKESGSTD  121
                 +     S  +QMG V R  S   +
Sbjct  502  AAQENS-EQNPSVAIQMGRVLRNASAPEE  529



>ref|XP_010429895.1| PREDICTED: MLO-like protein 1 [Camelina sativa]
Length=533

 Score =   324 bits (830),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/189 (81%), Positives = 172/189 (91%), Gaps = 0/189 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  288  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHV  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  348  AIEGDLVVKPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG+ FKK+IF+E++QVGLVGWAQK KQ++   
Sbjct  408  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSSFKKAIFEENVQVGLVGWAQKVKQKRASN  467

Query  222  AAFGGINHG  196
               GG   G
Sbjct  468  GTEGGSQAG  476



>gb|KEH18066.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=520

 Score =   323 bits (829),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 187/225 (83%), Gaps = 6/225 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+LLNINGWHTYFW+AFIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  298  VVGISWYLWIFVVIFMLLNINGWHTYFWVAFIPVILLLAVGTKLEHVIIQLAHEVAEKHS  357

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+LVVQPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV +GF+SC+MG + +
Sbjct  358  AIQGKLVVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTFGFNSCMMGKLHY  417

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             IPRLVIG++IQV+CSYSTLP+YAIVTQMGT++KK+IFDE IQ  L+GWAQKAK +KGL+
Sbjct  418  TIPRLVIGLLIQVICSYSTLPLYAIVTQMGTYYKKAIFDEQIQTCLLGWAQKAK-KKGLR  476

Query  222  AAFGGINHG--GALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
               G  N    G+   G+S+ +Q+G V R+     D   V   QQ
Sbjct  477  ---GNNNQSGEGSTHSGASSNIQLGSVFRRAPAPEDNTIVPKDQQ  518



>ref|XP_011011038.1| PREDICTED: MLO-like protein 1 isoform X2 [Populus euphratica]
Length=502

 Score =   323 bits (827),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 183/229 (80%), Gaps = 7/229 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIP  LLLAVGTKLEHVI QLA+EVAEKHV
Sbjct  264  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPLFLLLAVGTKLEHVITQLAYEVAEKHV  323

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+
Sbjct  324  AIEGELVVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKY  383

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K
Sbjct  384  IVPRLIIGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQK  443

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGS  76
             +  G       +  +S+ V  GG+  ++      A+  + Q    +GS
Sbjct  444  GSTEG-------SSEASSHVSAGGLQLEKLKRLKEANEGSAQSSSHEGS  485



>ref|XP_010907544.1| PREDICTED: LOW QUALITY PROTEIN: MLO-like protein 1 [Elaeis guineensis]
Length=497

 Score =   322 bits (826),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 182/221 (82%), Gaps = 6/221 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAF+P +LLLAVGTKLEHVI QLAHEVAEKH 
Sbjct  277  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFVPLLLLLAVGTKLEHVITQLAHEVAEKHS  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+L+VQPSD+HFWF RP+IVL+LIHFILF NAFEIAFFFWIL  YGFDSCIM H  F
Sbjct  337  AIQGDLIVQPSDDHFWFHRPRIVLYLIHFILFXNAFEIAFFFWILTTYGFDSCIMDHAGF  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL IGVIIQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWA+K K+RKG K
Sbjct  397  IIPRLAIGVIIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWARKVKRRKGTK  456

Query  222  AAFG--GINHGGALTDGSSTGVQMGG-VGRKESGSTDGASV  109
               G  G +H  A        ++M   VG+KE G +  A+ 
Sbjct  457  MDNGVAGSSHSSA---APYVKIEMQKLVGQKEEGKSGDANT  494



>gb|EEE63750.1| hypothetical protein OsJ_18569 [Oryza sativa Japonica Group]
Length=499

 Score =   322 bits (826),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 180/226 (80%), Gaps = 7/226 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ 
Sbjct  274  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNS  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V F
Sbjct  334  AIEGDLVVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFSSCIMGQVSF  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK
Sbjct  394  IVPRLVIGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLK  453

Query  222  AAFGGI-------NHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
                G        N GG  T G S  ++M     +E     G S+ 
Sbjct  454  EGSAGAGVAAEPSNGGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  499



>ref|NP_001105171.1| barley mlo defense gene homolog8 [Zea mays]
 gb|AAK38344.1| seven transmembrane protein Mlo8 [Zea mays]
 gb|ACF88127.1| unknown [Zea mays]
 gb|ACG43194.1| MLO-like protein 1 [Zea mays]
 gb|ACL54646.1| unknown [Zea mays]
 gb|AFW78033.1| MLO-like protein 1Seven transmembrane protein Mlo8 [Zea mays]
Length=492

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 181/225 (80%), Gaps = 6/225 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P ILLLA+GTKLEHVI QLAH+VAEKH 
Sbjct  274  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAIGTKLEHVIAQLAHDVAEKHT  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+++V+PSDEHFWFG+P+++L+LIHFILFQNAFEIAFFFWIL  YGFDSCIMG V+F
Sbjct  334  AVEGDVIVKPSDEHFWFGKPRVILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRF  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV+IQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQK K +KGLK
Sbjct  394  IVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMKKGLK  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
             A        A  D S T     G   K   +  G  V  +   G
Sbjct  454  GA------ASASKDESITNADSAGPSVKIEMAKAGEDVEIVGNTG  492



>ref|XP_003636206.1| MLO-like protein [Medicago truncatula]
Length=501

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 187/225 (83%), Gaps = 6/225 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+LLNINGWHTYFW+AFIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  279  VVGISWYLWIFVVIFMLLNINGWHTYFWVAFIPVILLLAVGTKLEHVIIQLAHEVAEKHS  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+LVVQPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV +GF+SC+MG + +
Sbjct  339  AIQGKLVVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTFGFNSCMMGKLHY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             IPRLVIG++IQV+CSYSTLP+YAIVTQMGT++KK+IFDE IQ  L+GWAQKAK +KGL+
Sbjct  399  TIPRLVIGLLIQVICSYSTLPLYAIVTQMGTYYKKAIFDEQIQTCLLGWAQKAK-KKGLR  457

Query  222  AAFGGINHG--GALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
               G  N    G+   G+S+ +Q+G V R+     D   V   QQ
Sbjct  458  ---GNNNQSGEGSTHSGASSNIQLGSVFRRAPAPEDNTIVPKDQQ  499



>ref|XP_008232215.1| PREDICTED: MLO-like protein 1 [Prunus mume]
 ref|XP_008232216.1| PREDICTED: MLO-like protein 1 [Prunus mume]
 ref|XP_008232217.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=488

 Score =   321 bits (823),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 182/210 (87%), Gaps = 7/210 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+L+N++GWH YFWIAF+PF LLLAVG KL+HVI QLAHEVAEKH+
Sbjct  283  VVGISWYLWIFVVLFMLMNVDGWHAYFWIAFVPFFLLLAVGAKLQHVITQLAHEVAEKHI  342

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGEL+VQPSDEHFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG VK+
Sbjct  343  AIEGELIVQPSDEHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVKY  402

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPR+VIGV IQVLCSYSTLP+YAIVTQMGT+FKK+IFDE I++GLVGWA+KAK+R   K
Sbjct  403  IIPRIVIGVFIQVLCSYSTLPLYAIVTQMGTNFKKAIFDEDIRLGLVGWAKKAKRR---K  459

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKES  133
            A+  G   G     GS  GVQ+G V +K +
Sbjct  460  ASMDGSGSG----TGSDVGVQLGKVNQKTT  485



>ref|XP_011011036.1| PREDICTED: MLO-like protein 1 isoform X1 [Populus euphratica]
 ref|XP_011011037.1| PREDICTED: MLO-like protein 1 isoform X1 [Populus euphratica]
Length=527

 Score =   322 bits (826),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/229 (70%), Positives = 183/229 (80%), Gaps = 7/229 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIP  LLLAVGTKLEHVI QLA+EVAEKHV
Sbjct  289  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPLFLLLAVGTKLEHVITQLAYEVAEKHV  348

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+
Sbjct  349  AIEGELVVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKY  408

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K
Sbjct  409  IVPRLIIGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQK  468

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGS  76
             +  G       +  +S+ V  GG+  ++      A+  + Q    +GS
Sbjct  469  GSTEG-------SSEASSHVSAGGLQLEKLKRLKEANEGSAQSSSHEGS  510



>ref|XP_006396473.1| hypothetical protein EUTSA_v10028582mg [Eutrema salsugineum]
 dbj|BAJ33805.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ37926.1| hypothetical protein EUTSA_v10028582mg [Eutrema salsugineum]
Length=516

 Score =   322 bits (824),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 152/187 (81%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAFIPFILL+AVG KLEHVI QLAHEVAEKHV
Sbjct  285  VVGISWYLWIFVVIFLLLNINGWHTYFWIAFIPFILLIAVGAKLEHVISQLAHEVAEKHV  344

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV+PSDEHFWF +PQ+VL+LIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  345  AIEGELVVKPSDEHFWFSKPQVVLYLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  404

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YAIV+QMG++FKK+IF++++QVGLVGWAQK K ++ LK
Sbjct  405  IVPRLVIGVFIQVLCSYSTLPLYAIVSQMGSNFKKAIFEKNVQVGLVGWAQKVKNKRDLK  464

Query  222  AAFGGIN  202
             A    N
Sbjct  465  TAASNGN  471



>gb|AIZ94062.1| Mlo protein [Hevea brasiliensis]
Length=516

 Score =   321 bits (823),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 166/218 (76%), Positives = 191/218 (88%), Gaps = 7/218 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAF+PF+LLLAVGTKLEHVI QLAH+VAEKHV
Sbjct  290  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFLPFLLLLAVGTKLEHVITQLAHDVAEKHV  349

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWF RP IVLFLIHFILFQNAFEIAFFFWI VQYGFDSCIMG V++
Sbjct  350  AIEGDLVVKPSDEHFWFNRPDIVLFLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVRY  409

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQ+LCSYSTLP+YAIVTQMG+ +KK+IFDEH+Q GLVGWA+K K++KGLK
Sbjct  410  IVPRLIIGVFIQILCSYSTLPLYAIVTQMGSSYKKAIFDEHVQAGLVGWAEKVKRKKGLK  469

Query  222  ----AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
                AA GG N   +  + SS G+Q+G VG   +GST 
Sbjct  470  GATAAARGGSNQPSS-HESSSLGIQLGRVGH--NGSTQ  504



>ref|XP_007217923.1| hypothetical protein PRUPE_ppa004866mg [Prunus persica]
 gb|EMJ19122.1| hypothetical protein PRUPE_ppa004866mg [Prunus persica]
Length=488

 Score =   320 bits (819),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 183/210 (87%), Gaps = 7/210 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+L+N++GWH YFWIAF+PF LLLAVG KL+HVI QLAHEVAEKH+
Sbjct  283  VVGISWYLWIFVVLFMLMNVDGWHAYFWIAFVPFFLLLAVGAKLQHVITQLAHEVAEKHI  342

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGEL+VQPSDEHFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG VK+
Sbjct  343  AVEGELIVQPSDEHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVKY  402

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPR+VIG+ IQVLCSYSTLP+YAIVTQMGT+FKK+IFDE +++GLVGWA+KAK+R   K
Sbjct  403  IIPRIVIGLFIQVLCSYSTLPLYAIVTQMGTNFKKAIFDEDVRLGLVGWAKKAKRR---K  459

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKES  133
            A+  G + G     GS  GVQ+G V +K +
Sbjct  460  ASMDGSSSG----IGSDVGVQLGKVNQKTT  485



>ref|XP_008812870.1| PREDICTED: MLO-like protein 1 isoform X3 [Phoenix dactylifera]
Length=329

 Score =   314 bits (805),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 179/219 (82%), Gaps = 2/219 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIP +LLLAVGTKLEHVI QLAHEVAEKH 
Sbjct  107  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPLLLLLAVGTKLEHVITQLAHEVAEKHS  166

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L+V+PSD+HFWF RP+++L+LIHFILFQNAFE AFFFWIL  YGF+SCIM H  F
Sbjct  167  AIEGDLIVKPSDDHFWFHRPRVILYLIHFILFQNAFEFAFFFWILTTYGFNSCIMDHAGF  226

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            II RLVIGVIIQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWAQK K+RKG K
Sbjct  227  IISRLVIGVIIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAQKVKRRKGTK  286

Query  222  AAFGGINHGGALTDGSSTGVQMGG-VGRKESGSTDGASV  109
               G      +  +     +QM   VG+KE G +  A  
Sbjct  287  MGNGSAGSSHSSAE-PYVKIQMQKLVGQKEEGKSGDADT  324



>ref|XP_003520359.1| PREDICTED: MLO-like protein 1-like [Glycine max]
 gb|KHN07795.1| MLO-like protein 1 [Glycine soja]
Length=517

 Score =   320 bits (819),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 178/218 (82%), Gaps = 4/218 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+LLN++GWH YFWI+FIP ILLLAVG KLEHVIIQLAHEVAEKH 
Sbjct  297  VVGISWYLWIFVVIFMLLNVHGWHAYFWISFIPLILLLAVGAKLEHVIIQLAHEVAEKHS  356

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQP D+HFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  357  AIEGELVVQPRDDHFWFNRPHIVLFLIHFILFQNAFEIAFFFWIWVIYGFDSCIMGRVRY  416

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IG+ IQ+LCSYSTLP+YAIVTQMGTHFKK++FDE +Q  LVGWAQKAK+    K
Sbjct  417  IVPRLIIGIFIQLLCSYSTLPLYAIVTQMGTHFKKAVFDEQVQARLVGWAQKAKK----K  472

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
               G  +H G  +     G+Q+G V ++ S   D   V
Sbjct  473  GQRGDNSHSGQGSSHVGAGIQLGSVFKRPSVPEDNVIV  510



>gb|EAY98072.1| hypothetical protein OsI_19990 [Oryza sativa Indica Group]
Length=488

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 179/219 (82%), Gaps = 4/219 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ 
Sbjct  274  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNS  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFW GRP+I+L+LIHFILFQNAFEIAFFFWIL  YGF SCIMG V F
Sbjct  334  AIEGDLVVKPSDDHFWLGRPRIILYLIHFILFQNAFEIAFFFWILTTYGFYSCIMGQVGF  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQ+LCSYST+P+YA+VTQMG+ +KK IF++H+Q G++GWAQK K RKGLK
Sbjct  394  IVPRLVIGVTIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLK  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVR  106
                  + GG  T G S  ++M     +E     G S+ 
Sbjct  454  EG----SAGGGDTAGPSVKIEMMRRAAREGNDEAGVSIE  488



>emb|CAN71629.1| hypothetical protein VITISV_015579 [Vitis vinifera]
Length=1031

 Score =   331 bits (849),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 179/214 (84%), Gaps = 12/214 (6%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN++GWHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH 
Sbjct  294  VVGISWYLWIFVVVFLLLNVDGWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHA  353

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RP+IVLFLIH ILFQN+FE+AFFFWIL  YGFDSCIMG V++
Sbjct  354  AIEGELVVQPSDDHFWFHRPRIVLFLIHIILFQNSFEMAFFFWILFTYGFDSCIMGKVQY  413

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGVIIQVLCSYSTLP+YAIVTQMGTHFKK+IFDEH+Q GLVGWAQKA++    K
Sbjct  414  IIPRLVIGVIIQVLCSYSTLPLYAIVTQMGTHFKKAIFDEHVQAGLVGWAQKARK----K  469

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
               G  N G          +Q+G V R E+   +
Sbjct  470  TTTGNANRGPT--------IQLGRVVRSENAKEE  495



>ref|XP_003568437.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=493

 Score =   317 bits (812),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 153/221 (69%), Positives = 180/221 (81%), Gaps = 7/221 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAFIP +LLLAVGTKLEHVI QLAH+VAEKH 
Sbjct  275  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFIPLLLLLAVGTKLEHVIAQLAHDVAEKHS  334

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L+V+PSD+HFWFGRP+I+LFLIHFILFQN+FEIAFFFWIL  YGF+SCIMG V F
Sbjct  335  AIEGDLIVKPSDDHFWFGRPRIILFLIHFILFQNSFEIAFFFWILTTYGFNSCIMGQVGF  394

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIG+IIQ+LCSYSTLP+YAIVTQMG+ +KK IF++H+Q G++GWAQK K RKGLK
Sbjct  395  IVPRLVIGLIIQLLCSYSTLPLYAIVTQMGSFYKKEIFNDHVQQGVLGWAQKVKMRKGLK  454

Query  222  AAFGGINHGGALT---DGSSTGVQMGGVGRKESGSTDGASV  109
                  N    LT   D +   V++  + R      D   +
Sbjct  455  EG----NATAGLTNTVDSAGPSVKIEMMKRAGREGNDAGEI  491



>ref|XP_003604071.1| MLO-like protein [Medicago truncatula]
 gb|AES74322.1| seven transmembrane MLO family protein [Medicago truncatula]
Length=517

 Score =   317 bits (812),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 189/222 (85%), Gaps = 4/222 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAF+P ILLL+VGTKLEHVI QLAHEVAEKH 
Sbjct  289  VVGISWYLWLFVVIFLLLNINGWHTYFWIAFVPVILLLSVGTKLEHVITQLAHEVAEKHA  348

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD HFWF RP IVLFLIHFILFQNAFEIAFFFWI V YGFDSCIMG V++
Sbjct  349  AIEGDLVVQPSDNHFWFHRPHIVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGQVRY  408

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQVLCSYSTLP+YA+VTQMG+HFK++IF++H+QVG+VGWA+K K++K LK
Sbjct  409  IVPRLVIGVFIQVLCSYSTLPLYAVVTQMGSHFKRAIFNDHVQVGIVGWAEKVKKKKALK  468

Query  222  A---AFGGINHGGALTDGSSTGVQMGGV-GRKESGSTDGASV  109
            A      G +H    + GSSTG+Q+G V  ++ S   D  SV
Sbjct  469  ADGQPSQGSSHIHEGSTGSSTGIQLGSVFQKRASAPEDTTSV  510



>ref|XP_003636497.1| MLO-like protein [Medicago truncatula]
Length=729

 Score =   322 bits (825),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 158/225 (70%), Positives = 187/225 (83%), Gaps = 6/225 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+LLNINGWHTYFW+AFIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  279  VVGISWYLWIFVVIFMLLNINGWHTYFWVAFIPVILLLAVGTKLEHVIIQLAHEVAEKHS  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+LVVQPSD+HFWF RP+IVLFLIH ILFQN+FEIAFFFWILV +GF+SC+MG + +
Sbjct  339  AIQGKLVVQPSDDHFWFHRPRIVLFLIHLILFQNSFEIAFFFWILVTFGFNSCMMGKLHY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             IPRLVIG++IQV+CSYSTLP+YAIVTQMGT++KK+IFDE IQ  L+GWAQKAK +KGL+
Sbjct  399  TIPRLVIGLLIQVICSYSTLPLYAIVTQMGTYYKKAIFDEQIQTCLLGWAQKAK-KKGLR  457

Query  222  AAFGGINHG--GALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
               G  N    G+   G+S+ +Q+G V R+     D   V   QQ
Sbjct  458  ---GNNNQSGEGSTHSGASSNIQLGSVFRRAPAPEDNTIVPKDQQ  499



>ref|XP_004970844.1| PREDICTED: MLO-like protein 1-like isoform X1 [Setaria italica]
Length=501

 Score =   315 bits (808),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 147/180 (82%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLN+NGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH 
Sbjct  280  VVGISWYLWIFVVVFMLLNVNGWHTYFWISFIPLLLLLAVGTKLEHVITQLAIEVAEKHS  339

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSDEHFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV F
Sbjct  340  AIEGDLVVNPSDEHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPF  399

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLV+G  IQ++CSYSTLP+YAIVTQMGT FKK IFDEH+Q  LVGWAQKAK+RK LK
Sbjct  400  IVPRLVVGATIQLVCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQSLVGWAQKAKKRKALK  459



>ref|XP_008812868.1| PREDICTED: MLO-like protein 1 isoform X1 [Phoenix dactylifera]
Length=502

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 156/219 (71%), Positives = 179/219 (82%), Gaps = 2/219 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIP +LLLAVGTKLEHVI QLAHEVAEKH 
Sbjct  280  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPLLLLLAVGTKLEHVITQLAHEVAEKHS  339

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L+V+PSD+HFWF RP+++L+LIHFILFQNAFE AFFFWIL  YGF+SCIM H  F
Sbjct  340  AIEGDLIVKPSDDHFWFHRPRVILYLIHFILFQNAFEFAFFFWILTTYGFNSCIMDHAGF  399

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            II RLVIGVIIQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWAQK K+RKG K
Sbjct  400  IISRLVIGVIIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAQKVKRRKGTK  459

Query  222  AAFGGINHGGALTDGSSTGVQMGG-VGRKESGSTDGASV  109
               G      +  +     +QM   VG+KE G +  A  
Sbjct  460  MGNGSAGSSHSSAE-PYVKIQMQKLVGQKEEGKSGDADT  497



>ref|XP_006858689.1| hypothetical protein AMTR_s00066p00091160 [Amborella trichopoda]
 gb|ERN20156.1| hypothetical protein AMTR_s00066p00091160 [Amborella trichopoda]
Length=510

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 179/230 (78%), Gaps = 12/230 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN++GWHTYFWIAFIP  LLLAVGTKLEH+I QLA EVAEKH 
Sbjct  284  VVGISWYLWIFVVLFLLLNVDGWHTYFWIAFIPLFLLLAVGTKLEHIITQLAQEVAEKHT  343

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFWF RP+IVL+LIHFILFQNAFEIAFFFWIL  +G+DSCIMG V++
Sbjct  344  AIEGDLVVRPSDDHFWFHRPRIVLYLIHFILFQNAFEIAFFFWILTTFGWDSCIMGQVRY  403

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGVIIQV+CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GL+GWAQK K RK +K
Sbjct  404  IIPRLIIGVIIQVVCSYSTLPLYAIVTQMGTTFKKAIFDEHVQQGLLGWAQKVKNRK-IK  462

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
             + G    G            + G       +    SV  +Q +  D  K
Sbjct  463  PSKGNSREGS-----------VAGAASCSRRAQANVSVEGIQLLKKDDKK  501



>emb|CDM85394.1| unnamed protein product [Triticum aestivum]
Length=483

 Score =   313 bits (802),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/194 (76%), Positives = 168/194 (87%), Gaps = 3/194 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WYLW+FVVIF+LLN+NGWHTYFWI+F+P ILLLAVGTKLEHVI QLA++VAEKH 
Sbjct  269  VVGIRWYLWIFVVIFMLLNVNGWHTYFWISFLPLILLLAVGTKLEHVIAQLAYDVAEKHS  328

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSDEHFW G+P+++L+LIHFILFQNAFEIA FFWIL  YGF+SCIM HV F
Sbjct  329  AIEGDLVVNPSDEHFWCGKPRVILYLIHFILFQNAFEIALFFWILTTYGFNSCIMDHVPF  388

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV+IQ+LCSYSTLP+YAIVTQMGT FKK IFDEHIQ GLVGWAQKA+ R  L 
Sbjct  389  IVPRLVIGVVIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHIQQGLVGWAQKARMRTELS  448

Query  222  ---AAFGGINHGGA  190
               AA G   HG +
Sbjct  449  KDAAAAGPTRHGPS  462



>ref|XP_009600156.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=493

 Score =   313 bits (803),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 161/212 (76%), Positives = 181/212 (85%), Gaps = 2/212 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHE+AEKHV
Sbjct  282  VVGISWYLWIFVILFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEIAEKHV  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGELVVQPSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F
Sbjct  342  AVEGELVVQPSDSHFWFDRPQIVLFLIHFILFQNAFEIAFFFWILFQYGFYSCIMGKYVF  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            + PRLVIGV IQVLCSYSTLP+YA+VTQMG+H+KKS+FD+H+Q  L+ WA+K K++K  K
Sbjct  402  VTPRLVIGVFIQVLCSYSTLPLYALVTQMGSHYKKSMFDDHVQACLIEWAEKVKKKKAQK  461

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGS  127
            AA  G NH  +  DG + G  M   G KES +
Sbjct  462  AARDGSNH--STDDGFTIGSPMSVHGSKESPN  491



>ref|XP_009399143.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=516

 Score =   314 bits (804),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIF+LLN+NGWHTYFWIAFIP ILLLA+GTKLEHVI QLA EVAEKH 
Sbjct  290  VVGISWYLWVFVVIFMLLNVNGWHTYFWIAFIPLILLLALGTKLEHVITQLAQEVAEKHT  349

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSD+HFWF RPQIVL+LIHFILFQNAFEIAFFFWI   YG++SCIM H  F
Sbjct  350  AIEGDLVVTPSDDHFWFHRPQIVLYLIHFILFQNAFEIAFFFWIFTTYGYNSCIMDHACF  409

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV IQ+LCSYSTLP+YAIVTQMG++FKK+IFDEH+Q GLVGWA+K K+RKG++
Sbjct  410  IVPRLVIGVTIQLLCSYSTLPLYAIVTQMGSYFKKAIFDEHVQEGLVGWAEKVKKRKGVR  469

Query  222  AAFG  211
               G
Sbjct  470  IGNG  473



>ref|XP_009376309.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=466

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLN++GWH YFWIAF+PF LLLAVGTKL+HVI QLAHEVAEKH+
Sbjct  284  VVGISWYLWIFVVLFMLLNVDGWHAYFWIAFVPFFLLLAVGTKLQHVITQLAHEVAEKHI  343

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGEL+VQPSD+HFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG V++
Sbjct  344  AIEGELIVQPSDKHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVRY  403

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            I+PRLVIGV IQVLCSYSTLP+YAI+TQMGT+FKK++FDE+I+ GLVGWAQKAK+RK 
Sbjct  404  IVPRLVIGVFIQVLCSYSTLPLYAIITQMGTNFKKAMFDENIRSGLVGWAQKAKRRKA  461



>ref|XP_008375689.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=417

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+L+N++GWH YFWIAFIPF LLLAVGTKL+HVI QLAHEVAEKH+
Sbjct  211  VVGISWYLWIFVVIFMLMNVDGWHAYFWIAFIPFFLLLAVGTKLQHVITQLAHEVAEKHI  270

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGEL+VQPSD+HFWFG+P+ VLFLIH ILFQNAFE+AFFFWI VQYGF SCIMG V++
Sbjct  271  AVEGELIVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRY  330

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMGT FKK+IFDE I+ GL+GWAQKAK+RK 
Sbjct  331  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKA  388



>ref|XP_009410722.1| PREDICTED: MLO-like protein 1 isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=502

 Score =   312 bits (800),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFV IFLLLN+NGWHTYFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH 
Sbjct  282  VVGISWYLWVFVFIFLLLNVNGWHTYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHS  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+LVV+PSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWIL  +GFDSCIM    F
Sbjct  342  AIQGDLVVKPSDDHFWFRRPRIVLNLIHFILFQNAFEIAFFFWILTTFGFDSCIMDQFSF  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV+IQ+LCSYSTLP+YAIVTQMG++FKK+IFDEH+Q GL+ WAQK K+RKG  
Sbjct  402  IVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSYFKKAIFDEHVQEGLMDWAQKVKRRKG--  459

Query  222  AAFGGINHGGALTDGSSTGVQMGG-VGRKESGSTDGAS  112
                G+       D  S  +++   V + ES   +G S
Sbjct  460  ---NGLVRSSQGQDEPSRKIELQKLVQQTESDLEEGRS  494



>ref|XP_009410721.1| PREDICTED: MLO-like protein 1 isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=504

 Score =   312 bits (799),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 177/218 (81%), Gaps = 6/218 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFV IFLLLN+NGWHTYFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH 
Sbjct  284  VVGISWYLWVFVFIFLLLNVNGWHTYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHS  343

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+LVV+PSD+HFWF RP+IVL LIHFILFQNAFEIAFFFWIL  +GFDSCIM    F
Sbjct  344  AIQGDLVVKPSDDHFWFRRPRIVLNLIHFILFQNAFEIAFFFWILTTFGFDSCIMDQFSF  403

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV+IQ+LCSYSTLP+YAIVTQMG++FKK+IFDEH+Q GL+ WAQK K+RKG  
Sbjct  404  IVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSYFKKAIFDEHVQEGLMDWAQKVKRRKG--  461

Query  222  AAFGGINHGGALTDGSSTGVQMGG-VGRKESGSTDGAS  112
                G+       D  S  +++   V + ES   +G S
Sbjct  462  ---NGLVRSSQGQDEPSRKIELQKLVQQTESDLEEGRS  496



>ref|XP_004500714.1| PREDICTED: MLO-like protein 1-like isoform X2 [Cicer arietinum]
Length=508

 Score =   311 bits (797),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/171 (86%), Positives = 161/171 (94%), Gaps = 0/171 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNINGWHTYFWIAF+P ILLLAVGTKL HVI QLAHEVAEKH 
Sbjct  282  VVGISWYLWLFVVIFLLLNINGWHTYFWIAFVPLILLLAVGTKLGHVITQLAHEVAEKHA  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSDEHFWF RP++VLFLIHFILFQNAFEIAFFFWI V YGFDSCIMGH+++
Sbjct  342  AIEGDLVVQPSDEHFWFHRPRVVLFLIHFILFQNAFEIAFFFWIWVTYGFDSCIMGHIRY  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
            I+PRLVIGV IQVLCSYSTLP+YA+VTQMGTHFK+ IF+EH+Q GLVGWAQ
Sbjct  402  IVPRLVIGVFIQVLCSYSTLPLYALVTQMGTHFKRVIFNEHVQDGLVGWAQ  452



>ref|XP_002319210.2| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
 gb|EEE95133.2| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
Length=388

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 176/224 (79%), Gaps = 9/224 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFV   LLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHV
Sbjct  153  VVGISWYLWVFV---LLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHV  209

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+
Sbjct  210  AIEGELVVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKY  269

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K
Sbjct  270  IVPRLIIGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQK  329

Query  222  AAFGGINHGGALTDGSSTGVQM------GGVGRKESGSTDGASV  109
             +  G +   +        +           G  +S S +G+++
Sbjct  330  GSTEGSSEASSHVSAGGLLLGRLKGLKEANEGSAQSSSHEGSTL  373



>ref|XP_006375950.1| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
 gb|ERP53747.1| hypothetical protein POPTR_0013s06680g [Populus trichocarpa]
Length=394

 Score =   306 bits (785),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 176/224 (79%), Gaps = 9/224 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFV   LLLNINGWHTYFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHV
Sbjct  159  VVGISWYLWVFV---LLLNINGWHTYFWIAFIPLILLLAVGTKLEHVINQLAYEVAEKHV  215

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD HFWF RP  V  LIHFILFQNAFEIAFFFWI VQYGFDSCIMG +K+
Sbjct  216  AIEGELVVQPSDNHFWFHRPGFVHLLIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQIKY  275

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL+IGV IQVLCSYSTLP+YAIV+QMG+ FKKSIF+EH+Q GLVGWAQK K+++G K
Sbjct  276  IVPRLIIGVFIQVLCSYSTLPLYAIVSQMGSTFKKSIFEEHVQAGLVGWAQKVKKKRGQK  335

Query  222  AAFGGINHGGALTDGSSTGVQM------GGVGRKESGSTDGASV  109
             +  G +   +        +           G  +S S +G+++
Sbjct  336  GSTEGSSEASSHVSAGGLLLGRLKGLKEANEGSAQSSSHEGSTL  379



>ref|XP_006655330.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=509

 Score =   310 bits (795),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P ILLLAVGTKLEHVI QLAH+VAEK+ 
Sbjct  281  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLILLLAVGTKLEHVIAQLAHDVAEKNS  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFW G+P+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIMG V F
Sbjct  341  AIEGDLVVKPSDDHFWLGKPRIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMGQVGF  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGVIIQ+LCSYST+P+YA+VTQMG+ +KK IF++HIQ G++GWAQK K RKGL+
Sbjct  401  IVPRLVIGVIIQLLCSYSTMPLYAVVTQMGSFYKKEIFNDHIQQGVLGWAQKVKMRKGLR  460



>ref|XP_008344996.1| PREDICTED: MLO-like protein 1 isoform X1 [Malus domestica]
 ref|XP_008345003.1| PREDICTED: MLO-like protein 1 isoform X1 [Malus domestica]
Length=466

 Score =   308 bits (790),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLN++GWH YFWIAF+PF LLLAVGTKL+HVI QLAHEVAEKH+
Sbjct  284  VVGISWYLWIFVVLFMLLNVDGWHAYFWIAFVPFFLLLAVGTKLQHVITQLAHEVAEKHI  343

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGEL+VQPSD+HFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG V +
Sbjct  344  AIEGELIVQPSDKHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVXY  403

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMGT+FKK++FDE+I+ GLVGWAQ AK+RK 
Sbjct  404  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTNFKKAMFDENIRSGLVGWAQXAKRRKA  461



>ref|XP_003636203.1| MLO-like protein [Medicago truncatula]
Length=484

 Score =   309 bits (791),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 179/218 (82%), Gaps = 13/218 (6%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIP ILLLAVGTKLEHVIIQLAHEVAEKH 
Sbjct  275  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPVILLLAVGTKLEHVIIQLAHEVAEKHS  334

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+GEL+VQPSD+HFWF RP+IVLFLIH ILFQN+FEI       +QYGF+SCIMG VKF
Sbjct  335  AIQGELIVQPSDDHFWFHRPRIVLFLIHLILFQNSFEI-------IQYGFNSCIMGQVKF  387

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I PRLV+GV IQVLCSYSTLP+YAIVTQMGTHFK+SIFD+ +Q  L+GWAQKAK +KGL+
Sbjct  388  IYPRLVMGVFIQVLCSYSTLPLYAIVTQMGTHFKRSIFDDQVQTRLIGWAQKAK-KKGLR  446

Query  222  AAFGGINHG--GALTDGSSTGVQMGGVGRKESGSTDGA  115
               G  NH   G+  +G ST +Q+G + R+     +  
Sbjct  447  ---GDSNHSVQGSSHNGGSTNIQLGSMFRRGPAPENKC  481



>ref|XP_009361360.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=489

 Score =   309 bits (791),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+L+N++GWH YFWIAFIPF LLLAVGTKL+HVI QLAHEVAEKH+
Sbjct  283  VVGISWYLWIFVVIFMLMNVDGWHAYFWIAFIPFFLLLAVGTKLQHVITQLAHEVAEKHI  342

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGEL+VQPSD+HFWFG+P+ VLFLIH ILFQNAFE+AFFFWI VQYGF SCIMG V++
Sbjct  343  AVEGELIVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRY  402

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMGT FKK+IFDE I+ GL+GWAQKAK+RK 
Sbjct  403  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKA  460



>ref|XP_010908317.1| PREDICTED: MLO-like protein 1 isoform X1 [Elaeis guineensis]
Length=498

 Score =   309 bits (791),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 179/212 (84%), Gaps = 5/212 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVG+SWYLW+FV+IF++LN+NGWHT+FWIAFIP ILLLA+GTKLEHVI QLA EVAEKH 
Sbjct  278  VVGLSWYLWIFVIIFMVLNVNGWHTFFWIAFIPLILLLALGTKLEHVITQLAREVAEKHS  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFWF RP++VL+L+HFILFQNAFEIAFFFWIL  +G DSC++ HV F
Sbjct  338  AIEGDLVVKPSDDHFWFHRPRLVLYLVHFILFQNAFEIAFFFWILTTFGLDSCMLDHVGF  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPRLVIGVIIQ+LCSYSTLP+YAIV+QMG+ FKK+IFDEH+Q GLV WA+K K+RKG K
Sbjct  398  VIPRLVIGVIIQLLCSYSTLPLYAIVSQMGSSFKKAIFDEHVQEGLVSWAEKVKRRKGAK  457

Query  222  AA--FGGINHGGALTDGSSTGVQMGGVGRKES  133
                  G++   A    SS  ++M G+ RK+ 
Sbjct  458  VGNELAGLSRRSA---ESSVKIEMQGLVRKKE  486



>ref|XP_008375669.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=489

 Score =   308 bits (790),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF+L+N++GWH YFWIAFIPF LLLAVGTKL+HVI QLAHEVAEKH+
Sbjct  283  VVGISWYLWIFVVIFMLMNVDGWHAYFWIAFIPFFLLLAVGTKLQHVITQLAHEVAEKHI  342

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGEL+VQPSD+HFWFG+P+ VLFLIH ILFQNAFE+AFFFWI VQYGF SCIMG V++
Sbjct  343  AVEGELIVQPSDKHFWFGKPKFVLFLIHLILFQNAFEMAFFFWIWVQYGFTSCIMGKVRY  402

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            I+PRLVIGV IQVLCSYSTLP+YAIVTQMGT FKK+IFDE I+ GL+GWAQKAK+RK 
Sbjct  403  IVPRLVIGVFIQVLCSYSTLPLYAIVTQMGTKFKKAIFDEGIRSGLIGWAQKAKKRKA  460



>ref|XP_008802152.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=230

 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 139/197 (71%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -2

Query  753  ISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIE  574
            + WYLW+FV++FLLL++NGWH YFWI+FIP ILLLA+GTKLEH+I QLAHEVAEKH AIE
Sbjct  1    MCWYLWIFVMVFLLLDVNGWHAYFWISFIPLILLLALGTKLEHIITQLAHEVAEKHSAIE  60

Query  573  GELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIP  394
            G+LVV PSD+ FWF RP+IVLFLIHFILFQNAFEIAFFFW+L  Y FDSCIMG   FIIP
Sbjct  61   GDLVVTPSDDLFWFHRPKIVLFLIHFILFQNAFEIAFFFWVLTTYNFDSCIMGQAGFIIP  120

Query  393  RLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAF  214
            RLVI V+IQ+LCSYSTLP+YAIVTQMG+ FKK+IFDE++Q GLVGWAQ+ K+RKG++   
Sbjct  121  RLVISVLIQILCSYSTLPLYAIVTQMGSSFKKAIFDENVQEGLVGWAQQVKKRKGMRVMN  180

Query  213  GGINHGGALTDGSSTGV  163
                    L  G+ T V
Sbjct  181  RESGSTSTLQSGNGTSV  197



>ref|XP_008788294.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=490

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/212 (71%), Positives = 178/212 (84%), Gaps = 6/212 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIF++LN+NGWHT+FW+AFIP ILLLA+GTKLEHVI QLA+EVAEKH 
Sbjct  282  VVGISWYLWIFVVIFMVLNVNGWHTFFWVAFIPLILLLALGTKLEHVIAQLANEVAEKHS  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD HFWF RP+IVL+LIHFILFQNAFEIAFFFWIL  YGF SCIM HV F
Sbjct  342  AIEGDLVVKPSDNHFWFHRPRIVLYLIHFILFQNAFEIAFFFWILTTYGFRSCIMDHVGF  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGVIIQ+LCSYSTLP+YAIV+QMG+ FKK+IFD+H++  LVGWA+K K+RK  K
Sbjct  402  IIPRLVIGVIIQLLCSYSTLPLYAIVSQMGSSFKKAIFDDHVREDLVGWAEKVKKRKVAK  461

Query  222  AAFGGINHGGALTDGSSTGVQM---GGVGRKE  136
               G   H G     + + V++   G VG+KE
Sbjct  462  MGNG---HAGLSRTPAESYVKIEMQGVVGQKE  490



>ref|XP_009794450.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana sylvestris]
Length=494

 Score =   305 bits (781),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 157/203 (77%), Positives = 174/203 (86%), Gaps = 2/203 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHE+AEKHV
Sbjct  282  VVGISWYLWIFVILFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEIAEKHV  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGELVVQPSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F
Sbjct  342  AVEGELVVQPSDSHFWFDRPQIVLFLIHFILFQNAFEIAFFFWILFQYGFYSCIMGKYVF  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            + PRLVIGV IQVLCSYSTLP+YA+VTQMG+H+KKS+FD+H+Q  L+ WA+K K++K  K
Sbjct  402  VAPRLVIGVFIQVLCSYSTLPLYALVTQMGSHYKKSMFDDHVQACLIEWAEKVKKKKAQK  461

Query  222  AAFGGINH--GGALTDGSSTGVQ  160
            AA  G NH      T GS   V 
Sbjct  462  AARDGSNHPTDDGFTIGSPESVH  484



>gb|ABY77906.1| mildew resistance locus o 15 [Vitis vinifera]
 emb|CBI24772.3| unnamed protein product [Vitis vinifera]
Length=506

 Score =   305 bits (781),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 173/230 (75%), Gaps = 2/230 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAFIPFILLL VGTKLEHV  QLAHEVAEKHV
Sbjct  279  VVGISWYLWIFVVVFLLLNVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHV  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFWF RPQIVLFLI  ILFQN+FE+AFFFWI VQYGFDSCIMG + F
Sbjct  339  AIEGDLVVRPSDDHFWFHRPQIVLFLIQIILFQNSFELAFFFWIWVQYGFDSCIMGQLGF  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL IG  +Q LCSYSTLP+YAIV QMG+ FK+SIF+EHIQ GLV WA KAK + G K
Sbjct  399  IIPRLFIGAFVQFLCSYSTLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFK  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
                G +  G   +     VQ+  V  KES    G         G  GSK
Sbjct  459  KNANGPSQVGP-KEVPPPAVQLAEV-VKESAEEKGNVGEIHPATGSGGSK  506



>gb|KDP29534.1| hypothetical protein JCGZ_19247 [Jatropha curcas]
Length=497

 Score =   305 bits (780),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/214 (72%), Positives = 178/214 (83%), Gaps = 1/214 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV IFLLLNI GWHTYFWIAF+PFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  274  VVGISWYLWLFVFIFLLLNIAGWHTYFWIAFVPFILLLAVGTKLEHVITQLAHEVAEKHV  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++G+LV+QPSD+HFWF RPQIV+ LIH ILFQN+FE+AFFFWI  QYGFDSCIMG V +
Sbjct  334  AVKGDLVIQPSDDHFWFHRPQIVIILIHIILFQNSFELAFFFWIWAQYGFDSCIMGQVGY  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IG  +Q +CSYSTLP+YAIVTQMG+ FKK+IFDEHIQVGLVGWA++AK+   L+
Sbjct  394  IIPRLIIGAFVQFVCSYSTLPLYAIVTQMGSSFKKAIFDEHIQVGLVGWAKQAKKNTVLR  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
             A  G +  G   D S   VQ+  +G KES   D
Sbjct  454  KAAHGSSQVGHKED-SPPAVQLANIGDKESAMED  486



>ref|NP_001267997.1| mildew resistance locus o 15 [Vitis vinifera]
 gb|ACF25912.1| MLO-like protein 7 [Vitis vinifera]
Length=506

 Score =   305 bits (780),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/230 (67%), Positives = 173/230 (75%), Gaps = 2/230 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAFIPFILLL VGTKLEHV  QLAHEVAEKHV
Sbjct  279  VVGISWYLWIFVVVFLLLNVKGWHAYFWIAFIPFILLLLVGTKLEHVTTQLAHEVAEKHV  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFWF RPQIVLFLI  ILFQN+FE+AFFFWI VQYGFDSCIMG + F
Sbjct  339  AIEGDLVVRPSDDHFWFHRPQIVLFLIQIILFQNSFELAFFFWIWVQYGFDSCIMGQLGF  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL IG  +Q LCSYSTLP+YAIV QMG+ FK+SIF+EHIQ GLV WA KAK + G K
Sbjct  399  IIPRLFIGAFVQFLCSYSTLPLYAIVAQMGSSFKRSIFEEHIQHGLVEWAHKAKLKTGFK  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
                G +  G   +     VQ+  V  KES    G         G  GSK
Sbjct  459  KNANGPSQVGP-KEVPPXAVQLAEV-VKESAEEKGNVGEIHPATGSGGSK  506



>ref|XP_008243092.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=532

 Score =   305 bits (782),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 177/215 (82%), Gaps = 1/215 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  286  VVGISWYLWIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHI  345

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP++VL LI  ILFQN+FE+AFFFWI VQY FDSCIMG V +
Sbjct  346  AIEGDLVVQPSDDHFWFHRPRLVLLLIQIILFQNSFELAFFFWIWVQYSFDSCIMGQVGY  405

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  IQ +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQVGLVGWA+ AK+ K L+
Sbjct  406  IIPRLVIGAFIQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQVGLVGWARSAKKNKALR  465

Query  222  AAFGGINHGGALTDGSSTGVQMGGV-GRKESGSTD  121
             A  G +        +S  VQ+  V G KES   D
Sbjct  466  KAANGSSSSQGGPKEASQTVQLAQVAGHKESSRED  500



>ref|XP_006478504.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=510

 Score =   305 bits (780),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 173/214 (81%), Gaps = 0/214 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++ WH YFWI+FIPFILLLAVGTKLEH+I QLAHEVAEKHV
Sbjct  281  VVGISWYLWVFVVVFLLLNVHNWHAYFWISFIPFILLLAVGTKLEHIITQLAHEVAEKHV  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L V+PSD+HFWF +P++VL LIH ILFQN+FEIA F WI VQY F SCIMG   +
Sbjct  341  AIEGDLYVKPSDDHFWFRKPRLVLVLIHIILFQNSFEIAVFLWICVQYKFHSCIMGPYGY  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IG+ +Q  CSYSTLP+YAIVTQMG+ FKKSIFDEHIQ GLVGWA++AK+  GL+
Sbjct  401  IIPRLIIGLFVQFFCSYSTLPLYAIVTQMGSSFKKSIFDEHIQEGLVGWAKQAKKNMGLR  460

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
             A    ++     D SS  +QM  V  +++ + D
Sbjct  461  KAAAKGSNQVVHKDDSSASIQMTNVQSEQNSAED  494



>ref|XP_004962062.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=494

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 153/207 (74%), Positives = 179/207 (86%), Gaps = 1/207 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P  LLLA+GTKLEHVI QLAH+VAEKH 
Sbjct  278  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLFLLLAIGTKLEHVIAQLAHDVAEKHT  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGE+VV+PSD+HFWFG+P+++LFLIHFILFQNAFEIAFFFWIL  YGFDSCIMG V+F
Sbjct  338  AIEGEVVVKPSDDHFWFGKPRVILFLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRF  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV+IQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQK K RKGLK
Sbjct  398  IVPRLVIGVLIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMRKGLK  457

Query  222  -AAFGGINHGGALTDGSSTGVQMGGVG  145
             AA    +   A + G S  ++M   G
Sbjct  458  GAANKAESTSNADSAGPSATIEMAKAG  484



>dbj|BAJ24148.1| seven trans-membrane protein [Triticum aestivum]
Length=499

 Score =   303 bits (777),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 155/217 (71%), Positives = 182/217 (84%), Gaps = 4/217 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAFIP ILLLAVGTKLEHVI QLA +VAEKH 
Sbjct  281  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFIPLILLLAVGTKLEHVIAQLAQDVAEKHS  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+L+V+PSD+HFWFGRP+IVLFLIHFILFQNAFEIAFFFWIL  YGF+SCIMG V F
Sbjct  341  AVEGDLIVKPSDDHFWFGRPRIVLFLIHFILFQNAFEIAFFFWILTTYGFNSCIMGQVGF  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIG+IIQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQKAK +KG K
Sbjct  401  IVPRLVIGLIIQLLCSYSTLPLYAIVTQMGSFYKKEIFNEHVQQGVLGWAQKAKMKKGFK  460

Query  222  AAFGGINHGGAL-TDGSSTGVQMGGVGRKESGSTDGA  115
             + G       + + G S  V+M    R+ +G  + A
Sbjct  461  KSNGAAESTSPVGSAGPSAKVEM---VRRPAGQGNDA  494



>dbj|BAK08220.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WYLW+FVVIF+LLN+NGWHTYFWI+F+P ILLLAVGTKLEHVI QLA +V EKH 
Sbjct  267  VVGIRWYLWIFVVIFMLLNVNGWHTYFWISFVPLILLLAVGTKLEHVIDQLAQDVVEKHS  326

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSDEHFW G+P+++L+LIHFILFQNAFEIA FFWIL  YGF+SCIM HV F
Sbjct  327  AIEGDLVVNPSDEHFWCGKPRVILYLIHFILFQNAFEIALFFWILTTYGFNSCIMDHVPF  386

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL  226
            I+PRLVIGV+IQ+LCSYSTLP+YAIVTQMGT +KK IFDEH+Q GL+GWAQKA+ R  L
Sbjct  387  IVPRLVIGVVIQLLCSYSTLPLYAIVTQMGTFYKKEIFDEHVQQGLLGWAQKARMRTEL  445



>ref|XP_006441977.1| hypothetical protein CICLE_v10019784mg [Citrus clementina]
 gb|ESR55217.1| hypothetical protein CICLE_v10019784mg [Citrus clementina]
Length=508

 Score =   303 bits (776),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 144/214 (67%), Positives = 172/214 (80%), Gaps = 0/214 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++ WH YFWI+FIPFILLLAVGTKLEH+I QLAHEVAEKHV
Sbjct  279  VVGISWYLWVFVVVFLLLNVHNWHAYFWISFIPFILLLAVGTKLEHIITQLAHEVAEKHV  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L V+PSD+HFWF +P++VL LIH ILFQN+FEIA F WI VQY F SCIMG   +
Sbjct  339  AIEGDLYVKPSDDHFWFRKPRLVLVLIHIILFQNSFEIAVFLWICVQYKFHSCIMGPYGY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IG+ +Q  CSYSTLP+YAIVTQMG+ FKKSIFDEHIQ GLVGWA++AK+  GL+
Sbjct  399  IIPRLIIGLFVQFFCSYSTLPLYAIVTQMGSSFKKSIFDEHIQEGLVGWAKQAKKNMGLR  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
             A    ++     D SS   QM  V  +++ + D
Sbjct  459  KAAAKGSNQVVHKDDSSASTQMTNVQSEQNSAID  492



>ref|XP_007203635.1| hypothetical protein PRUPE_ppa004012mg [Prunus persica]
 gb|EMJ04834.1| hypothetical protein PRUPE_ppa004012mg [Prunus persica]
Length=535

 Score =   304 bits (778),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 154/215 (72%), Positives = 176/215 (82%), Gaps = 1/215 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  288  VVGISWYLWIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHI  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP++VL LI  ILFQN+FE+AFFFWI VQY FDSCIMG V +
Sbjct  348  AIEGDLVVQPSDDHFWFHRPRLVLLLIQIILFQNSFELAFFFWIWVQYSFDSCIMGQVGY  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  IQ +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GLVGWA+ AK+ K L+
Sbjct  408  IIPRLVIGAFIQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLVGWARSAKKNKALR  467

Query  222  AAFGGINHGGALTDGSSTGVQMGGV-GRKESGSTD  121
             A  G +        +S  VQ+  V G KES   D
Sbjct  468  KAANGSSSSQGGPKEASQTVQLAQVAGNKESSRED  502



>ref|XP_010065113.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=387

 Score =   299 bits (765),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 179/230 (78%), Gaps = 19/230 (8%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWI+FIP ILLLAVGTKLEHVI QLA EVA++HV
Sbjct  149  VVGISWYLWLFVVVFLLLNVAGWHAYFWISFIPLILLLAVGTKLEHVITQLAQEVAQRHV  208

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVVQPSD+HFWF RP++VL LIH I FQN+FE+AFFF+I +QY F SCIMG V +
Sbjct  209  AIAGDLVVQPSDDHFWFHRPRLVLVLIHIIQFQNSFELAFFFFIWIQYNFSSCIMGEVGY  268

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV +Q LCSYSTLP+YAIVTQMGT FKK+IFDEHI  GLVGWA+ AK+ K L+
Sbjct  269  IIPRLIIGVFVQFLCSYSTLPLYAIVTQMGTSFKKAIFDEHIHQGLVGWARHAKKNKNLR  328

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
                        TDGSST          ++GS +G+    L++ GG+G++
Sbjct  329  K---------TATDGSST----------QTGSKEGSVGVELRENGGNGTE  359



>ref|XP_002441109.1| hypothetical protein SORBIDRAFT_09g020570 [Sorghum bicolor]
 gb|EES19539.1| hypothetical protein SORBIDRAFT_09g020570 [Sorghum bicolor]
Length=498

 Score =   302 bits (773),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 154/226 (68%), Positives = 182/226 (81%), Gaps = 7/226 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+NGWHTYFWIAF+P  LLLA+GTKLEHVI QLAH+VAEKH 
Sbjct  279  VVGISWYLWVFVVIFLLLNVNGWHTYFWIAFLPLFLLLAIGTKLEHVIAQLAHDVAEKHT  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+++V+PSDEHFWFG+P+I+L+LIHFILFQNAFEIAFFFWIL  YGFDSCIMG V+F
Sbjct  339  AIEGDVIVKPSDEHFWFGKPRIILYLIHFILFQNAFEIAFFFWILSTYGFDSCIMGQVRF  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGV+IQ+LCSYSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQK K RKGLK
Sbjct  399  IVPRLVIGVVIQLLCSYSTLPLYAIVTQMGSCYKKEIFNEHVQQGVLGWAQKVKMRKGLK  458

Query  222  -AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
             AA    N      D +   V++      E    +G  V  +   G
Sbjct  459  GAAAASKNESTINADSAGPSVKI------EMAKAEGEDVEVVGNTG  498



>gb|ABK93651.1| unknown [Populus trichocarpa]
Length=439

 Score =   300 bits (767),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV
Sbjct  214  VVGISWYLWLFVVIFLCLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  273

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++G+LVV+PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +
Sbjct  274  AVQGDLVVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGY  333

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+
Sbjct  334  IIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLR  393

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                  +H        S  +QM   G +E+   +  S
Sbjct  394  RDANESSHNQVGPKVESPLIQMAKAGSRETAVEENKS  430



>ref|XP_006372313.1| hypothetical protein POPTR_0017s00470g [Populus trichocarpa]
 gb|ERP50110.1| hypothetical protein POPTR_0017s00470g [Populus trichocarpa]
Length=499

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV
Sbjct  274  VVGISWYLWLFVVIFLCLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++G+LVV+PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +
Sbjct  334  AVQGDLVVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGY  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+
Sbjct  394  IIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLR  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                  +H        S  +QM   G +E+   +  S
Sbjct  454  RTANESSHNQVGPKEESPLIQMAKAGSRETAVEENKS  490



>ref|XP_004244787.1| PREDICTED: MLO-like protein 1 [Solanum lycopersicum]
Length=504

 Score =   301 bits (772),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/215 (69%), Positives = 172/215 (80%), Gaps = 5/215 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++GWHTYFWIAF+PF LLLAVGTKLEHVI QLA EVA KH+
Sbjct  278  VVGISWYLWVFVVLFLLLNVHGWHTYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHI  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF RP++VLFLIH ILFQN+FEIAFFFWI  QY F+SCIMG V +
Sbjct  338  AVEGDLVVKPSDDHFWFHRPRLVLFLIHIILFQNSFEIAFFFWIWAQYRFNSCIMGQVGY  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GL+ WA KA++R    
Sbjct  398  IIPRLVIGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQEGLLVWANKARRR----  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDG  118
             A  G N        S   VQ+  VG +ES   +G
Sbjct  454  -AVNGSNQVEHKESTSLMSVQLAQVGTQESAMEEG  487



>ref|XP_011014744.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=499

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLA EVAEKHV
Sbjct  274  VVGISWYLWLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAREVAEKHV  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +
Sbjct  334  AVEGDLVVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGY  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+E+IQ GLVGWA++AK++ GL+
Sbjct  394  IIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEYIQEGLVGWAKQAKKKAGLR  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
             A    +H        S  +QM   G +E+   +  S
Sbjct  454  RAANESSHNQVSPKEESPLIQMAKAGSRETAVEENKS  490



>ref|XP_011004548.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
 ref|XP_011004549.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
 ref|XP_011004550.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=499

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLA EVAEKHV
Sbjct  274  VVGISWYLWLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAREVAEKHV  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +
Sbjct  334  AVEGDLVVRPSDDHFWFNKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGY  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+E+IQ GLVGWA++AK++ GL+
Sbjct  394  IIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEYIQEGLVGWAKQAKKKAGLR  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
             A    +H        S  +QM   G +E+   +  S
Sbjct  454  RAANESSHNQVSPKEESPLIQMAKAGSRETAVEENKS  490



>ref|XP_006366803.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=507

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/171 (83%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLLNINGWHTYFWIAF PFILLLAVGTKLEHVI+QLAHE+AEKHV
Sbjct  296  VVGISWYLWIFVILFLLLNINGWHTYFWIAFFPFILLLAVGTKLEHVILQLAHEIAEKHV  355

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV PSD HFWF  PQI+LFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F
Sbjct  356  AIEGELVVTPSDNHFWFDNPQIILFLIHFILFQNAFEIAFFFWILFQYGFHSCIMGKYVF  415

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
            +IPRLVIGVIIQVLCSYSTLP+YA+VTQMG+H+KKS+FD H+Q  L+ WA+
Sbjct  416  VIPRLVIGVIIQVLCSYSTLPLYALVTQMGSHYKKSMFDNHVQACLMEWAE  466



>ref|XP_006372311.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
 gb|ERP50108.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
Length=439

 Score =   299 bits (766),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV
Sbjct  214  VVGISWYLWLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  273

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++G+LVV+PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +
Sbjct  274  AVQGDLVVRPSDDHFWFKKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGY  333

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+
Sbjct  334  IIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLR  393

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                  +H        S  +QM   G +E+   +  S
Sbjct  394  RDANESSHNQVGPKVESPLIQMAKAGSRETAVEENKS  430



>ref|XP_003564808.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=500

 Score =   300 bits (768),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WYLW+FVVIF+LLN+NGWHTYFWI+F+P +LLLAVGTKLEHVI QLA EVAEKH 
Sbjct  284  VVGIRWYLWLFVVIFMLLNVNGWHTYFWISFLPLLLLLAVGTKLEHVIAQLAQEVAEKHS  343

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            +IEG+LVV PSDEHFW  RP+++L+LIHFILFQNAFEIA FFW+L  YGF+SCIM HV F
Sbjct  344  SIEGDLVVNPSDEHFWCARPRVILYLIHFILFQNAFEIALFFWMLTTYGFNSCIMDHVPF  403

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVIGVIIQ+LCSYSTLP+YAIVTQMGT FKK IFDEH+Q GLVGWAQKAK+RK  K
Sbjct  404  IVPRLVIGVIIQLLCSYSTLPLYAIVTQMGTFFKKEIFDEHVQQGLVGWAQKAKRRKESK  463

Query  222  AA  217
             A
Sbjct  464  EA  465



>ref|XP_006372312.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
 gb|ERP50109.1| hypothetical protein POPTR_0017s00450g [Populus trichocarpa]
Length=499

 Score =   300 bits (767),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 177/217 (82%), Gaps = 0/217 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFL LN++GWH YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV
Sbjct  274  VVGISWYLWLFVVIFLFLNVSGWHAYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++G+LVV+PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V +
Sbjct  334  AVQGDLVVRPSDDHFWFKKPKIVLLLIHIILFQNSFELAFFFWIWVQYGFDSCIMGQVGY  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  +Q LCSYSTLP+YAIVTQMG+ FK+ IF+EHIQ GLVGWA++AK++ GL+
Sbjct  394  IIPRLVIGAFVQFLCSYSTLPLYAIVTQMGSSFKREIFEEHIQEGLVGWAKQAKKKAGLR  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
                  +H        S  +QM   G +E+   +  S
Sbjct  454  RDANESSHNQVGPKVESPLIQMAKAGSRETAVEENKS  490



>ref|XP_004962063.1| PREDICTED: MLO-like protein 1-like isoform X1 [Setaria italica]
Length=485

 Score =   298 bits (764),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            +V  SW LWVFVVIFLLLN+NGWHTYFW+AF+P +LL+A+GTKLEHVI QLA++VA +H 
Sbjct  283  IVSTSWSLWVFVVIFLLLNVNGWHTYFWMAFLPLVLLMAIGTKLEHVIAQLAYDVASRHA  342

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSDEHFWFGRP+IVL LIHFILFQNAFE++FFFWIL+ YGF SC M HV F
Sbjct  343  AIEGDLVVKPSDEHFWFGRPRIVLHLIHFILFQNAFELSFFFWILMTYGFHSCFMDHVGF  402

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            ++PRLV+GV+IQ+LCSYSTLP+YAIVTQMG+++KK IF+EH+Q G++GWA+KAK+R GLK
Sbjct  403  LVPRLVLGVVIQLLCSYSTLPLYAIVTQMGSYYKKEIFNEHVQQGVLGWAEKAKKRSGLK  462



>gb|KDO49756.1| hypothetical protein CISIN_1g0113632mg, partial [Citrus sinensis]
Length=348

 Score =   293 bits (751),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLL+NI+GWHTYFWIAF+PFILLLAVGTKLEH+I QLAHEVAEKH+
Sbjct  142  VVGISWYLWLFVVIFLLINIDGWHTYFWIAFVPFILLLAVGTKLEHIISQLAHEVAEKHI  201

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSC MG V+F
Sbjct  202  AIEGDLVVQPSDDHFWFNRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCTMGQVRF  261

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  IQ LCSYSTLP+Y IVTQMG+ FKK+IFDEHIQ GLVGWA+ AK++   K
Sbjct  262  IIPRLVIGCFIQFLCSYSTLPLYVIVTQMGSSFKKAIFDEHIQDGLVGWARMAKKKNTNK  321

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK  139
             A  G +  G   +  S  +Q+  +  K
Sbjct  322  NAADGSSKVGHKEEYPSV-IQLQKLSNK  348



>ref|XP_010930334.1| PREDICTED: MLO-like protein 1 isoform X3 [Elaeis guineensis]
Length=414

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLL++NGWH YFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH 
Sbjct  182  VVGISWYLWIFVMVFLLLDVNGWHAYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHS  241

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG L+V PSDE FWF RP+IVLFLIHFILFQNAFEIAFFFWIL  Y FDSCIMG   F
Sbjct  242  AIEGHLIVTPSDELFWFHRPKIVLFLIHFILFQNAFEIAFFFWILTTYHFDSCIMGQAVF  301

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVI VIIQ+LC YSTLP+YAIVTQMG+ FK +IFDE++QVGLVGWAQ+ ++ KG +
Sbjct  302  IIPRLVICVIIQLLCGYSTLPLYAIVTQMGSSFKMAIFDENVQVGLVGWAQQVRKGKGKR  361

Query  222  AAFGGINHGGALTDGSSTGV  163
                          G+ T V
Sbjct  362  VVNRESRSTSTPQSGNGTSV  381



>ref|XP_010040798.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=517

 Score =   298 bits (763),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 148/230 (64%), Positives = 179/230 (78%), Gaps = 19/230 (8%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWI+FIP +LLLAVGTKLEHVI QLA EVA++HV
Sbjct  279  VVGISWYLWLFVVVFLLLNVAGWHAYFWISFIPLLLLLAVGTKLEHVITQLAQEVAQRHV  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVVQPSD+HFWF RP++VL LIH ILFQN+FE+AFFF+IL+QY F SCIMG V +
Sbjct  339  AIAGDLVVQPSDDHFWFHRPRLVLVLIHIILFQNSFELAFFFFILLQYNFSSCIMGEVGY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV +Q LCSYSTLP+YAIVTQMGT FKK IFDEHI  GLVGWA+ AK+ K L+
Sbjct  399  IIPRLIIGVFVQFLCSYSTLPLYAIVTQMGTSFKKVIFDEHIHQGLVGWARHAKKNKNLR  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGSK  73
                       +T GSST          ++GS +G+    L + GG+G++
Sbjct  459  K---------TVTVGSST----------QTGSKEGSVGVELTKNGGNGTE  489



>ref|XP_006441984.1| hypothetical protein CICLE_v10020313mg [Citrus clementina]
 gb|ESR55224.1| hypothetical protein CICLE_v10020313mg [Citrus clementina]
Length=421

 Score =   295 bits (755),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 174/208 (84%), Gaps = 1/208 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLL+NI+GWHTYFWIAF PFILLLAVGTKLEH+I QLAHEVAEKH+
Sbjct  215  VVGISWYLWLFVVIFLLINIDGWHTYFWIAFFPFILLLAVGTKLEHIISQLAHEVAEKHI  274

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIMG V+F
Sbjct  275  AIEGDLVVQPSDDHFWFNRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCIMGRVRF  334

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  IQ +CSYSTLP+Y IVTQMG+ FKK+IFDEHIQ GLVGWA+ AK++   K
Sbjct  335  IIPRLVIGCFIQFICSYSTLPLYVIVTQMGSSFKKAIFDEHIQDGLVGWARMAKKKNTNK  394

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK  139
             A  G +  G   +  S  +Q+  +  K
Sbjct  395  NAADGSSKVGHKEEYPSV-IQLQKLSNK  421



>ref|XP_006351085.1| PREDICTED: MLO-like protein 1-like [Solanum tuberosum]
Length=504

 Score =   297 bits (760),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 147/215 (68%), Positives = 171/215 (80%), Gaps = 5/215 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++GWH YFWIAF+PF LLLAVGTKLEHVI QLA EVA KH+
Sbjct  278  VVGISWYLWVFVVLFLLLNVHGWHAYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHI  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF RP++VLFLIH ILFQN+FEIAFFFWI  QY F+SCIMG V +
Sbjct  338  AVEGDLVVKPSDDHFWFHRPRLVLFLIHIILFQNSFEIAFFFWIWAQYRFNSCIMGQVGY  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDE+IQ GLV WA+KA++R    
Sbjct  398  IIPRLVIGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEYIQDGLVVWAKKARRR----  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDG  118
             A  G N  G     S   VQ+  V  + S   +G
Sbjct  454  -AVNGSNQVGHKESTSPMAVQLAQVETQVSAMEEG  487



>gb|KJB28898.1| hypothetical protein B456_005G074900 [Gossypium raimondii]
Length=462

 Score =   295 bits (756),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 171/216 (79%), Gaps = 4/216 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW FV IFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+
Sbjct  246  VVGISWYLWAFVAIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHM  305

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             + GELVVQPSD HFWF RP++VL LIH ILFQN+FE+AFF WI VQYGF+SC+MG V+F
Sbjct  306  VVTGELVVQPSDNHFWFNRPRLVLRLIHIILFQNSFEMAFFAWIWVQYGFNSCMMGQVRF  365

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK---  232
            IIPRLVIGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHIQ GLVGWA+KA+++    
Sbjct  366  IIPRLVIGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIQEGLVGWARKARKKNKGS  425

Query  231  GLKAAFGGINHGGALTDGSSTGVQMGGVGRKESGST  124
            GLK      +  G   + S    +M  V  KES S+
Sbjct  426  GLKRPSNESSQVGP-KEESPLVFEMDKVNGKESSSS  460



>ref|XP_010930331.1| PREDICTED: MLO-like protein 1 isoform X1 [Elaeis guineensis]
Length=508

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/200 (72%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLL++NGWH YFWI+FIP ILLLAVGTKLEH+I QLAHEVAEKH 
Sbjct  276  VVGISWYLWIFVMVFLLLDVNGWHAYFWISFIPLILLLAVGTKLEHIITQLAHEVAEKHS  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG L+V PSDE FWF RP+IVLFLIHFILFQNAFEIAFFFWIL  Y FDSCIMG   F
Sbjct  336  AIEGHLIVTPSDELFWFHRPKIVLFLIHFILFQNAFEIAFFFWILTTYHFDSCIMGQAVF  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVI VIIQ+LC YSTLP+YAIVTQMG+ FK +IFDE++QVGLVGWAQ+ ++ KG +
Sbjct  396  IIPRLVICVIIQLLCGYSTLPLYAIVTQMGSSFKMAIFDENVQVGLVGWAQQVRKGKGKR  455

Query  222  AAFGGINHGGALTDGSSTGV  163
                          G+ T V
Sbjct  456  VVNRESRSTSTPQSGNGTSV  475



>gb|KHG23854.1| MLO-like protein 1 [Gossypium arboreum]
Length=471

 Score =   295 bits (755),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 172/216 (80%), Gaps = 4/216 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW FVVIFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+
Sbjct  255  VVGISWYLWAFVVIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHM  314

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             + GELVVQPSD HFWF RP++VL LIH ILFQN+FE+AFF WI VQYGF+SC+MG V+F
Sbjct  315  VVTGELVVQPSDNHFWFNRPRLVLRLIHIILFQNSFEMAFFAWIWVQYGFNSCMMGQVRF  374

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK---  232
            IIPRLVIGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHIQ GLVGWA+KA+++    
Sbjct  375  IIPRLVIGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIQEGLVGWARKARKKNKGS  434

Query  231  GLKAAFGGINHGGALTDGSSTGVQMGGVGRKESGST  124
            G K +    +  G   + S    +M  V  KES S+
Sbjct  435  GFKRSSNESSQVGP-KEESPLVFEMHKVNGKESSSS  469



>ref|XP_006478537.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=487

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 167/190 (88%), Gaps = 0/190 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLL+NI+GWHTYFWIAF+PFILLLAVGTKLEH+I QLAHEVAEKH+
Sbjct  281  VVGISWYLWLFVVIFLLINIDGWHTYFWIAFVPFILLLAVGTKLEHIISQLAHEVAEKHI  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSC MG V+F
Sbjct  341  AIEGDLVVQPSDDHFWFNRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCTMGQVRF  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  IQ LCSYSTLP+Y IVTQMG+ FKK+IFDEHIQ GLVGWA+ AK++   K
Sbjct  401  IIPRLVIGCFIQFLCSYSTLPLYVIVTQMGSSFKKAIFDEHIQDGLVGWARMAKKKNTNK  460

Query  222  AAFGGINHGG  193
             A  G +  G
Sbjct  461  NAADGSSKVG  470



>gb|KJB28899.1| hypothetical protein B456_005G074900 [Gossypium raimondii]
Length=497

 Score =   295 bits (756),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 171/216 (79%), Gaps = 4/216 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW FV IFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+
Sbjct  281  VVGISWYLWAFVAIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHM  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             + GELVVQPSD HFWF RP++VL LIH ILFQN+FE+AFF WI VQYGF+SC+MG V+F
Sbjct  341  VVTGELVVQPSDNHFWFNRPRLVLRLIHIILFQNSFEMAFFAWIWVQYGFNSCMMGQVRF  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK---  232
            IIPRLVIGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHIQ GLVGWA+KA+++    
Sbjct  401  IIPRLVIGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIQEGLVGWARKARKKNKGS  460

Query  231  GLKAAFGGINHGGALTDGSSTGVQMGGVGRKESGST  124
            GLK      +  G   + S    +M  V  KES S+
Sbjct  461  GLKRPSNESSQVGP-KEESPLVFEMDKVNGKESSSS  495



>ref|XP_011085087.1| PREDICTED: MLO-like protein 1 isoform X3 [Sesamum indicum]
Length=512

 Score =   294 bits (753),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 172/223 (77%), Gaps = 15/223 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAF+P ILLLAVGTKLEH+I QLA EVA++HV
Sbjct  295  VVGISWYLWIFVVVFLLLNVRGWHAYFWIAFVPLILLLAVGTKLEHIITQLAEEVAQRHV  354

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+ GELVV+PSD HFWF +P++VL LIH ILFQN+FEIA FFW+LV + FDSCIMGH ++
Sbjct  355  AVPGELVVKPSDHHFWFSKPRLVLVLIHIILFQNSFEIAIFFWMLVMFQFDSCIMGHSRY  414

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR-KGL  226
            IIPRL+IGV++Q LCSYSTLP+YAIV QMG+ F ++IF+EHIQ  L GWAQKAK+  KG 
Sbjct  415  IIPRLIIGVLVQFLCSYSTLPLYAIVAQMGSSFNRAIFEEHIQEKLTGWAQKAKRNYKGQ  474

Query  225  KAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            + A GG         GSS       VG KES S      + L+
Sbjct  475  RKAMGGA--------GSSQ------VGNKESPSPAAPQAKGLE  503



>ref|XP_011085086.1| PREDICTED: MLO-like protein 1 isoform X2 [Sesamum indicum]
Length=518

 Score =   293 bits (751),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 172/223 (77%), Gaps = 15/223 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAF+P ILLLAVGTKLEH+I QLA EVA++HV
Sbjct  301  VVGISWYLWIFVVVFLLLNVRGWHAYFWIAFVPLILLLAVGTKLEHIITQLAEEVAQRHV  360

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+ GELVV+PSD HFWF +P++VL LIH ILFQN+FEIA FFW+LV + FDSCIMGH ++
Sbjct  361  AVPGELVVKPSDHHFWFSKPRLVLVLIHIILFQNSFEIAIFFWMLVMFQFDSCIMGHSRY  420

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR-KGL  226
            IIPRL+IGV++Q LCSYSTLP+YAIV QMG+ F ++IF+EHIQ  L GWAQKAK+  KG 
Sbjct  421  IIPRLIIGVLVQFLCSYSTLPLYAIVAQMGSSFNRAIFEEHIQEKLTGWAQKAKRNYKGQ  480

Query  225  KAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            + A GG         GSS       VG KES S      + L+
Sbjct  481  RKAMGGA--------GSSQ------VGNKESPSPAAPQAKGLE  509



>ref|XP_011085085.1| PREDICTED: MLO-like protein 15 isoform X1 [Sesamum indicum]
Length=537

 Score =   294 bits (752),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 172/223 (77%), Gaps = 15/223 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAF+P ILLLAVGTKLEH+I QLA EVA++HV
Sbjct  320  VVGISWYLWIFVVVFLLLNVRGWHAYFWIAFVPLILLLAVGTKLEHIITQLAEEVAQRHV  379

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+ GELVV+PSD HFWF +P++VL LIH ILFQN+FEIA FFW+LV + FDSCIMGH ++
Sbjct  380  AVPGELVVKPSDHHFWFSKPRLVLVLIHIILFQNSFEIAIFFWMLVMFQFDSCIMGHSRY  439

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR-KGL  226
            IIPRL+IGV++Q LCSYSTLP+YAIV QMG+ F ++IF+EHIQ  L GWAQKAK+  KG 
Sbjct  440  IIPRLIIGVLVQFLCSYSTLPLYAIVAQMGSSFNRAIFEEHIQEKLTGWAQKAKRNYKGQ  499

Query  225  KAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            + A GG         GSS       VG KES S      + L+
Sbjct  500  RKAMGGA--------GSSQ------VGNKESPSPAAPQAKGLE  528



>ref|XP_008656279.1| PREDICTED: MLO-like protein 1 [Zea mays]
Length=491

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/219 (64%), Positives = 178/219 (81%), Gaps = 5/219 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWH YFWI+F+P +LLLAVGTKLEHVI QL H+VA+KH 
Sbjct  273  VVGISWYLWIFVVIFLLLNVNGWHIYFWISFLPLLLLLAVGTKLEHVIAQLGHDVAKKHA  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+++V+PSD HFWFG+P+I+L+LIHFILFQN+FEIAFFFWIL  YGFD+C+M H++F
Sbjct  333  AIDGDVIVKPSDSHFWFGKPRIILYLIHFILFQNSFEIAFFFWILTTYGFDACMMEHLRF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLV+GV+IQ+LCSY TLP+YAIVTQMG+ +KK IF++H+Q G++ WAQK K RKGLK
Sbjct  393  IIPRLVMGVVIQLLCSYITLPLYAIVTQMGSCYKKEIFNDHVQKGVLVWAQKVKMRKGLK  452

Query  222  AAFG---GINHGGALTDGSSTGVQMGGVGR--KESGSTD  121
             A        +  A   G S  ++M   G   K  G+T+
Sbjct  453  GALSKSDSAKNNNADPAGPSVKIEMAKAGEDAKVVGNTE  491



>ref|XP_010065098.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=516

 Score =   293 bits (750),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 171/217 (79%), Gaps = 6/217 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWI+FIP  LLLAVGTKLEHVI QLA +VA++H+
Sbjct  277  VVGISWYLWLFVVVFLLLNVAGWHAYFWISFIPLTLLLAVGTKLEHVINQLAQDVAQRHI  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVVQPSD+HFWF RP++VL LIH ILFQN+FE+AF F+I +QY F SCIMG V+F
Sbjct  337  AIAGDLVVQPSDDHFWFHRPRLVLVLIHIILFQNSFELAFLFFIWIQYRFKSCIMGEVRF  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q+LCSYSTLP+YAIVTQMGT FKK+IFDEHIQ GLVGWA +AK+   L+
Sbjct  397  IIPRLVIGVFVQLLCSYSTLPLYAIVTQMGTSFKKAIFDEHIQQGLVGWAWQAKKNNNLR  456

Query  222  AAFGGINHGGALTDGS---STGVQMGGVGRKESGSTD  121
                    G  +  GS   S GV++   GR  +   D
Sbjct  457  KT---ATDGSTVRTGSKQGSVGVELTKNGRDRTAMGD  490



>gb|EPS69013.1| hypothetical protein M569_05756 [Genlisea aurea]
Length=467

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/177 (77%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW FV+IFLLLNI+GWH+YFW+AF+PFILLLA+GTKLEHVI +LA EVAEKHV
Sbjct  255  VVGISWYLWCFVIIFLLLNIHGWHSYFWMAFVPFILLLAIGTKLEHVITELASEVAEKHV  314

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+ GELVV+PSD+ FWF RP +V  LIHFILFQNAFE+A+FFWI VQYGF+SCIMG V F
Sbjct  315  AVRGELVVRPSDDLFWFHRPWVVFVLIHFILFQNAFEVAYFFWIWVQYGFNSCIMGQVGF  374

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK  232
            +IPRLVI VIIQV+CSYSTLP+YA+VTQMG+HFKKSIFDEH+Q GLV WA+ AK   
Sbjct  375  VIPRLVIAVIIQVICSYSTLPLYALVTQMGSHFKKSIFDEHVQAGLVLWAENAKHNN  431



>ref|XP_002533335.1| Protein MLO, putative [Ricinus communis]
 gb|EEF29044.1| Protein MLO, putative, partial [Ricinus communis]
Length=507

 Score =   292 bits (748),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/223 (67%), Positives = 175/223 (78%), Gaps = 6/223 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+ GWH YFWIAFIPF+LL+AVG KLEHVI QLAHEVAEKH+
Sbjct  279  VVGISWYLWLFVVIFLLLNVAGWHAYFWIAFIPFVLLVAVGAKLEHVITQLAHEVAEKHI  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVVQPSD+HFWF RP+IVL LIH ILFQN+FE+AFFFWI VQYGFDSCIM  V +
Sbjct  339  AVEGDLVVQPSDDHFWFHRPRIVLILIHIILFQNSFELAFFFWIWVQYGFDSCIMEEVGY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPRL+IGV IQ +CSYSTLP+YAIVTQMG+ FKK+IFDEHIQ GLVGWA++ K++  L+
Sbjct  399  LIPRLIIGVFIQFVCSYSTLPLYAIVTQMGSSFKKAIFDEHIQTGLVGWAKQVKKKMVLR  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQ  94
             A  G        D        G V    +GS D   +R  Q+
Sbjct  459  KAANGSTQVSKKEDSP------GSVQLSHAGSEDSEMMRKEQE  495



>gb|KHG04571.1| MLO-like protein 1 [Gossypium arboreum]
Length=485

 Score =   291 bits (746),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = -2

Query  714  LLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVVQPSDEHFW  535
            LL    WHTYFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHVAIEGELVVQPSD+HFW
Sbjct  281  LLVAECWHTYFWIAFIPFILLLAVGTKLEHVITQLAHEVAEKHVAIEGELVVQPSDDHFW  340

Query  534  FGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVIIQVLCS  355
            F +P+IVLFLIHFILFQNAFEIAFFFWI VQ+GFDSCIMG V++I+PRLVIGV IQVLCS
Sbjct  341  FNKPRIVLFLIHFILFQNAFEIAFFFWIWVQFGFDSCIMGQVRYIVPRLVIGVFIQVLCS  400

Query  354  YSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHGGALTDGS  175
            YSTLP+YAIVTQMG+ FKKSIFDEH+QVGLVGWAQK K++KGLKAA G      +     
Sbjct  401  YSTLPLYAIVTQMGSSFKKSIFDEHVQVGLVGWAQKVKKKKGLKAATGSAAQENS-EQNP  459

Query  174  STGVQMGGVGRKESGSTD  121
            S  +QMG V R  S   +
Sbjct  460  SVAIQMGRVLRNASAPEE  477



>ref|XP_006295922.1| hypothetical protein CARUB_v10025059mg [Capsella rubella]
 gb|EOA28820.1| hypothetical protein CARUB_v10025059mg [Capsella rubella]
Length=490

 Score =   290 bits (743),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/198 (69%), Positives = 168/198 (85%), Gaps = 0/198 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKH+
Sbjct  260  VVGISWYLWVFVVLFLLLNIAAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHI  319

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKF
Sbjct  320  AVEGDLVVRPSDDLFWFQSPRLVLFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKF  379

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV++Q+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK+     
Sbjct  380  IIPRLIIGVLVQLLCSYSTLPLYALVTQMGSSFKGAIFNEQTQQQLVGWAKMAKKGVKKG  439

Query  222  AAFGGINHGGALTDGSST  169
            +   G +HGG+    ++T
Sbjct  440  STHAGSSHGGSPNPLAAT  457



>ref|XP_010559056.1| PREDICTED: MLO-like protein 15 isoform X1 [Tarenaya hassleriana]
Length=535

 Score =   291 bits (745),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/205 (69%), Positives = 169/205 (82%), Gaps = 1/205 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVVIFLLLN+  WH YFW+AFIP ILLLAVGTKLEH+I +LAH VAEKHV
Sbjct  306  VVGISWYLWVFVVIFLLLNVAAWHIYFWLAFIPLILLLAVGTKLEHIITELAHRVAEKHV  365

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGELVV+PSD+ FWFG P++VLFLIHFILFQN+FE+AFFF+IL+Q+G+DSCIMG VKF
Sbjct  366  AVEGELVVRPSDDLFWFGSPRLVLFLIHFILFQNSFELAFFFFILLQFGWDSCIMGQVKF  425

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV++Q+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK R   K
Sbjct  426  IIPRLVIGVMVQLLCSYSTLPLYALVTQMGSSFKAAIFNEQTQQQLVGWAKMAK-RGVKK  484

Query  222  AAFGGINHGGALTDGSSTGVQMGGV  148
             +    +  G  T  S   VQ+  +
Sbjct  485  GSTHASSSHGVETTPSPRSVQLQAL  509



>ref|XP_007020280.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY17505.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=489

 Score =   290 bits (741),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 169/215 (79%), Gaps = 4/215 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW FVVIFLLLN  GWHTYFWIAFIPFILLLAVGTKLEH+I QLA EVAE+H+
Sbjct  276  VVGISWYLWAFVVIFLLLNFVGWHTYFWIAFIPFILLLAVGTKLEHIITQLAQEVAERHI  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGELVVQPSD HFWF RP+++L LIH  LFQN+FE+AFF WI  QYGF SC+MG V+F
Sbjct  336  AVEGELVVQPSDNHFWFNRPRLILRLIHITLFQNSFELAFFAWIWFQYGFKSCMMGQVRF  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR---K  232
            IIPRLVIGV +Q +CSYSTLP+YA VTQMG+ +KK+IF+EHI+ GLVGWA+KAK+     
Sbjct  396  IIPRLVIGVFVQFVCSYSTLPLYAFVTQMGSSYKKAIFEEHIREGLVGWARKAKKNTKGN  455

Query  231  GLKAAFGGINHGGALTDGSSTGVQMGGVGRKESGS  127
              K +  G +  G   + S   ++M     KES +
Sbjct  456  AFKRSANGSSQVGP-KEESPLVLEMVEAYGKESAA  489



>ref|XP_002441107.1| hypothetical protein SORBIDRAFT_09g020550 [Sorghum bicolor]
 gb|EES19537.1| hypothetical protein SORBIDRAFT_09g020550 [Sorghum bicolor]
Length=479

 Score =   289 bits (739),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            +VG SW LW+FVVIFLLLN+NGWHTYFW+AF+P +LLLAVGTKLEHVI QLA++VAEK  
Sbjct  282  IVGTSWRLWIFVVIFLLLNVNGWHTYFWMAFLPLVLLLAVGTKLEHVIAQLAYDVAEKQT  341

Query  582  A-IEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVK  406
            A IEG+LVV PSD+HFWFGRP+I+L LIHFILFQNAFE+AFFFWIL+ YGF+SC M ++ 
Sbjct  342  ATIEGDLVVTPSDQHFWFGRPRIILHLIHFILFQNAFELAFFFWILMTYGFESCFMDNIG  401

Query  405  FIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL  226
            F++PRLV+GV+IQ+LCSYSTLP+YAIVTQMG+++K  IF+EH+Q G++GWA+KAK+R G 
Sbjct  402  FLVPRLVLGVVIQLLCSYSTLPLYAIVTQMGSYYKMEIFNEHVQHGVLGWAEKAKKRSGF  461

Query  225  K  223
            K
Sbjct  462  K  462



>ref|XP_006397586.1| hypothetical protein EUTSA_v10001415mg [Eutrema salsugineum]
 gb|ESQ39039.1| hypothetical protein EUTSA_v10001415mg [Eutrema salsugineum]
Length=505

 Score =   289 bits (740),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 141/220 (64%), Positives = 174/220 (79%), Gaps = 3/220 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAHEVAEKH+
Sbjct  274  VVGISWYLWVFVVLFLLLNIAAWHIYFWIAFIPLILLLAVGTKLEHIITDLAHEVAEKHI  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I V+YGFDSCIMG VKF
Sbjct  334  AVEGDLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFVEYGFDSCIMGQVKF  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  +VGWA+ AK+     
Sbjct  394  IIPRLVIGVLVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQIVGWAKMAKKGVKKG  453

Query  222  AAFGGINHGGA---LTDGSSTGVQMGGVGRKESGSTDGAS  112
            ++  G +HGG+   L   S   +Q+  +  K S   +  S
Sbjct  454  SSHAGTSHGGSPNPLATPSPRSIQLQSLLGKGSSQQNHHS  493



>ref|XP_010517997.1| PREDICTED: MLO-like protein 15 isoform X2 [Camelina sativa]
Length=464

 Score =   288 bits (737),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 171/200 (86%), Gaps = 4/200 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKH+
Sbjct  234  VVGISWYLWVFVVFFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHI  293

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKF
Sbjct  294  AVEGDLVVRPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKF  353

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKG  229
            IIPRL+IGV++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++  +KG
Sbjct  354  IIPRLIIGVLVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKG  413

Query  228  LKAAFGGINHGGALTDGSST  169
            +  A  G +HGG+    ++T
Sbjct  414  ITHA--GSSHGGSPNPLAAT  431



>ref|XP_010508339.1| PREDICTED: MLO-like protein 15 [Camelina sativa]
Length=503

 Score =   289 bits (739),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 134/198 (68%), Positives = 166/198 (84%), Gaps = 0/198 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKHV
Sbjct  273  VVGISWYLWVFVVFFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHV  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKF
Sbjct  333  AVEGDLVVRPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IG ++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++     
Sbjct  393  IIPRLIIGALVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKS  452

Query  222  AAFGGINHGGALTDGSST  169
            +   G +HGG+    ++T
Sbjct  453  STQAGSSHGGSPNPLAAT  470



>ref|XP_008383732.1| PREDICTED: MLO-like protein 1 [Malus domestica]
Length=540

 Score =   290 bits (742),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 150/225 (67%), Positives = 182/225 (81%), Gaps = 4/225 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  277  VVGISWYLWIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP++VL L+H ILFQN+FE+AFFFWILVQY F SC+MG + +
Sbjct  337  AIEGDLVVQPSDDHFWFHRPRLVLLLVHIILFQNSFELAFFFWILVQYKFHSCMMGELGY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPRLVIGV +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GLVGWA+ AK+ K L+
Sbjct  397  VIPRLVIGVFVQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLVGWARSAKKNKALR  456

Query  222  AAFGGINHGGALTDGSSTGVQMG-GVGRKESGSTDGASVRALQQM  91
             A        + +   +   Q+G GVG KE      A++   Q++
Sbjct  457  NAANANG---SGSGAGAGSTQVGVGVGLKEKEKEASATLELAQKL  498



>ref|XP_009757992.1| PREDICTED: MLO-like protein 1 [Nicotiana sylvestris]
Length=505

 Score =   288 bits (738),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 152/226 (67%), Positives = 176/226 (78%), Gaps = 4/226 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++GWH YFWIAF+PF LLLAVGTKLEHVI QLA EVA KHV
Sbjct  281  VVGISWYLWVFVVLFLLLNVHGWHAYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHV  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF RP++VL LIH ILFQN+FEIAFFFWI  QY F+SCIMG V +
Sbjct  341  AVEGDLVVKPSDDHFWFHRPRLVLLLIHIILFQNSFEIAFFFWIWAQYHFNSCIMGQVGY  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    
Sbjct  401  IIPRLVIGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----  456

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGG  85
            AA G    G   +  S   VQ+  V  +ES   +G +  A  Q+  
Sbjct  457  AANGSSQVGHKESSPSPMAVQLSQVEIQESAMEEGNARPATNQLNS  502



>ref|XP_010517996.1| PREDICTED: MLO-like protein 15 isoform X1 [Camelina sativa]
Length=503

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 171/200 (86%), Gaps = 4/200 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKH+
Sbjct  273  VVGISWYLWVFVVFFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHI  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKF
Sbjct  333  AVEGDLVVRPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKG  229
            IIPRL+IGV++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++  +KG
Sbjct  393  IIPRLIIGVLVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKG  452

Query  228  LKAAFGGINHGGALTDGSST  169
            +  A  G +HGG+    ++T
Sbjct  453  ITHA--GSSHGGSPNPLAAT  470



>ref|XP_009366270.1| PREDICTED: MLO-like protein 1 [Pyrus x bretschneideri]
Length=546

 Score =   289 bits (739),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  277  VVGISWYLWIFVVIFLLLNVSGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHI  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP++VL L+H ILFQN+FE+AFFFWILVQY F SC+MG + +
Sbjct  337  AIEGDLVVQPSDDHFWFHRPRLVLLLVHIILFQNSFELAFFFWILVQYKFHSCMMGELGY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPRLVIGV +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GLVGWA+ AK+ K L+
Sbjct  397  VIPRLVIGVFVQFVCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLVGWARSAKKNKALR  456



>gb|KFK37229.1| hypothetical protein AALP_AA4G230500 [Arabis alpina]
Length=507

 Score =   286 bits (733),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 143/229 (62%), Positives = 172/229 (75%), Gaps = 11/229 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKHV
Sbjct  273  VVGISWYLWVFVVLFLLLNIAAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHV  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I V+YGFDSCIMG VKF
Sbjct  333  AVEGDLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFLFFIFVEYGFDSCIMGQVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IGV++Q+LCSYSTLP+YA+VTQMG+ FK +IF++  Q  + GWA+ AK  KG+K
Sbjct  393  IIPRLIIGVLVQLLCSYSTLPLYALVTQMGSSFKGAIFNDQTQQQIAGWAKMAK--KGVK  450

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMGGDGS  76
                G  H G     +S G     +      S        LQ + G GS
Sbjct  451  K---GTTHAGTAHASTSHGESPNPLATPSPRSVQ------LQSLLGKGS  490



>ref|XP_010913234.1| PREDICTED: MLO-like protein 1 isoform X6 [Elaeis guineensis]
Length=355

 Score =   281 bits (719),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH 
Sbjct  107  VVGISWYLWLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHA  166

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              +    V+PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +
Sbjct  167  DEQEAPSVKPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGY  226

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--G  229
            IIPRL+IGV +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G
Sbjct  227  IIPRLIIGVTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPG  286

Query  228  LKAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            + +     +      D S   VQM  +  + S     A   AL+
Sbjct  287  ISSFLKKFSSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  330



>gb|KDO49761.1| hypothetical protein CISIN_1g044857mg, partial [Citrus sinensis]
Length=387

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 165/214 (77%), Gaps = 10/214 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++ WH YFWI+FIPFILLLAVGTKLEH+I QLAHEVAEKHV
Sbjct  168  VVGISWYLWVFVVVFLLLNVHNWHAYFWISFIPFILLLAVGTKLEHIITQLAHEVAEKHV  227

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L V+PSD+HFWF +P++VL LIH ILFQN+          VQY F SCIMG   +
Sbjct  228  AIEGDLYVKPSDDHFWFRKPRLVLVLIHIILFQNS----------VQYKFHSCIMGPYGY  277

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IG+ +Q  CSYSTLP+YAIVTQMG+ FKKSIFDEHIQ GLVGWA++AK+  GL+
Sbjct  278  IIPRLIIGLFVQFFCSYSTLPLYAIVTQMGSSFKKSIFDEHIQEGLVGWAKQAKKNMGLR  337

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
             A    ++     D SS   QM  V  +++ + D
Sbjct  338  KAAAKGSNQVVHKDDSSASTQMTNVQSEQNSAID  371



>ref|XP_010506316.1| PREDICTED: MLO-like protein 15 [Camelina sativa]
Length=499

 Score =   285 bits (729),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 138/226 (61%), Positives = 175/226 (77%), Gaps = 3/226 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFWIAFIP ILLLAVGTKLEH+I  LAH+VAEKH+
Sbjct  273  VVGISWYLWVFVVLFLLLNIAAWHVYFWIAFIPLILLLAVGTKLEHIITDLAHDVAEKHI  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P+++LFLIHFILFQN+FE+A+FF+IL QYG+DSCIMGHVKF
Sbjct  333  AVEGDLVVRPSDDLFWFQSPRLILFLIHFILFQNSFELAYFFFILFQYGWDSCIMGHVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKG  229
            IIPRL+IG ++Q+LCSYSTLP+YA+VTQMG+ +K +IF+E  Q  LVGWA+ A++  +KG
Sbjct  393  IIPRLIIGALVQLLCSYSTLPLYALVTQMGSSYKGAIFNEQTQQQLVGWAKTARKEVKKG  452

Query  228  LKAAFGGINHGGALTDGSSTGVQ-MGGVGRKESGSTDGASVRALQQ  94
               A    N   A     S  +Q + G G  +     G +   +++
Sbjct  453  TTHAGSSPNPLAATPSPRSVQLQSLLGKGSSQQNQHLGKTSEIVEK  498



>ref|XP_009413424.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=490

 Score =   283 bits (725),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 160/197 (81%), Gaps = 3/197 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISW LW+FV+IFLLLN+ GWH YFWI+F+P +LLLA+GTKLEH+I QLA EVAEKH 
Sbjct  272  VVGISWQLWIFVMIFLLLNVEGWHAYFWISFLPLVLLLAIGTKLEHIITQLAQEVAEKHS  331

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSD  FWF RPQIV+FLIHFILFQNAFEIA+FFWIL  YGFDSCIMG V F
Sbjct  332  AIEGDLVVTPSDHLFWFHRPQIVIFLIHFILFQNAFEIAYFFWILTTYGFDSCIMGEVGF  391

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRLVI V+ Q+LCSYSTLP+YAIVTQMG+ F K+IFD ++Q GL+ WA+ AK+ K  +
Sbjct  392  IVPRLVISVLSQLLCSYSTLPLYAIVTQMGSFFNKAIFDANVQAGLLDWARGAKKNKKTR  451

Query  222  AAFGGINHGGALTDGSS  172
               G      + T+G+ 
Sbjct  452  IVNG---ENASRTEGAE  465



>ref|XP_009620916.1| PREDICTED: MLO-like protein 1 [Nicotiana tomentosiformis]
Length=313

 Score =   278 bits (710),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 172/217 (79%), Gaps = 4/217 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++GWHTYFWIAF+PF LLLAVGTKLEHVI QLA EVA KHV
Sbjct  86   VVGISWYLWVFVVLFLLLNVHGWHTYFWIAFVPFGLLLAVGTKLEHVITQLAGEVAAKHV  145

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF RP+IVL LIH IL QN+FEIAFFFWI  QY F+SCIMG V +
Sbjct  146  AVEGDLVVKPSDDHFWFHRPRIVLLLIHIILIQNSFEIAFFFWIWAQYHFNSCIMGQVGY  205

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    
Sbjct  206  IIPRLVIGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----  261

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            A  G    G   +  S+  VQ+  V  +E    +G +
Sbjct  262  AVNGSSQVGHKESSPSTMAVQLSQVEIQEFALEEGNA  298



>ref|XP_010913230.1| PREDICTED: MLO-like protein 13 isoform X3 [Elaeis guineensis]
Length=461

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH 
Sbjct  213  VVGISWYLWLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHA  272

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              +    V+PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +
Sbjct  273  DEQEAPSVKPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGY  332

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--G  229
            IIPRL+IGV +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G
Sbjct  333  IIPRLIIGVTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPG  392

Query  228  LKAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            + +     +      D S   VQM  +  + S     A   AL+
Sbjct  393  ISSFLKKFSSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  436



>ref|NP_181939.1| MLO-like protein 15 [Arabidopsis thaliana]
 sp|O80580.1|MLO15_ARATH RecName: Full=MLO-like protein 15; Short=AtMlo15 [Arabidopsis 
thaliana]
 gb|AAK53808.1|AF369576_1 membrane protein Mlo15 [Arabidopsis thaliana]
 gb|AAC23431.1| similar to Mlo proteins from H. vulgare [Arabidopsis thaliana]
 gb|AEC10376.1| MLO-like protein 15 [Arabidopsis thaliana]
Length=496

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 172/216 (80%), Gaps = 7/216 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKH+
Sbjct  273  VVGISWYLWVFVVLFLLLNIVAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHI  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FEIA+FF+IL Q+G+DSCIM HVKF
Sbjct  333  AVEGDLVVRPSDDLFWFQSPRLVLFLIHFILFQNSFEIAYFFFILFQFGWDSCIMDHVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPRLVIGVIIQ+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK  +G+K
Sbjct  393  VIPRLVIGVIIQLLCSYSTLPLYALVTQMGSSFKGAIFNEQTQEHLVGWAKMAK--RGVK  450

Query  222  AAFGGINHGGALTDGSS--TGVQMGGVGRKESGSTD  121
                G    G   D +S    +Q+  +  K S   +
Sbjct  451  K---GATQVGTSHDATSPRPSIQLNSLLGKGSSQQN  483



>ref|NP_973686.1| MLO-like protein 15 [Arabidopsis thaliana]
 gb|AEC10377.1| MLO-like protein 15 [Arabidopsis thaliana]
Length=497

 Score =   283 bits (724),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/216 (66%), Positives = 172/216 (80%), Gaps = 7/216 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFW+AFIP ILLLAVGTKLEH+I  LAHEVAEKH+
Sbjct  274  VVGISWYLWVFVVLFLLLNIVAWHVYFWLAFIPLILLLAVGTKLEHIITDLAHEVAEKHI  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FEIA+FF+IL Q+G+DSCIM HVKF
Sbjct  334  AVEGDLVVRPSDDLFWFQSPRLVLFLIHFILFQNSFEIAYFFFILFQFGWDSCIMDHVKF  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPRLVIGVIIQ+LCSYSTLP+YA+VTQMG+ FK +IF+E  Q  LVGWA+ AK  +G+K
Sbjct  394  VIPRLVIGVIIQLLCSYSTLPLYALVTQMGSSFKGAIFNEQTQEHLVGWAKMAK--RGVK  451

Query  222  AAFGGINHGGALTDGSS--TGVQMGGVGRKESGSTD  121
                G    G   D +S    +Q+  +  K S   +
Sbjct  452  K---GATQVGTSHDATSPRPSIQLNSLLGKGSSQQN  484



>gb|ABR16800.1| unknown [Picea sitchensis]
Length=483

 Score =   282 bits (722),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/176 (76%), Positives = 150/176 (85%), Gaps = 0/176 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGIS YLW FVVIFLLLNI GWHTYFWIAFIP ILLLAVG KLEH+I QLA EV EKH 
Sbjct  279  VVGISSYLWGFVVIFLLLNIEGWHTYFWIAFIPLILLLAVGAKLEHIITQLAQEVVEKHT  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+ SDEHFWFG+P++VL+LIHFILFQNAFEI FFFWIL  YGFDSCIMG + +
Sbjct  339  AVEGDLVVRLSDEHFWFGKPKLVLYLIHFILFQNAFEIGFFFWILTTYGFDSCIMGKIAY  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            IIPRL +GVIIQVLCSYSTLP+Y +VTQMGT FK+ I +EHI  GL  W QKAK +
Sbjct  399  IIPRLAVGVIIQVLCSYSTLPLYVLVTQMGTSFKREILNEHIHEGLSVWHQKAKAK  454



>ref|XP_010913229.1| PREDICTED: MLO-like protein 13 isoform X2 [Elaeis guineensis]
Length=501

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH 
Sbjct  253  VVGISWYLWLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHA  312

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              +    V+PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +
Sbjct  313  DEQEAPSVKPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGY  372

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--G  229
            IIPRL+IGV +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G
Sbjct  373  IIPRLIIGVTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPG  432

Query  228  LKAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            + +     +      D S   VQM  +  + S     A   AL+
Sbjct  433  ISSFLKKFSSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  476



>ref|XP_010069191.1| PREDICTED: MLO-like protein 1 isoform X1 [Eucalyptus grandis]
 gb|KCW57460.1| hypothetical protein EUGRSUZ_H00239 [Eucalyptus grandis]
Length=501

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 146/224 (65%), Positives = 172/224 (77%), Gaps = 1/224 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GW  YFWI+FIPF+LLLAVGTKLEHVI QLAHEVAEKH 
Sbjct  279  VVGISWYLWIFVVIFLLLNVHGWQAYFWISFIPFLLLLAVGTKLEHVINQLAHEVAEKHA  338

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVVQPSD+HFWF  P+IVL LIH +LFQNAFE+AFFF+I VQYGFDSCIMG V F
Sbjct  339  AVEGDLVVQPSDDHFWFHSPRIVLLLIHILLFQNAFELAFFFFIWVQYGFDSCIMGQVGF  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV++Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHIQ GL  W Q AK +K  +
Sbjct  399  IIPRLVIGVLVQFMCSYSTLPLYAIVTQMGSSFKKAIFEEHIQEGLSIWTQHAKMKKNAR  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQM  91
                G        D   T    GG   +     D  S++  ++M
Sbjct  459  MTATGTGSTTLPMDPKETSQSHGGPTEEAEIQYD-PSIQGPKEM  501



>ref|XP_010913228.1| PREDICTED: MLO-like protein 13 isoform X1 [Elaeis guineensis]
Length=526

 Score =   283 bits (723),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/224 (60%), Positives = 165/224 (74%), Gaps = 2/224 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH 
Sbjct  278  VVGISWYLWLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHA  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              +    V+PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +
Sbjct  338  DEQEAPSVKPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGY  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--G  229
            IIPRL+IGV +QVLCSYSTLP+YAIVTQMG  FKK+IFDE +++ L GWA+ A++RK  G
Sbjct  398  IIPRLIIGVTVQVLCSYSTLPLYAIVTQMGDMFKKAIFDEQLRLTLHGWAEGARKRKRPG  457

Query  228  LKAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQ  97
            + +     +      D S   VQM  +  + S     A   AL+
Sbjct  458  ISSFLKKFSSKSKRQDKSGNEVQMQTMASEASAVIPNALPAALE  501



>ref|XP_007026460.1| Seven transmembrane MLO family protein [Theobroma cacao]
 gb|EOY06962.1| Seven transmembrane MLO family protein [Theobroma cacao]
Length=491

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV FLLLNI+GWH YFWIAFIPF+LLLAVGT+LEHVI QLAHEVAEKHV
Sbjct  277  VVGISWYLWLFVVAFLLLNIHGWHAYFWIAFIPFMLLLAVGTQLEHVITQLAHEVAEKHV  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RPQIVL LIH ILFQN+FE+A FFWILVQY FDSCIMG V +
Sbjct  337  AIEGDLVVQPSDDHFWFHRPQIVLLLIHIILFQNSFELACFFWILVQYHFDSCIMGEVGY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            +IPRLVIGVI+Q LCSYSTLP+YAIVTQMG+ FKK+IF+EH+Q G+  WA++AK +
Sbjct  397  VIPRLVIGVIVQFLCSYSTLPLYAIVTQMGSSFKKAIFEEHVQEGIAIWARRAKSK  452



>gb|KDO49429.1| hypothetical protein CISIN_1g0104501mg, partial [Citrus sinensis]
Length=379

 Score =   277 bits (708),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+
Sbjct  232  VVGISWYLWIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHI  291

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +
Sbjct  292  AIEGELVVQPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCY  351

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQ  319
            I+PRL+IGV IQVLCSYSTLP+YAIVTQ
Sbjct  352  IVPRLIIGVFIQVLCSYSTLPLYAIVTQ  379



>ref|XP_009615189.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana tomentosiformis]
Length=504

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 173/217 (80%), Gaps = 4/217 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++GWHTYFWIAF+PF LL+ VGTKLEHVI QLA EVA KH+
Sbjct  277  VVGISWYLWVFVVLFLLLNVHGWHTYFWIAFVPFGLLVGVGTKLEHVITQLAGEVAAKHI  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF RP+IVL LIH ILFQN+FEIAFFFWI  QY F+SCIMG V +
Sbjct  337  AVEGDLVVKPSDDHFWFHRPRIVLLLIHIILFQNSFEIAFFFWIWAQYHFNSCIMGQVGY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    
Sbjct  397  IIPRLVIGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----  452

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            A  G    G   +  S+  VQ+  V  +ES   +G +
Sbjct  453  AVNGSSQVGHKESSPSTMAVQLSQVEIQESAMEEGNA  489



>ref|XP_009615188.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana tomentosiformis]
Length=508

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 148/217 (68%), Positives = 173/217 (80%), Gaps = 4/217 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLN++GWHTYFWIAF+PF LL+ VGTKLEHVI QLA EVA KH+
Sbjct  281  VVGISWYLWVFVVLFLLLNVHGWHTYFWIAFVPFGLLVGVGTKLEHVITQLAGEVAAKHI  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFWF RP+IVL LIH ILFQN+FEIAFFFWI  QY F+SCIMG V +
Sbjct  341  AVEGDLVVKPSDDHFWFHRPRIVLLLIHIILFQNSFEIAFFFWIWAQYHFNSCIMGQVGY  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q LCSYSTLP+YAIVTQMG+ FKK IFDEHIQ GLV WA+KAK+R    
Sbjct  401  IIPRLVIGVFVQFLCSYSTLPLYAIVTQMGSSFKKEIFDEHIQDGLVFWAKKAKRR----  456

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            A  G    G   +  S+  VQ+  V  +ES   +G +
Sbjct  457  AVNGSSQVGHKESSPSTMAVQLSQVEIQESAMEEGNA  493



>gb|KDO49428.1| hypothetical protein CISIN_1g0104501mg, partial [Citrus sinensis]
Length=437

 Score =   277 bits (709),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/148 (89%), Positives = 141/148 (95%), Gaps = 0/148 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLNIN WHTYFWIAFIPFILLLAVG KLEHVI QLAHEVAEKH+
Sbjct  290  VVGISWYLWIFVVIFLLLNINEWHTYFWIAFIPFILLLAVGAKLEHVISQLAHEVAEKHI  349

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVVQPSD+HFWF RPQIVLFLIHFILFQN+FEIAFFFWIL+QYGFDSCIMG V +
Sbjct  350  AIEGELVVQPSDQHFWFNRPQIVLFLIHFILFQNSFEIAFFFWILIQYGFDSCIMGQVCY  409

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQ  319
            I+PRL+IGV IQVLCSYSTLP+YAIVTQ
Sbjct  410  IVPRLIIGVFIQVLCSYSTLPLYAIVTQ  437



>ref|XP_004287195.1| PREDICTED: MLO-like protein 15 [Fragaria vesca subsp. vesca]
Length=536

 Score =   280 bits (716),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/178 (75%), Positives = 159/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAF+PFILLLAVGTKLEHVIIQLAH+VAEKH+
Sbjct  292  VVGISWYLWMFVVLFLLLNVAGWHAYFWIAFVPFILLLAVGTKLEHVIIQLAHDVAEKHI  351

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP++VL LIH ILFQN+FE+A FFWI +QY FDSC+MG + +
Sbjct  352  AIEGDLVVQPSDDHFWFRRPRLVLLLIHIILFQNSFELALFFWIWIQYKFDSCMMGKIGY  411

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            +IPRLVIG  +Q +CSYSTLP+YAIVTQMGT FK +IFDEH+QVGL GWA+ AK+ + 
Sbjct  412  VIPRLVIGAFVQFVCSYSTLPLYAIVTQMGTSFKNAIFDEHVQVGLAGWAKSAKKHQA  469



>ref|XP_010040938.1| PREDICTED: MLO-like protein 1, partial [Eucalyptus grandis]
Length=309

 Score =   273 bits (697),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 168/208 (81%), Gaps = 11/208 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWI+FIP  LLLAVGTKLEHVI +LA +VA++H+
Sbjct  93   VVGISWYLWLFVVVFLLLNVAGWHAYFWISFIPLTLLLAVGTKLEHVITRLAQDVAQRHI  152

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVVQPSD+HFWF RP+++L LIH ILFQN+FE+AF  +IL++Y F  CIMG V F
Sbjct  153  AIAGDLVVQPSDDHFWFHRPRLILVLIHIILFQNSFELAFLLFILIRYKFKYCIMGEVHF  212

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q+LCSYSTLP+YAIVTQMGT FKK+IFDEHIQ GLVGWA++AK+   L+
Sbjct  213  IIPRLVIGVFVQLLCSYSTLPLYAIVTQMGTSFKKAIFDEHIQQGLVGWARQAKKNHNLR  272

Query  222  AAFGGINHGGALTDGSS--TGVQMGGVG  145
                        TDGSS  TG + G VG
Sbjct  273  K---------TATDGSSVQTGSKQGLVG  291



>ref|XP_004242449.1| PREDICTED: MLO-like protein 1 [Solanum lycopersicum]
Length=511

 Score =   279 bits (714),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 169/212 (80%), Gaps = 7/212 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLLNINGWHTYFWIAF PFILLL+VGTKLEHVI+QLAHE+AEKHV
Sbjct  300  VVGISWYLWIFVILFLLLNINGWHTYFWIAFFPFILLLSVGTKLEHVILQLAHEIAEKHV  359

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV PSD HFWF  PQI+L LIHFILFQNAFEIAFFFWIL QYGF SCIMG   F
Sbjct  360  AIEGELVVTPSDNHFWFDNPQIILLLIHFILFQNAFEIAFFFWILFQYGFHSCIMGKYVF  419

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ-----  238
            +IPRLVIGVIIQVLCSYSTLP+YA+VTQMG+H+KKS+FD H+Q  LV WA+K K+     
Sbjct  420  VIPRLVIGVIIQVLCSYSTLPLYALVTQMGSHYKKSMFDNHVQTCLVEWAEKVKKKKGHK  479

Query  237  --RKGLKAAFGGINHGGALTDGSSTGVQMGGV  148
              R G   +  G     +L+      +   GV
Sbjct  480  YGRDGSTRSNDGSVVAASLSVNDHKDLPQNGV  511



>gb|KGN46257.1| hypothetical protein Csa_6G078520 [Cucumis sativus]
Length=464

 Score =   278 bits (710),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FL LN++GWHTYFWIAFIPF+LLLAVGTKLEHVI QLAHEVAEKH+
Sbjct  292  VVGISWYLWIFVVVFLFLNVSGWHTYFWIAFIPFVLLLAVGTKLEHVITQLAHEVAEKHI  351

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+HFWF RP+IVLFLIHFILFQNAFEI FFFWI VQYGFDSCIMG V++
Sbjct  352  AIEGDLVVQPSDDHFWFQRPRIVLFLIHFILFQNAFEIGFFFWIWVQYGFDSCIMGQVRY  411

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQ  274
            IIPRL+IGV +QVLCSYSTLP+YAIVTQ+G   +K+   + I+
Sbjct  412  IIPRLIIGVFVQVLCSYSTLPLYAIVTQLGNVMRKASAPQEIK  454



>ref|XP_002441108.1| hypothetical protein SORBIDRAFT_09g020560 [Sorghum bicolor]
 gb|EES19538.1| hypothetical protein SORBIDRAFT_09g020560 [Sorghum bicolor]
Length=458

 Score =   277 bits (708),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 125/178 (70%), Positives = 156/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFL LN++GWH YFWI+F+P ILLLAVGTKLEH+I +L H+VA+KH 
Sbjct  281  VVGISWYLWIFVVIFLFLNVDGWHVYFWISFLPLILLLAVGTKLEHIIAELVHDVAKKHT  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIE +++V+PSDEHFWFG+P+I+L+LIHFILFQN+FEIAFFFWIL  YGFDSCIM  V F
Sbjct  341  AIEDDVIVKPSDEHFWFGKPRIILYLIHFILFQNSFEIAFFFWILTTYGFDSCIMESVGF  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            I  RLV+GV+IQ++CSY TLP+YAIVTQMG+ +KK IF++H+Q G++ WA+K K R G
Sbjct  401  IATRLVMGVVIQLICSYVTLPLYAIVTQMGSCYKKEIFNDHVQKGVLVWAEKVKTRGG  458



>emb|CDP19084.1| unnamed protein product [Coffea canephora]
Length=537

 Score =   279 bits (713),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 172/214 (80%), Gaps = 15/214 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWHTYFWI+FIPF LLLAVGTKLEHVI QLA EVAEKHV
Sbjct  288  VVGISWYLWLFVVLFLLLNVYGWHTYFWISFIPFALLLAVGTKLEHVISQLAQEVAEKHV  347

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++GELVV+PSD+HFWF RP++VL LIH ILFQNAFEIA FFW   QY FDSCIMG V F
Sbjct  348  AVQGELVVRPSDDHFWFNRPKLVLHLIHIILFQNAFEIAIFFWTWAQYKFDSCIMGAVGF  407

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPRLV+G  +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EH+Q GLVGWAQKA++ KG++
Sbjct  408  VIPRLVLGAFVQFICSYSTLPLYAIVTQMGSTFKKAIFEEHVQEGLVGWAQKARKNKGMR  467

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
                       + + SST      VG KES S +
Sbjct  468  ----------KVVNASST-----QVGPKESPSVE  486



>ref|XP_007208676.1| hypothetical protein PRUPE_ppa024581mg [Prunus persica]
 gb|EMJ09875.1| hypothetical protein PRUPE_ppa024581mg [Prunus persica]
Length=463

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 140/209 (67%), Positives = 170/209 (81%), Gaps = 4/209 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+ GWH+YFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKHV
Sbjct  250  VVGISWYLWIFVVIFLLLNVWGWHSYFWIAFIPLILLLAVGTKLEHVITQLANEVAEKHV  309

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD  FWF RP+++LFLIH ILFQN+F++A+FFW+  QY FDSCIMG V +
Sbjct  310  AIEGDLVVQPSDNQFWFHRPRLILFLIHIILFQNSFQLAYFFWLWYQYSFDSCIMGKVAY  369

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IG  IQ +CSYST P+YAIVTQMG+ FKK+IF+EHIQ GL+GWA+ AK+ K L+
Sbjct  370  IIPRLIIGAFIQFVCSYSTFPLYAIVTQMGSSFKKAIFEEHIQEGLIGWARSAKRNKPLR  429

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKE  136
                 ++   A    + + V++G  G  E
Sbjct  430  R----VDPKEACATVNESSVEVGTTGEIE  454



>ref|XP_011005242.1| PREDICTED: MLO-like protein 1 [Populus euphratica]
Length=480

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  273  VVGISWYLWLFVVLFLLLNVAGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHV  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++G+LVV PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI +QYGFDSCIMG V +
Sbjct  333  AVQGDLVVHPSDDHFWFNKPKIVLILIHIILFQNSFEMAFFFWIWLQYGFDSCIMGQVSY  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  IQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWA++AK++  L+
Sbjct  393  IIPRLVIGAFIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAKQAKKKTVLR  452

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK  139
             A     H   +    S  +QM   G K
Sbjct  453  KAANESTHNQVVHREESPLIQMAKAGSK  480



>ref|XP_002523965.1| calmodulin binding protein, putative [Ricinus communis]
 gb|EEF38333.1| calmodulin binding protein, putative [Ricinus communis]
Length=458

 Score =   275 bits (703),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+NGWHTYFWIAFIPF LLLAVGTKLEHVI QLAH+VAEKHV
Sbjct  287  VVGISWYLWIFVVVFLLLNVNGWHTYFWIAFIPFALLLAVGTKLEHVISQLAHDVAEKHV  346

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L+V+PSD+HFWF +P IVLF IHFILFQNAFEIAFFFWI VQYGFDSCIMG VK+
Sbjct  347  AIEGDLIVKPSDDHFWFHKPHIVLFFIHFILFQNAFEIAFFFWIWVQYGFDSCIMGQVKY  406

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQ  274
            I+PRL+IGV IQ+LCSYSTLP+YAIVTQ+G   + +   E IQ
Sbjct  407  IVPRLIIGVFIQILCSYSTLPLYAIVTQLGRIGRNASTPEEIQ  449



>ref|XP_002309708.1| hypothetical protein POPTR_0007s00240g [Populus trichocarpa]
 gb|EEE90158.1| hypothetical protein POPTR_0007s00240g [Populus trichocarpa]
Length=481

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+FLLLN+ GWH YFWIAFIPFILLLAVGTKLEHVI QLAHEVAEKHV
Sbjct  274  VVGISWYLWLFVVLFLLLNVAGWHAYFWIAFIPFILLLAVGTKLEHVISQLAHEVAEKHV  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A++G+LVV PSD+HFWF +P+IVL LIH ILFQN+FE+AFFFWI +QYGFDSCIMG V +
Sbjct  334  AVQGDLVVHPSDDHFWFNKPKIVLILIHIILFQNSFEMAFFFWIWLQYGFDSCIMGQVSY  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIG  IQ+LCSYSTLP+YAIVTQMG+ FKK+IFDEH+Q GLVGWA++AK++  L+
Sbjct  394  IIPRLVIGAFIQLLCSYSTLPLYAIVTQMGSSFKKAIFDEHVQEGLVGWAKQAKKKTVLR  453

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK  139
             A     H   +    S  +QM   G K
Sbjct  454  KAANESTHNQVVHREESPLIQMAKAGSK  481



>gb|EMT27451.1| MLO-like protein 1 [Aegilops tauschii]
Length=573

 Score =   278 bits (711),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 158/220 (72%), Gaps = 39/220 (18%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WYLW+FVVIF+LLN+NGWHTYFWI+F+P ILLLAVGTKLEHVI QLAH+VAEKH 
Sbjct  334  VVGIRWYLWIFVVIFMLLNVNGWHTYFWISFLPLILLLAVGTKLEHVIAQLAHDVAEKHS  393

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSDEHFW G+P+++L+LIHFILFQNAFEIA FFWIL  YGF+SCIM HV F
Sbjct  394  AIEGDLVVNPSDEHFWCGKPRVILYLIHFILFQNAFEIALFFWILTTYGFNSCIMDHVPF  453

Query  402  IIPRLVIG---------------------------------------VIIQVLCSYSTLP  340
            I+PRLVIG                                       V+IQ+LCSYSTLP
Sbjct  454  IVPRLVIGWVAIHRLTLLIMKKKKQANSHVFQVQAQRQLLVLPFACRVVIQLLCSYSTLP  513

Query  339  IYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKA  220
            +YAIV QMGT F K IFDEHIQ GLVG  +  + R+ L A
Sbjct  514  LYAIVAQMGTFFNKEIFDEHIQQGLVGRGRTHQARRVLPA  553



>ref|XP_006857534.1| hypothetical protein AMTR_s00061p00034560 [Amborella trichopoda]
 gb|ERN19001.1| hypothetical protein AMTR_s00061p00034560 [Amborella trichopoda]
Length=528

 Score =   276 bits (707),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 152/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW FVVIFLLLNI+GWHTYFWI+F+P ILLLAVGTKLEH+I +LA EV EK  
Sbjct  291  VVGISWYLWAFVVIFLLLNIDGWHTYFWISFLPLILLLAVGTKLEHIITRLAQEVEEKWK  350

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
                ELVV+PSDEHFWF RP  VL+LIHFILFQN+FEIAFFFWI   YGFDSCIM  V +
Sbjct  351  PGLEELVVKPSDEHFWFDRPNAVLYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMEKVGY  410

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK  232
            I+PRL+ GVIIQVLCSYSTLP+YA+VTQMG+ FK +IF EH+Q+GL+GWA+ AK+++
Sbjct  411  IVPRLIFGVIIQVLCSYSTLPLYALVTQMGSTFKSAIFHEHMQLGLLGWAENAKKKR  467



>ref|XP_008227254.1| PREDICTED: MLO-like protein 1 [Prunus mume]
Length=463

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 171/209 (82%), Gaps = 4/209 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+ GWH+YFWIAFIP ILLLAVGTKLEHVI QLA+EVAEKH+
Sbjct  250  VVGISWYLWIFVVIFLLLNVWGWHSYFWIAFIPLILLLAVGTKLEHVITQLANEVAEKHI  309

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVVQPSD+ FWF RP+++LFLIH ILFQN+F++A+FFW+  QY FDSCIMG V +
Sbjct  310  AIEGDLVVQPSDDQFWFHRPRLILFLIHIILFQNSFQLAYFFWLWYQYSFDSCIMGKVGY  369

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRL+IG  IQ +CSYST P+YAIVTQMG+ FKK+IF+EHIQ GL+GWA+ AK+ K L+
Sbjct  370  IIPRLIIGAFIQFVCSYSTFPLYAIVTQMGSSFKKAIFEEHIQEGLIGWARSAKRNKPLR  429

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKE  136
                 ++   A    + + V++G  G  E
Sbjct  430  R----VDPKEACVTVNESSVEVGTTGEIE  454



>ref|XP_009794451.1| PREDICTED: MLO-like protein 1 isoform X2 [Nicotiana sylvestris]
Length=430

 Score =   271 bits (694),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/149 (88%), Positives = 140/149 (94%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHE+AEKHV
Sbjct  282  VVGISWYLWIFVILFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEIAEKHV  341

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EGELVVQPSD HFWF RPQIVLFLIHFILFQNAFEIAFFFWIL QYGF SCIMG   F
Sbjct  342  AVEGELVVQPSDSHFWFDRPQIVLFLIHFILFQNAFEIAFFFWILFQYGFYSCIMGKYVF  401

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQM  316
            + PRLVIGV IQVLCSYSTLP+YA+VTQ+
Sbjct  402  VAPRLVIGVFIQVLCSYSTLPLYALVTQL  430



>ref|XP_010054950.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=506

 Score =   273 bits (698),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 161/208 (77%), Gaps = 0/208 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN  GWH YFWI+FIPF+LLLAVGTKLEHVI QLA +VAEKH 
Sbjct  284  VVGISWYLWIFVVIFLLLNYAGWHAYFWISFIPFLLLLAVGTKLEHVINQLAQDVAEKHA  343

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVVQPSD+HFWF RP+IVL LIH +LFQNAFE+AFFF+I VQY  DSCIMG V F
Sbjct  344  AVEGDLVVQPSDDHFWFHRPRIVLLLIHILLFQNAFELAFFFFICVQYSSDSCIMGQVGF  403

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHI  GL  W Q AK +K  +
Sbjct  404  IIPRLVIGVSVQFMCSYSTLPLYAIVTQMGSSFKKAIFEEHIHEGLSVWTQHAKMKKNAR  463

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK  139
                G        D   T   +G   ++
Sbjct  464  MTATGTGSTTLPVDPKVTSQSLGEPTKE  491



>ref|XP_010251437.1| PREDICTED: MLO-like protein 1 isoform X1 [Nelumbo nucifera]
 ref|XP_010251438.1| PREDICTED: MLO-like protein 1 isoform X1 [Nelumbo nucifera]
Length=484

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 169/216 (78%), Gaps = 8/216 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WYLW+FV IFLLLN++GW+TYFW+AFIPFILLL VGTKLE+VI QLAH+VAEKH 
Sbjct  276  VVGIRWYLWLFVFIFLLLNVHGWNTYFWLAFIPFILLLVVGTKLEYVITQLAHKVAEKHY  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSD+ FWF +P+IVL LIH ILFQN+FEIA FFWI VQYGF SCIMGH+ +
Sbjct  336  AIEGDLVVTPSDDLFWFRKPKIVLLLIHLILFQNSFEIALFFWIWVQYGFKSCIMGHIGY  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I PRLVIG  +QVLCSYSTLP+YAIVTQMG+H+K +IF+EHIQ  L+ WA+KAK+++ + 
Sbjct  396  IFPRLVIGGFVQVLCSYSTLPLYAIVTQMGSHYKMAIFEEHIQHTLLNWAEKAKRKQRVA  455

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGA  115
                        T   + GVQ+G    KES   +G 
Sbjct  456  PDLS--------TGKPTEGVQLGKTRSKESEMEEGK  483



>ref|XP_010251439.1| PREDICTED: MLO-like protein 1 isoform X2 [Nelumbo nucifera]
Length=477

 Score =   270 bits (691),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 140/216 (65%), Positives = 169/216 (78%), Gaps = 8/216 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WYLW+FV IFLLLN++GW+TYFW+AFIPFILLL VGTKLE+VI QLAH+VAEKH 
Sbjct  269  VVGIRWYLWLFVFIFLLLNVHGWNTYFWLAFIPFILLLVVGTKLEYVITQLAHKVAEKHY  328

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSD+ FWF +P+IVL LIH ILFQN+FEIA FFWI VQYGF SCIMGH+ +
Sbjct  329  AIEGDLVVTPSDDLFWFRKPKIVLLLIHLILFQNSFEIALFFWIWVQYGFKSCIMGHIGY  388

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I PRLVIG  +QVLCSYSTLP+YAIVTQMG+H+K +IF+EHIQ  L+ WA+KAK+++ + 
Sbjct  389  IFPRLVIGGFVQVLCSYSTLPLYAIVTQMGSHYKMAIFEEHIQHTLLNWAEKAKRKQRVA  448

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGA  115
                        T   + GVQ+G    KES   +G 
Sbjct  449  PDLS--------TGKPTEGVQLGKTRSKESEMEEGK  476



>gb|EMT10343.1| MLO-like protein 1 [Aegilops tauschii]
Length=526

 Score =   271 bits (693),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 165/204 (81%), Gaps = 2/204 (1%)
 Frame = -2

Query  714  LLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVVQPSDEHFW  535
            L N NGWHTYFWIAFIP ILLLAVGTKLEHVI QLA +VAEKH A+EG+L+V+PSD+HFW
Sbjct  324  LANGNGWHTYFWIAFIPLILLLAVGTKLEHVIAQLAQDVAEKHSAVEGDLIVKPSDDHFW  383

Query  534  FGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVIIQVLCS  355
            FGRP+I+LFLIHFILFQNAFEIAFFFWIL  YGF+SCIMG V FI+PRLVIG+IIQ+LCS
Sbjct  384  FGRPRIILFLIHFILFQNAFEIAFFFWILTTYGFNSCIMGQVGFIVPRLVIGLIIQLLCS  443

Query  354  YSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHGGALTD-G  178
            YSTLP+YAIVTQMG+ +KK IF+EH+Q G++GWAQKAK +KG K + G       +   G
Sbjct  444  YSTLPLYAIVTQMGSFYKKEIFNEHVQQGVLGWAQKAKMKKGFKKSNGAAQSTSPVDSVG  503

Query  177  SSTGVQMGGVGRKESGSTDGASVR  106
             ST V+M     +E G+  G S+ 
Sbjct  504  PSTKVEMVRRPARE-GNDAGESIE  526



>ref|XP_009399302.1| PREDICTED: MLO-like protein 1 [Musa acuminata subsp. malaccensis]
Length=495

 Score =   265 bits (676),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 167/204 (82%), Gaps = 5/204 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISW+LW +V+IFLLLNINGWHTYFWIAF+P ILLL+VGTKLEHVI ++AH VAEK+ 
Sbjct  289  VVGISWHLWAYVIIFLLLNINGWHTYFWIAFVPLILLLSVGTKLEHVITEIAHNVAEKYF  348

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+L+V PSD++FWF RP+I+LFLIH ILFQNAF+IAF FW+   YG DSCI  H  F
Sbjct  349  AIGGDLIVMPSDDYFWFHRPRILLFLIHLILFQNAFDIAFIFWLFTPYGLDSCITDHFGF  408

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             +PRLVIG+I+Q+LCSYSTLP+YAIVTQMGTHFKK++FD++++ GL  WAQKAK+R  LK
Sbjct  409  AVPRLVIGIIVQILCSYSTLPLYAIVTQMGTHFKKTVFDDNVRGGLEDWAQKAKKRLSLK  468

Query  222  A--AFGGINHGGALTDGSSTGVQM  157
                FGG ++G      SS  ++M
Sbjct  469  EDNEFGGSSNG---RKESSKTMEM  489



>ref|XP_008649648.1| PREDICTED: MLO-like protein 1 isoform X2 [Zea mays]
Length=466

 Score =   263 bits (672),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 145/162 (90%), Gaps = 0/162 (0%)
 Frame = -2

Query  708  NINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVVQPSDEHFWFG  529
             +NG H YFWIAF+P +LLLAVGTKLEHVI QLA++VAEK  AIEG+LVV PSD+HFWFG
Sbjct  290  RLNGLHAYFWIAFLPLVLLLAVGTKLEHVIAQLAYDVAEKQTAIEGDLVVTPSDQHFWFG  349

Query  528  RPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVIIQVLCSYS  349
            RP+I+L LIHFILFQNAFE+AFFFWIL+ YG +SC M H+ F++PRLV+GV+IQ+LCSYS
Sbjct  350  RPRIILHLIHFILFQNAFELAFFFWILMTYGLESCFMDHIGFLVPRLVLGVVIQLLCSYS  409

Query  348  TLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            TLP+YAIVTQMG+++KK IF+EH+Q G++GWAQKAK+R G+K
Sbjct  410  TLPLYAIVTQMGSYYKKEIFNEHVQQGVLGWAQKAKKRSGVK  451



>ref|XP_008649647.1| PREDICTED: MLO-like protein 1 isoform X1 [Zea mays]
Length=467

 Score =   263 bits (671),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 11/180 (6%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            +VG SW+LW+FVVIFLLLN+N              LLLAVGTKLEHVI QLA++VAEK  
Sbjct  284  IVGTSWHLWIFVVIFLLLNVNA-----------STLLLAVGTKLEHVIAQLAYDVAEKQT  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSD+HFWFGRP+I+L LIHFILFQNAFE+AFFFWIL+ YG +SC M H+ F
Sbjct  333  AIEGDLVVTPSDQHFWFGRPRIILHLIHFILFQNAFELAFFFWILMTYGLESCFMDHIGF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            ++PRLV+GV+IQ+LCSYSTLP+YAIVTQMG+++KK IF+EH+Q G++GWAQKAK+R G+K
Sbjct  393  LVPRLVLGVVIQLLCSYSTLPLYAIVTQMGSYYKKEIFNEHVQQGVLGWAQKAKKRSGVK  452



>ref|XP_006441978.1| hypothetical protein CICLE_v10023336mg, partial [Citrus clementina]
 gb|ESR55218.1| hypothetical protein CICLE_v10023336mg, partial [Citrus clementina]
Length=474

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 153/185 (83%), Gaps = 0/185 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISW+LWV V+IFLL N+   H YFWI+F+P ILL+ VGTKL+H++ QLA +VAEKH+
Sbjct  286  VVGISWHLWVIVIIFLLANVQDLHAYFWISFVPLILLICVGTKLQHILTQLAQDVAEKHM  345

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFW  +P++VL LIH ILFQN+FE+A FFWILVQYGF SCIMG V++
Sbjct  346  AVEGDLVVKPSDDHFWLHKPKLVLTLIHIILFQNSFELAVFFWILVQYGFHSCIMGSVEY  405

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +QVLCSYS LP+YAIV QMG+ FKK+IF E+IQ GL+ WA+KA++    +
Sbjct  406  IIPRLVIGVFVQVLCSYSILPLYAIVVQMGSKFKKAIFKENIQEGLIHWAKKARKNIERR  465

Query  222  AAFGG  208
                G
Sbjct  466  NRLDG  470



>ref|XP_011460878.1| PREDICTED: MLO-like protein 1 isoform X2 [Fragaria vesca subsp. 
vesca]
Length=485

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VV ISWYLW+FVV+FLLLN+ GWH YFW +F+PF LLLAVGTKLEHVIIQLAH+VA+KH+
Sbjct  238  VVRISWYLWIFVVLFLLLNVAGWHIYFWTSFVPFFLLLAVGTKLEHVIIQLAHDVADKHM  297

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFW  RP++VL LIH ILFQN+FE+AF FWI VQY FDSC+MG + +
Sbjct  298  AIEGDLVVRPSDDHFWLRRPRLVLLLIHIILFQNSFELAFCFWIWVQYNFDSCMMGKIGY  357

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            +IPRLVIGV +Q +CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GLVGWA+ A++ + 
Sbjct  358  VIPRLVIGVFVQFVCSYSTLPLYAIVTQMGTSFKKAIFDEHVQEGLVGWAKSARKHQA  415



>ref|XP_006478540.1| PREDICTED: MLO-like protein 1-like [Citrus sinensis]
Length=498

 Score =   261 bits (667),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 152/185 (82%), Gaps = 0/185 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGIS +LWV VVIFLL N+   H YFWI+F+P ILL+ VGTKL+H++ QLA +VAEKH+
Sbjct  286  VVGISRHLWVIVVIFLLANVQDLHAYFWISFVPLILLICVGTKLQHILTQLAQDVAEKHM  345

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+HFW  +P++VL LIH ILFQN+FE+A FFWILVQYGF SCIMG V++
Sbjct  346  AVEGDLVVKPSDDHFWLHKPKLVLTLIHIILFQNSFELAVFFWILVQYGFHSCIMGSVEY  405

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +QVLCSYS LP+YAIV QMG+ FKK+IF E+IQ GL+ WA+KA++    +
Sbjct  406  IIPRLVIGVFVQVLCSYSILPLYAIVVQMGSKFKKAIFKENIQEGLIHWAKKARKNNERR  465

Query  222  AAFGG  208
                G
Sbjct  466  NRLDG  470



>ref|XP_010066114.1| PREDICTED: MLO-like protein 1 [Eucalyptus grandis]
Length=491

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 164/208 (79%), Gaps = 11/208 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            V+GISWYLW+FV +FLLL++ GWH +FWI+FIP  LLLAVGTKLEHVI +LA +VA++H+
Sbjct  250  VIGISWYLWLFVAVFLLLSVAGWHAHFWISFIPLTLLLAVGTKLEHVITRLAQDVAQRHI  309

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVVQPSD+HFWF RP ++L LIH ILFQN+FE+AF  +I ++Y  +SC+M  + F
Sbjct  310  AIAGDLVVQPSDDHFWFHRPCLILVLIHIILFQNSFELAFLLFISIRYKLNSCMMREIHF  369

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q+LCSYSTLP+YAIVTQMGT FKK+IFDEHIQ GLVGWAQ+AK+   L+
Sbjct  370  IIPRLVIGVFVQLLCSYSTLPLYAIVTQMGTSFKKAIFDEHIQQGLVGWAQQAKKNNNLR  429

Query  222  AAFGGINHGGALTDGSS--TGVQMGGVG  145
                        TDGSS  T  + G VG
Sbjct  430  K---------PATDGSSVQTSSKQGLVG  448



>ref|XP_004294225.1| PREDICTED: MLO-like protein 15 isoform X1 [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   261 bits (667),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VV ISWYLW+FVV+FLLLN+ GWH YFW +F+PF LLLAVGTKLEHVIIQLAH+VA+KH+
Sbjct  277  VVRISWYLWIFVVLFLLLNVAGWHIYFWTSFVPFFLLLAVGTKLEHVIIQLAHDVADKHM  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV+PSD+HFW  RP++VL LIH ILFQN+FE+AF FWI VQY FDSC+MG + +
Sbjct  337  AIEGDLVVRPSDDHFWLRRPRLVLLLIHIILFQNSFELAFCFWIWVQYNFDSCMMGKIGY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            +IPRLVIGV +Q +CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GLVGWA+ A++ + 
Sbjct  397  VIPRLVIGVFVQFVCSYSTLPLYAIVTQMGTSFKKAIFDEHVQEGLVGWAKSARKHQA  454



>ref|XP_011469571.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=463

 Score =   259 bits (661),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 148/191 (77%), Gaps = 4/191 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV FLL+NI+G H YFW+AFIPF LLLA GTKL+H+I QLAHEVAEKHV
Sbjct  270  VVGISWYLWIFVVFFLLINIDGVHAYFWLAFIPFFLLLATGTKLQHIITQLAHEVAEKHV  329

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+L+V+PSD+HFWFGRP  VLFLIHFILFQNAFE+AFF WI  QYGF SCIMG  ++
Sbjct  330  AVEGDLLVKPSDQHFWFGRPSFVLFLIHFILFQNAFEMAFFLWIWAQYGFRSCIMGKAEY  389

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDE----HIQVGLVGWAQKAKQR  235
            I PR++IG  IQ L SYSTLP+YAIVTQMG++FKK IF E      +     W+  A +R
Sbjct  390  IFPRILIGTFIQFLTSYSTLPLYAIVTQMGSNFKKEIFVEGSVHTTRRNQSNWSHIATRR  449

Query  234  KGLKAAFGGIN  202
            K      G + 
Sbjct  450  KTSPDGNGEVQ  460



>gb|EMT25264.1| MLO-like protein 1 [Aegilops tauschii]
Length=291

 Score =   251 bits (642),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 151/201 (75%), Gaps = 8/201 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI+ +PFI+LL VG+K+EH+I +LA+EVA+KH 
Sbjct  99   VVGISWYLWTVLMIFLLLNVQGWYVYIWISVVPFIMLLVVGSKMEHIITELAYEVAQKHT  158

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI GELVV PSD+ FWF RP++VL LIH ++FQNAFEIAFFFW+LV YGF SCIMG   +
Sbjct  159  AICGELVVAPSDDFFWFHRPKLVLLLIHIVVFQNAFEIAFFFWLLVTYGFKSCIMGKPAY  218

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +I R+VI VI Q +C YSTLP+YAIV+QMG  FKKSI DE++  GLV WA+KA++   + 
Sbjct  219  VITRVVISVISQFICGYSTLPLYAIVSQMGNSFKKSIIDENVNEGLVNWAEKARRSTRVP  278

Query  222  AAFGGINHGGALTDGSSTGVQ  160
                      A  D +S+ + 
Sbjct  279  --------NRAAIDANSSSID  291



>gb|EYU22367.1| hypothetical protein MIMGU_mgv1a0228202mg, partial [Erythranthe 
guttata]
Length=319

 Score =   252 bits (644),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLL+N+ GWH YFWI+FIP ++LLAVGTKLEH+I QLA EVAEKH+
Sbjct  102  VVGISWYLWLFVILFLLVNVTGWHAYFWISFIPLLILLAVGTKLEHIISQLAQEVAEKHI  161

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+ G++VV+PSD+ FWF +P++VL LIH +LFQNAFEIA FFW+LV YGF+SCIMG V F
Sbjct  162  AVAGDVVVKPSDDLFWFRKPRLVLLLIHVLLFQNAFEIAIFFWMLVMYGFNSCIMGSVGF  221

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            +IPRL+IGVI+Q+LCSYSTLPIYAIV QMG+ F  +IF++ IQVGLVGW
Sbjct  222  VIPRLIIGVIVQLLCSYSTLPIYAIVAQMGSSFNSAIFEDRIQVGLVGW  270



>gb|EAY86311.1| hypothetical protein OsI_07684 [Oryza sativa Indica Group]
Length=449

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI+ +PF++LL VGTKLEH+I +LAH+VAEKH 
Sbjct  233  VVGISWYLWAMLIIFLLLNVQGWYVYIWISAVPFVMLLVVGTKLEHIITELAHQVAEKHT  292

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV PSDE FWF RP+IVL LIH +LFQNAFEIAFFFW+LV YGF SCIMG+  +
Sbjct  293  AIEGELVVSPSDELFWFHRPKIVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGNKGY  352

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            +I RLVI VI Q+LC YSTLP+YAIV+ MGT FKK IFDE++  GL  W
Sbjct  353  VIARLVISVISQLLCGYSTLPLYAIVSHMGTSFKKVIFDENVAEGLANW  401



>ref|XP_010930330.1| PREDICTED: MLO-like protein 1 [Elaeis guineensis]
Length=496

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WY W+FVVIFL++NI+GW TYF+++F P +LLLAVGTKL HV+ QLA EVAEKH 
Sbjct  266  VVGIRWYFWIFVVIFLVMNIHGWRTYFYVSFSPLVLLLAVGTKLVHVMTQLAKEVAEKHS  325

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LV++ SD  FWF RP+IVL LIHFILFQNA  IA FFW+ + +GF SCI G + F
Sbjct  326  AIEGDLVIKLSDNLFWFHRPRIVLILIHFILFQNALGIALFFWLWMTFGFASCINGPLGF  385

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             I RLVIGV +Q+LCSYSTLP+YAI+TQMG+ FKK IFDEHIQ GLVGW Q+A+ R G +
Sbjct  386  NITRLVIGVTVQILCSYSTLPLYAIITQMGSSFKKVIFDEHIQEGLVGWVQEARLRVGQR  445

Query  222  A  220
            A
Sbjct  446  A  446



>ref|XP_009142246.1| PREDICTED: MLO-like protein 15 [Brassica rapa]
Length=502

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFW+AF+P ILLLAVG KLEH+I  LAHEVAEKH+
Sbjct  273  VVGISWYLWVFVVLFLLLNIAAWHVYFWLAFLPLILLLAVGMKLEHIITDLAHEVAEKHI  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I  QYGFDSCIMG VKF
Sbjct  333  AVEGDLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFAQYGFDSCIMGQVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV++Q+LCSYSTLP+YA+V QMG+ FK +IF +  Q  + GWA+ AK  K   
Sbjct  393  IIPRLVIGVLVQLLCSYSTLPLYALVAQMGSSFKGAIFTDQAQQQIAGWAKSAKMAKKKG  452

Query  222  AAFGGINHGGA  190
            +   G +HGG+
Sbjct  453  STHAGSSHGGS  463



>emb|CDY23418.1| BnaC04g49460D [Brassica napus]
Length=511

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFW+AF+P ILLLAVG KLEH+I  LAHEVAEKH+
Sbjct  273  VVGISWYLWVFVVLFLLLNIAAWHVYFWLAFLPLILLLAVGMKLEHIITDLAHEVAEKHI  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I  QYGFDSCIMG VKF
Sbjct  333  AVEGDLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFAQYGFDSCIMGQVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV++Q+LCSYSTLP+YA+V QMG+ FK +IF +  Q  + GWA+ AK  K   
Sbjct  393  IIPRLVIGVLVQLLCSYSTLPLYALVAQMGSSFKGAIFTDQAQQQIAGWAKSAKMAKKKG  452

Query  222  AAFGGINHGGA  190
            +   G +HGG+
Sbjct  453  STHAGSSHGGS  463



>ref|XP_008806171.1| PREDICTED: MLO-like protein 13 isoform X2 [Phoenix dactylifera]
Length=552

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWH+YFW++F+P ILLLAVGTKLEH+I +L+ E AEK  
Sbjct  307  VVGISWYLWLFVIIFLLLNVNGWHSYFWLSFLPLILLLAVGTKLEHIITRLSQEAAEKPA  366

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              +    V+PSD  FWF RP IVL+LIHFILFQN+FEIAFFFWI   YGFDSCIM  + +
Sbjct  367  DEQEAPRVKPSDHLFWFHRPGIVLYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMEKIGY  426

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--G  229
            IIPRL+IGV++QVLCSYSTLP+YAIVTQMG  FKK+IFD H+++ L GWA+ A++RK  G
Sbjct  427  IIPRLIIGVMVQVLCSYSTLPLYAIVTQMGDMFKKAIFDVHLRLTLHGWAEGARKRKRPG  486

Query  228  LKAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGA  115
            + +     +      D S   VQM  +  + S     A
Sbjct  487  ISSFLNKFSSKSKRQDKSGNEVQMQKMASEASAGFQNA  524



>gb|EYU36622.1| hypothetical protein MIMGU_mgv1a005184mg [Erythranthe guttata]
Length=494

 Score =   253 bits (646),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 121/169 (72%), Positives = 150/169 (89%), Gaps = 0/169 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV++FLL+N+ GWH YFWI+FIP ++LLAVGTKLEH+I QLA EVAEKH+
Sbjct  277  VVGISWYLWLFVILFLLVNVTGWHAYFWISFIPLLILLAVGTKLEHIISQLAQEVAEKHI  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+ G++VV+PSD+ FWF +P++VL LIH +LFQNAFEIA FFW+LV YGF+SCIMG V F
Sbjct  337  AVAGDVVVKPSDDLFWFRKPRLVLLLIHVLLFQNAFEIAIFFWMLVMYGFNSCIMGSVGF  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            +IPRL+IGVI+Q+LCSYSTLPIYAIV QMG+ F  +IF++ IQVGLVGW
Sbjct  397  VIPRLIIGVIVQLLCSYSTLPIYAIVAQMGSSFNSAIFEDRIQVGLVGW  445



>gb|EEE57203.1| hypothetical protein OsJ_07160 [Oryza sativa Japonica Group]
Length=497

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 140/169 (83%), Gaps = 0/169 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI+ +PF++LL VGTKLEH+I +LAH+VAEKH 
Sbjct  281  VVGISWYLWAMLIIFLLLNVQGWYVYIWISAVPFVMLLVVGTKLEHIITELAHQVAEKHT  340

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV PSDE FWF RP+IVL LIH +LFQNAFEIAFFFW+LV YGF SCIMG+  +
Sbjct  341  AIEGELVVSPSDELFWFHRPKIVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGNKGY  400

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGW  256
            +I RLVI VI Q+LC YSTLP+YAIV+ MGT FKK IFDE++  GL  W
Sbjct  401  VIARLVISVISQLLCGYSTLPLYAIVSHMGTSFKKVIFDENVVEGLANW  449



>ref|XP_008806170.1| PREDICTED: MLO-like protein 13 isoform X1 [Phoenix dactylifera]
Length=565

 Score =   254 bits (650),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 130/218 (60%), Positives = 162/218 (74%), Gaps = 2/218 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWH+YFW++F+P ILLLAVGTKLEH+I +L+ E AEK  
Sbjct  320  VVGISWYLWLFVIIFLLLNVNGWHSYFWLSFLPLILLLAVGTKLEHIITRLSQEAAEKPA  379

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              +    V+PSD  FWF RP IVL+LIHFILFQN+FEIAFFFWI   YGFDSCIM  + +
Sbjct  380  DEQEAPRVKPSDHLFWFHRPGIVLYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMEKIGY  439

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK--G  229
            IIPRL+IGV++QVLCSYSTLP+YAIVTQMG  FKK+IFD H+++ L GWA+ A++RK  G
Sbjct  440  IIPRLIIGVMVQVLCSYSTLPLYAIVTQMGDMFKKAIFDVHLRLTLHGWAEGARKRKRPG  499

Query  228  LKAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGA  115
            + +     +      D S   VQM  +  + S     A
Sbjct  500  ISSFLNKFSSKSKRQDKSGNEVQMQKMASEASAGFQNA  537



>ref|XP_004970845.1| PREDICTED: MLO-like protein 1-like isoform X2 [Setaria italica]
Length=487

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 135/155 (87%), Gaps = 2/155 (1%)
 Frame = -2

Query  687  YFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVVQPSDEHFWFGRPQIVLF  508
            +F I F+   LLLAVGTKLEHVI QLA EVAEKH AIEG+LVV PSDEHFWFGRP+IVL+
Sbjct  293  HFLICFVQ--LLLAVGTKLEHVITQLAIEVAEKHSAIEGDLVVNPSDEHFWFGRPKIVLY  350

Query  507  LIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVIIQVLCSYSTLPIYAI  328
            LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV FI+PRLV+G  IQ++CSYSTLP+YAI
Sbjct  351  LIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPFIVPRLVVGATIQLVCSYSTLPLYAI  410

Query  327  VTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            VTQMGT FKK IFDEH+Q  LVGWAQKAK+RK LK
Sbjct  411  VTQMGTFFKKEIFDEHVQQSLVGWAQKAKKRKALK  445



>ref|XP_011460879.1| PREDICTED: MLO-like protein 1 [Fragaria vesca subsp. vesca]
Length=200

 Score =   242 bits (617),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/177 (69%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  759  VGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHVA  580
            +  SWYLW+F+V+FLLLN+ GWH YFW++F+PF LLLAVGTKLEHVIIQLAH+VAEKH+ 
Sbjct  1    MNFSWYLWIFLVLFLLLNVAGWHAYFWMSFVPFFLLLAVGTKLEHVIIQLAHDVAEKHIT  60

Query  579  IEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKFI  400
            IEG+LVV+PSD+HFWF RP++ L LIH ILFQN+FE+A FFWI +QY FDSC+MG + ++
Sbjct  61   IEGDLVVRPSDDHFWFRRPRLSLLLIHIILFQNSFELALFFWIWIQYKFDSCMMGKIGYV  120

Query  399  IPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
            IPRLVIG  +Q +CSYSTLP+YAIVTQMGT FKK+IFDEH+Q GLVGW + A++ + 
Sbjct  121  IPRLVIGAFVQFVCSYSTLPLYAIVTQMGTSFKKAIFDEHVQEGLVGWDKSARKHQA  177



>emb|CDY30455.1| BnaA04g25560D [Brassica napus]
Length=672

 Score =   255 bits (652),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLWVFVV+FLLLNI  WH YFW+AF+P ILLLAVG KLEH+I  LAHEVAEKH+
Sbjct  273  VVGISWYLWVFVVLFLLLNIAAWHVYFWLAFLPLILLLAVGMKLEHIITDLAHEVAEKHI  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV+PSD+ FWF  P++VLFLIHFILFQN+FE+AF F+I  QYGFDSCIMG VKF
Sbjct  333  AVEGDLVVRPSDDLFWFKSPRLVLFLIHFILFQNSFELAFIFFIFAQYGFDSCIMGQVKF  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV++Q+LCSYSTLP+YA+V QMG+ FK +IF +  Q  + GWA+ AK  K   
Sbjct  393  IIPRLVIGVLVQLLCSYSTLPLYALVAQMGSSFKGAIFTDQAQQQIAGWAKSAKMAKKKG  452

Query  222  AAFGGINHGGA  190
            +   G +HGG+
Sbjct  453  STHAGSSHGGS  463



>ref|XP_008802140.1| PREDICTED: MLO-like protein 1 [Phoenix dactylifera]
Length=498

 Score =   250 bits (639),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 161/207 (78%), Gaps = 7/207 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWY W+FVVIFL+LNI+GWHTYF++AF P +LLLAVGTKL HV+ QLA  VAEKH 
Sbjct  262  VVGISWYFWIFVVIFLMLNIHGWHTYFYVAFGPLVLLLAVGTKLAHVMTQLAKAVAEKHS  321

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWI----LVQYGFDSCIMG  415
            AIEG+LV++PSD  FWF RP+++L LIHF+LF N+ EIA FFWI    L  +GFDSCI G
Sbjct  322  AIEGDLVIKPSDNLFWFQRPRLILILIHFLLFLNSLEIALFFWIWVGSLSGFGFDSCING  381

Query  414  HVKFIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
             V F I RLVIGV +Q+LCSYSTLP+YAI+TQMGT FKK IFDEHIQ GLVGWAQ+AK R
Sbjct  382  SVGFNIARLVIGVTVQLLCSYSTLPLYAIITQMGTSFKKVIFDEHIQEGLVGWAQQAKMR  441

Query  234  KGLKAAF--GGINHGGALTDGSSTGVQ  160
             G +A     G +H G   DG+   VQ
Sbjct  442  VGQRADNYQTGPSHVGP-KDGTLVAVQ  467



>ref|XP_006648751.1| PREDICTED: MLO-like protein 1-like [Oryza brachyantha]
Length=496

 Score =   250 bits (638),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 157/203 (77%), Gaps = 3/203 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI+ +PF++LL VGTKLEH+I +LAH+VAEKH 
Sbjct  280  VVGISWYLWAMLIIFLLLNVQGWYVYIWISAVPFVMLLVVGTKLEHIITELAHQVAEKHT  339

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV PSDE FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF+SCIMG+  +
Sbjct  340  AIEGELVVSPSDELFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFNSCIMGNKGY  399

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +I RLVI V+ Q+LC YS+LP+YAIV+ MGT FKK IFDE++  GL  WAQKA  R   +
Sbjct  400  VIARLVISVVSQLLCGYSSLPLYAIVSHMGTSFKKVIFDENVAEGLANWAQKA--RNNAR  457

Query  222  AAFGGINHGGALTDGSSTG-VQM  157
                  N G +  D S+ G VQM
Sbjct  458  GGARTQNVGDSPVDESNGGAVQM  480



>ref|XP_004952743.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=497

 Score =   250 bits (638),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 164/217 (76%), Gaps = 7/217 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN++GW+ Y W++ +PF+ LL VG+KLEH+I +LA EVA+KH 
Sbjct  285  VVGISWYLWALLMIFLLLNVHGWYVYIWLSVVPFLALLVVGSKLEHIITELALEVAQKHT  344

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+LVV PSDE FWF RP++VL LIH ILFQNAFEIAFFFW+LV YGF SCIMG   +
Sbjct  345  AIEGDLVVSPSDELFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVIYGFKSCIMGKPAY  404

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +I RLVI VI Q+LC YSTLP+YAI++QMG+ FKK++FD++I  GL  WAQ A+QRK + 
Sbjct  405  VITRLVISVISQLLCGYSTLPLYAIISQMGSSFKKAMFDQNISEGLTNWAQNARQRKRMP  464

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
            A     N G +  DG   G+QM    R+ S   +G +
Sbjct  465  AT----NVGDSSPDGE--GIQMVN-ARRVSAMEEGTA  494



>ref|XP_008678707.1| PREDICTED: MLO-like protein 1 [Zea mays]
Length=479

 Score =   246 bits (627),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 162/217 (75%), Gaps = 7/217 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN++GW+ Y WI+ IPFILLL +G+K+EH+I +LA EV +KH 
Sbjct  267  VVGISWYLWGMLMIFLLLNVHGWYVYIWISVIPFILLLVLGSKMEHIITELALEVIQKHT  326

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG LVV PSDE FWF RP++VL LIH ILFQNAFEIAFFFW+LV YGF+SCIMG   +
Sbjct  327  AIEGVLVVTPSDELFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVTYGFNSCIMGKPAY  386

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +I R+VI VI QVLC YSTLP+YA+++QMG+ FKK+IFDE++  GL+ WA+ A++R  + 
Sbjct  387  VITRVVISVISQVLCGYSTLPLYALISQMGSSFKKAIFDENVSEGLINWAENARRRNRMP  446

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
             + G  +  G        G+QM    ++ES    G +
Sbjct  447  TSVGDNSPVGE-------GIQMSNQTQRESSMEQGTA  476



>gb|EMT22302.1| MLO-like protein 1 [Aegilops tauschii]
Length=418

 Score =   243 bits (619),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 157/213 (74%), Gaps = 11/213 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN++GWH Y WI+  PFILLL VG+KLEH+I +LA +VA+K+ 
Sbjct  214  VVGISWYLWAMLMIFLLLNVHGWHVYIWISIAPFILLLLVGSKLEHIITELAIDVAQKNT  273

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGELVV  SDE FWF RP++VL LIH ILFQNAFEIAFFFW+LV YGF SCIMG   +
Sbjct  274  AIEGELVVALSDEFFWFHRPKLVLLLIHIILFQNAFEIAFFFWLLVTYGFKSCIMGKPAY  333

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             I RLVI VI Q+LC YSTLP+YA+++QMG+ FKK++FDE I  GL  WA KA++R    
Sbjct  334  AIARLVISVIGQLLCGYSTLPLYALISQMGSSFKKAMFDESISEGLANWAHKARKRNTKP  393

Query  222  AAFGGINHGGALTDGSSTG--VQMGGVGRKESG  130
            AA  G        D SS G  +QM    R+ES 
Sbjct  394  AASVG--------DNSSVGEEIQMTN-ARRESA  417



>dbj|BAJ24153.1| seven trans-membrane protein [Triticum aestivum]
Length=492

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/217 (56%), Positives = 155/217 (71%), Gaps = 8/217 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH 
Sbjct  274  VVGISWYLWAMLMIFLLLNVEGWYVYIWITLVPFIMLLMVGSKMEHIITELAYEVAQKHT  333

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVV PSD  FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   +
Sbjct  334  AIRGDLVVSPSDNFFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAY  393

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +I R+VI VI QVLC YSTLP+YA+V+ MG  FKK+IFDE++  GLV WA+KA++     
Sbjct  394  VITRVVISVICQVLCGYSTLPLYAVVSHMGNSFKKTIFDENVTEGLVNWAEKARR-----  448

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
               G        TD SS+ +     G  +  +T   S
Sbjct  449  ---GTRTPNKITTDASSSPIDEANGGAVQMTNTRANS  482



>ref|XP_003575162.1| PREDICTED: MLO-like protein 1 [Brachypodium distachyon]
Length=495

 Score =   244 bits (622),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 160/219 (73%), Gaps = 2/219 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN++GW+ Y WI+ +PFI+LL VG+K+EH+I +LA+EVA+KH 
Sbjct  277  VVGISWYLWAMLMIFLLLNVHGWYVYIWISVVPFIMLLLVGSKMEHIITELAYEVAQKHT  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+LVV PSD+ FWF RP++VL LIH +LFQNAFEIAFF W+LV YGF SCIMG   +
Sbjct  337  AIQGDLVVAPSDDFFWFHRPKLVLLLIHIVLFQNAFEIAFFLWLLVTYGFKSCIMGKPAY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             I R+VI V+ Q+LC YSTLP+YAIV+QMG  FKKSIFDE++  GLV WA+KA++R  + 
Sbjct  397  AITRVVISVVSQLLCGYSTLPLYAIVSQMGNSFKKSIFDENVTEGLVNWAEKARRRTRIP  456

Query  222  AAFGGINHGGALTDGSSTG-VQMGGVGRKESGSTDGASV  109
                 +    +  DG + G +QM       S     A +
Sbjct  457  NN-SSVGASSSPIDGVNGGAIQMANTQANSSAEEGTARL  494



>ref|XP_002299404.2| hypothetical protein POPTR_0001s11880g [Populus trichocarpa]
 gb|EEE84209.2| hypothetical protein POPTR_0001s11880g [Populus trichocarpa]
Length=488

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 118/218 (54%), Positives = 151/218 (69%), Gaps = 1/218 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            +V ISWYLW+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAEK V
Sbjct  271  IVTISWYLWLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEKTV  330

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             I+ E  V+PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +
Sbjct  331  PID-EARVKPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGY  389

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL++G+++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++   
Sbjct  390  IVPRLIMGLVVQVLCSYSTLPLYALVSQMGTSFRKGMFGEDVETAIGIWAGGAKDKRDPS  449

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
               G   H  A     S   +M   G  E  S   A V
Sbjct  450  ENHGARMHKLATESSHSAAQEMVIDGGTELSSVTQAPV  487



>ref|XP_009600155.1| PREDICTED: MLO-like protein 1 isoform X1 [Nicotiana tomentosiformis]
Length=554

 Score =   244 bits (624),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 147/178 (83%), Gaps = 2/178 (1%)
 Frame = -2

Query  660  ILLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQN  481
            +LLLAVGTKLEHVIIQLAHE+AEKHVA+EGELVVQPSD HFWF RPQIVLFLIHFILFQN
Sbjct  377  LLLLAVGTKLEHVIIQLAHEIAEKHVAVEGELVVQPSDSHFWFDRPQIVLFLIHFILFQN  436

Query  480  AFEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFK  301
            AFEIAFFFWIL QYGF SCIMG   F+ PRLVIGV IQVLCSYSTLP+YA+VTQMG+H+K
Sbjct  437  AFEIAFFFWILFQYGFYSCIMGKYVFVTPRLVIGVFIQVLCSYSTLPLYALVTQMGSHYK  496

Query  300  KSIFDEHIQVGLVGWAQKAKQRKGLKAAFGGINHGGALTDGSSTGVQMGGVGRKESGS  127
            KS+FD+H+Q  L+ WA+K K++K  KAA  G NH  +  DG + G  M   G KES +
Sbjct  497  KSMFDDHVQACLIEWAEKVKKKKAQKAARDGSNH--STDDGFTIGSPMSVHGSKESPN  552


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 37/39 (95%), Gaps = 0/39 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLA  646
            VVGISWYLW+FV++FLLLNINGWHTYFWIAFIPFI ++ 
Sbjct  282  VVGISWYLWIFVILFLLLNINGWHTYFWIAFIPFIDMIT  320



>gb|EYU29404.1| hypothetical protein MIMGU_mgv1a004805mg [Erythranthe guttata]
Length=509

 Score =   243 bits (621),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+ VV+FL+LN++GWH YFWIAF+P ILLL VGTKLEH+I +LA EVA++HV
Sbjct  277  VVGISWYLWIVVVVFLVLNVHGWHAYFWIAFLPLILLLIVGTKLEHIITELAQEVAQRHV  336

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+ GELVV+PSD HFWF +P++VL LIH +LFQN+FEIA FFW+LV YGF+SCIMG V +
Sbjct  337  AVTGELVVKPSDHHFWFRKPRLVLILIHILLFQNSFEIAIFFWMLVMYGFNSCIMGQVGY  396

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK  232
            IIPRLVIGV++Q +CSYSTLP+YAIVTQMG+ F ++IF E IQV L GWAQK K+ K
Sbjct  397  IIPRLVIGVLVQFVCSYSTLPLYAIVTQMGSSFNRAIFGEDIQVKLTGWAQKVKKNK  453



>ref|XP_010672534.1| PREDICTED: MLO-like protein 15 [Beta vulgaris subsp. vulgaris]
Length=537

 Score =   243 bits (621),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 126/230 (55%), Positives = 161/230 (70%), Gaps = 7/230 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAE--K  589
            VVGISW+LW+FVV+FL LN+NG+H YFWIAFIP ILL  VGTKLEH+IIQLA +VA+  +
Sbjct  266  VVGISWFLWLFVVVFLFLNVNGYHAYFWIAFIPLILLFGVGTKLEHIIIQLAKQVAQSRR  325

Query  588  HVAIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHV  409
               I G + + PSD+HFWF +P+++L LIH ILFQN+FE+AFFFWI VQYGFDSCIMG +
Sbjct  326  QSEIGGHVEIHPSDDHFWFHKPRLLLLLIHIILFQNSFEVAFFFWIWVQYGFDSCIMGSI  385

Query  408  KFIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKG  229
             + +PRLVI   +Q +CSYSTLP+YAIVTQMG+ F K+IF+++IQ GL+ WAQKAK+ K 
Sbjct  386  GYTVPRLVIAAFVQFVCSYSTLPLYAIVTQMGSSFNKAIFEDYIQEGLISWAQKAKKTKT  445

Query  228  LKAAFGGINHGGALTDGSSTGVQM-----GGVGRKESGSTDGASVRALQQ  94
              +A              S    M      G    ++G  +G S   L Q
Sbjct  446  TLSAHTTTKQSAFTKRTRSMPAAMKLFDNKGSTSHQAGQGEGESQLDLVQ  495



>gb|EMT12340.1| MLO-like protein 1 [Aegilops tauschii]
Length=551

 Score =   243 bits (619),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 121/217 (56%), Positives = 155/217 (71%), Gaps = 8/217 (4%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH 
Sbjct  333  VVGISWYLWAMLMIFLLLNVEGWYVYIWITLVPFIMLLVVGSKMEHIITELAYEVAQKHT  392

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVV PSD  FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   +
Sbjct  393  AIRGDLVVSPSDNFFWFHRPKLVLLLIHIVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAY  452

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +I R+VI VI QVLC YSTLP+YA+V+ MG  FKK+IFD+++  GLV WA+KA++     
Sbjct  453  VITRVVISVICQVLCGYSTLPLYAVVSHMGNSFKKTIFDDNVTEGLVNWAEKARR-----  507

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGAS  112
               G        TD SS+ +     G  +  +T   S
Sbjct  508  ---GTRTPNKITTDASSSPIDEANGGAVQMTNTRANS  541



>ref|XP_002454019.1| hypothetical protein SORBIDRAFT_04g023170 [Sorghum bicolor]
 gb|EES06995.1| hypothetical protein SORBIDRAFT_04g023170 [Sorghum bicolor]
Length=533

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 160/219 (73%), Gaps = 10/219 (5%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN++GW+ Y W++  PFILLL +G+K+EH+I +LA EVA+KH 
Sbjct  320  VVGISWYLWAMLMIFLLLNVHGWYVYIWLSVAPFILLLVLGSKMEHIITELALEVAQKHT  379

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG LVV PSDE FWF RP++VL LIH ILFQNAFEIA FFW+LV YGF+SCIMG   +
Sbjct  380  AIEGVLVVTPSDELFWFHRPKLVLLLIHIILFQNAFEIALFFWLLVTYGFNSCIMGEPAY  439

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             I R+VI VI Q+LC YSTLP+YA+++QMG+ FKK+IFDE+I  GL  WA+ A++R  + 
Sbjct  440  AIIRVVISVISQLLCGYSTLPLYALISQMGSSFKKAIFDENISEGLTNWAENARRRNRMA  499

Query  222  AAFGGINHGGALTDGSS--TGVQMGGVGRKESGSTDGAS  112
                      +++D S    G+QM    ++ES    G +
Sbjct  500  TT--------SVSDNSPIGEGIQMSNKAQRESAMEQGTA  530



>dbj|BAJ91124.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 155/213 (73%), Gaps = 6/213 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH 
Sbjct  273  VVGISWYLWAMLMIFLLLNVQGWYVYIWITLVPFIMLLVVGSKMEHIITELAYEVAQKHT  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVV PSD+ FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   +
Sbjct  333  AIRGDLVVAPSDDFFWFHRPKLVLLLIHVVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAY  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKG  229
            +I R+VI VI Q+LC YSTLP+YAIV+ MG  FKK+IFD+++  GLV WA+KA++  R+ 
Sbjct  393  VITRIVISVICQLLCGYSTLPLYAIVSHMGNSFKKTIFDDNVSEGLVNWAEKARRGARRP  452

Query  228  LKAAFGGINHGGA----LTDGSSTGVQMGGVGR  142
             K     I+        +T+  +      G  R
Sbjct  453  NKTTIEPIDEANVGAVQMTNTRTNSSVEKGTAR  485



>gb|AAS93431.1| Mlo3 [Hordeum vulgare subsp. vulgare]
Length=491

 Score =   240 bits (613),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 158/225 (70%), Gaps = 14/225 (6%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN+ GW+ Y WI  +PFI+LL V +K+EH+I +LA+EVA KH 
Sbjct  273  VVGISWYLWAMLMIFLLLNVEGWYVYIWITLVPFIMLLVVASKMEHIITELAYEVAHKHT  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVV PSD+ FWF RP++VL LIH +LFQNAF+IAFFFW+LV YGF SCIMG   +
Sbjct  333  AIRGDLVVAPSDDFFWFHRPKLVLLLIHIVLFQNAFQIAFFFWLLVTYGFKSCIMGKPAY  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +I R+VI VI Q+LC YSTLP+YAIV+ MG  FKK+IFDE++  GLV WA+KA++     
Sbjct  393  VITRVVISVICQILCGYSTLPLYAIVSHMGNSFKKTIFDENVTEGLVNWAEKARR-----  447

Query  222  AAFGGINHGGALTDGSSTGVQ--MGGV----GRKESGSTDGASVR  106
               G        TD SS+ +    GG+      + + S D  + R
Sbjct  448  ---GTRTPNKITTDASSSPIDEANGGIVQMTNTRANSSVDQGTAR  489



>gb|EYU33241.1| hypothetical protein MIMGU_mgv1a017858mg, partial [Erythranthe 
guttata]
Length=460

 Score =   239 bits (609),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            ++GISWYLW+FVVIFLL+NI GWH YFW++F+P ILLL VG KLEH+I QLA + AE+  
Sbjct  280  IIGISWYLWMFVVIFLLMNIAGWHAYFWMSFLPLILLLIVGAKLEHIITQLAKDAAERSG  339

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             +EG + V+ SDE FWF RP +VL+LIHFILFQN+FEIAFFFWI   YGF SCIM  + F
Sbjct  340  DVEG-IPVRLSDELFWFHRPTLVLYLIHFILFQNSFEIAFFFWIWTTYGFKSCIMEGLNF  398

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAK  241
            IIPRLVIGVI+QVLCSYSTLP+YA+VTQMG+ FK+++FDE     ++ WA+  K
Sbjct  399  IIPRLVIGVIVQVLCSYSTLPLYALVTQMGSMFKQTVFDEFTHDLILTWAKDRK  452



>dbj|BAJ94381.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   239 bits (610),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 119/213 (56%), Positives = 154/213 (72%), Gaps = 6/213 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  ++IFLLLN  GW+ Y WI  +PFI+LL VG+K+EH+I +LA+EVA+KH 
Sbjct  273  VVGISWYLWAMLMIFLLLNAQGWYVYIWITLVPFIMLLVVGSKMEHIITELAYEVAQKHT  332

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI G+LVV PSD+ FWF RP++VL LIH +LFQNAFEIAFFFW+LV YGF SCIMG   +
Sbjct  333  AIRGDLVVAPSDDFFWFHRPKLVLLLIHVVLFQNAFEIAFFFWLLVTYGFKSCIMGKPAY  392

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ--RKG  229
            +I R+VI VI Q+LC YSTLP+YAIV+ MG  FKK+IFD+++  GLV WA+KA++  R+ 
Sbjct  393  VITRIVISVICQLLCGYSTLPLYAIVSHMGNSFKKTIFDDNVSEGLVNWAEKARRGARRP  452

Query  228  LKAAFGGINHGGA----LTDGSSTGVQMGGVGR  142
             K     I+        +T+  +      G  R
Sbjct  453  NKTTIEPIDEANVGAVQMTNTRTNSSVEKGTAR  485



>ref|XP_011026716.1| PREDICTED: MLO-like protein 13 isoform X2 [Populus euphratica]
Length=488

 Score =   239 bits (610),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 150/218 (69%), Gaps = 1/218 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            +V ISWYLW+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAE  V
Sbjct  271  IVTISWYLWLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEMPV  330

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             ++ E  V+PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +
Sbjct  331  PVD-EARVKPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGY  389

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL++G+++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++   
Sbjct  390  IVPRLIMGLVVQVLCSYSTLPLYALVSQMGTRFRKGMFGEDMEAAIEIWAGGAKGKRDPS  449

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
               G      A     S   +M  +G  E  S   A V
Sbjct  450  ENHGARMDKLATESSHSAAQEMVIIGGTELSSVTQAPV  487



>ref|XP_010913231.1| PREDICTED: MLO-like protein 13 isoform X4 [Elaeis guineensis]
Length=431

 Score =   237 bits (605),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FV+IFLLLN+NGWHTYFW++F+P I LLAVGTKLEH+I +L  E AEKH 
Sbjct  278  VVGISWYLWLFVIIFLLLNVNGWHTYFWLSFLPLIPLLAVGTKLEHIITRLTQEAAEKHA  337

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              +    V+PSD HFWF RP I+L+LIHFILFQN+FEIAFFFWI   YGFDSCIMG + +
Sbjct  338  DEQEAPSVKPSDHHFWFRRPGIILYLIHFILFQNSFEIAFFFWIWSTYGFDSCIMGKIGY  397

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQM  316
            IIPRL+IGV +QVLCSYSTLP+YAIVTQ+
Sbjct  398  IIPRLIIGVTVQVLCSYSTLPLYAIVTQL  426



>ref|XP_011026715.1| PREDICTED: MLO-like protein 13 isoform X1 [Populus euphratica]
Length=510

 Score =   239 bits (609),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 150/218 (69%), Gaps = 1/218 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            +V ISWYLW+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAE  V
Sbjct  293  IVTISWYLWLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEMPV  352

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             ++ E  V+PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +
Sbjct  353  PVD-EARVKPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGY  411

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            I+PRL++G+++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++   
Sbjct  412  IVPRLIMGLVVQVLCSYSTLPLYALVSQMGTRFRKGMFGEDMEAAIEIWAGGAKGKRDPS  471

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
               G      A     S   +M  +G  E  S   A V
Sbjct  472  ENHGARMDKLATESSHSAAQEMVIIGGTELSSVTQAPV  509



>gb|KJB56407.1| hypothetical protein B456_009G118700 [Gossypium raimondii]
Length=484

 Score =   238 bits (607),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 143/186 (77%), Gaps = 6/186 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+ GW+TYFW++F+P +LLL VGTKLEH+II+LA E++E  +
Sbjct  265  VVGISWYLWLFVVIFLLLNVKGWNTYFWLSFLPVVLLLIVGTKLEHIIIRLAQEMSE--M  322

Query  582  AIEGELV-VQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVK  406
               GE   V+PSDEHFWF  P+IV FLIHFILFQNAFE+AFFFWIL  YGF SCIM  + 
Sbjct  323  KERGETAQVKPSDEHFWFKNPRIVFFLIHFILFQNAFELAFFFWILCTYGFHSCIMEKLG  382

Query  405  FIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQ---R  235
            +II RL++GVI+QVLCSY TLP+Y +VTQMG+ FK+ IF EHI   L  W    +    R
Sbjct  383  YIITRLIMGVIVQVLCSYITLPLYVLVTQMGSCFKEGIFKEHIHSTLTTWRSGPRDQGSR  442

Query  234  KGLKAA  217
            +G  A 
Sbjct  443  RGSSAP  448



>ref|XP_010913978.1| PREDICTED: MLO-like protein 13 [Elaeis guineensis]
Length=424

 Score =   236 bits (601),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 128/225 (57%), Positives = 160/225 (71%), Gaps = 18/225 (8%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GWHTYFW++F+P +LLL VG KLEH+I +LA ++AE  V
Sbjct  184  VVGISWYLWLFVVIFLLLNVHGWHTYFWLSFLPLVLLLIVGAKLEHIITRLALDLAELPV  243

Query  582  A-IEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVK  406
              +E    V+PSDEHFWF RP I+L+LIHFILFQNAFEIAFFFWI   YGF SCIM  V 
Sbjct  244  DDMERPARVKPSDEHFWFNRPGIMLYLIHFILFQNAFEIAFFFWIWSTYGFHSCIMESVG  303

Query  405  FIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL  226
            ++IPRLV G++IQVLCSYSTLP+YAIVTQMG  FK++IF EH+Q+ L GW +  ++RK  
Sbjct  304  YLIPRLVFGIMIQVLCSYSTLPLYAIVTQMGDMFKRAIFAEHMQLLLHGWVEGVRKRK--  361

Query  225  KAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQM  91
            +A F                   G  GRK+   +       +Q+M
Sbjct  362  RAGFSAFR---------------GFFGRKDKKRSPSGRDIPMQRM  391



>gb|AFW81913.1| hypothetical protein ZEAMMB73_691352 [Zea mays]
Length=439

 Score =   235 bits (599),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 123/219 (56%), Positives = 154/219 (70%), Gaps = 32/219 (15%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWH YFWI+F+P +LLLAVGTKLEHVI QL H+VA+KH 
Sbjct  248  VVGISWYLWIFVVIFLLLNVNGWHIYFWISFLPLLLLLAVGTKLEHVIAQLGHDVAKKHA  307

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+++V+PSD HFWFG+P+I+L+LIHFILFQN+FEIAFFFWIL               
Sbjct  308  AIDGDVIVKPSDSHFWFGKPRIILYLIHFILFQNSFEIAFFFWIL---------------  352

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
                        +LCSY TLP+YAIVTQMG+ +KK IF++H+Q G++ WAQK K RKGLK
Sbjct  353  ------------LLCSYITLPLYAIVTQMGSCYKKEIFNDHVQKGVLVWAQKVKMRKGLK  400

Query  222  AAFG---GINHGGALTDGSSTGVQMGGVGR--KESGSTD  121
             A        +  A   G S  ++M   G   K  G+T+
Sbjct  401  GALSKSDSAKNNNADPAGPSVKIEMAKAGEDAKVVGNTE  439



>ref|XP_011026717.1| PREDICTED: endoglucanase 25-like isoform X3 [Populus euphratica]
Length=1093

 Score =   244 bits (622),  Expect = 3e-70, Method: Composition-based stats.
 Identities = 115/218 (53%), Positives = 150/218 (69%), Gaps = 1/218 (0%)
 Frame = -2

Query  762   VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
             +V ISWYLW+F+V+FLL+N+ GWHT+FW++F+P ILLL VG KLEH+I  L H VAE  V
Sbjct  876   IVTISWYLWLFIVMFLLMNVEGWHTFFWLSFLPVILLLLVGAKLEHIITSLGHRVAEMPV  935

Query  582   AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              ++ E  V+PSDEHFW  +P IVL LI FILFQN+FEIAFFFWI   YGF SCIM  V +
Sbjct  936   PVD-EARVKPSDEHFWLEKPAIVLDLIQFILFQNSFEIAFFFWIWSTYGFRSCIMERVGY  994

Query  402   IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             I+PRL++G+++QVLCSYSTLP+YA+V+QMGT F+K +F E ++  +  WA  AK ++   
Sbjct  995   IVPRLIMGLVVQVLCSYSTLPLYALVSQMGTRFRKGMFGEDMEAAIEIWAGGAKGKRDPS  1054

Query  222   AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
                G      A     S   +M  +G  E  S   A V
Sbjct  1055  ENHGARMDKLATESSHSAAQEMVIIGGTELSSVTQAPV  1092



>gb|ACN35418.1| unknown [Zea mays]
 tpg|DAA56447.1| TPA: hypothetical protein ZEAMMB73_710218 [Zea mays]
Length=342

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 119/128 (93%), Gaps = 0/128 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLNINGWHTYFWI+FIP +LLLAVGTKLEHVI QLA EVAEKH 
Sbjct  215  VVGISWYLWIFVVVFMLLNINGWHTYFWISFIPLLLLLAVGTKLEHVITQLAQEVAEKHS  274

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVV PSD+HFWFGRP+IVL+LIHFILFQNAFEIAFFFWIL  YGF+SCIM HV F
Sbjct  275  AVEGDLVVNPSDDHFWFGRPKIVLYLIHFILFQNAFEIAFFFWILTTYGFNSCIMDHVPF  334

Query  402  IIPRLVIG  379
            I+PRLV+G
Sbjct  335  IVPRLVVG  342



>ref|XP_010521421.1| PREDICTED: MLO-like protein 13 isoform X2 [Tarenaya hassleriana]
Length=478

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEK-H  586
            VVGISWYLW+FVV+FLLL++ GW+TYFW++F+P ILL+ VG KLE++I  LA +V+EK +
Sbjct  267  VVGISWYLWLFVVVFLLLDVGGWNTYFWLSFLPLILLVMVGAKLENIISSLALDVSEKRN  326

Query  585  VAIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVK  406
               E E  ++PSDE FWF RP IVL LIHFILFQN+FEIAFFFWIL  YG  SCIM  + 
Sbjct  327  REQESERTIKPSDELFWFHRPSIVLSLIHFILFQNSFEIAFFFWILFTYGIKSCIMERLG  386

Query  405  FIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            F+IPRLV+GV++QVLCSYSTLP+YA+VTQMG+ FKK IFDE +   +  W +  + +
Sbjct  387  FLIPRLVMGVLVQVLCSYSTLPLYALVTQMGSKFKKGIFDELVHSAIDLWVEDTRNK  443



>ref|XP_010521420.1| PREDICTED: MLO-like protein 13 isoform X1 [Tarenaya hassleriana]
Length=480

 Score =   233 bits (595),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 140/177 (79%), Gaps = 1/177 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEK-H  586
            VVGISWYLW+FVV+FLLL++ GW+TYFW++F+P ILL+ VG KLE++I  LA +V+EK +
Sbjct  269  VVGISWYLWLFVVVFLLLDVGGWNTYFWLSFLPLILLVMVGAKLENIISSLALDVSEKRN  328

Query  585  VAIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVK  406
               E E  ++PSDE FWF RP IVL LIHFILFQN+FEIAFFFWIL  YG  SCIM  + 
Sbjct  329  REQESERTIKPSDELFWFHRPSIVLSLIHFILFQNSFEIAFFFWILFTYGIKSCIMERLG  388

Query  405  FIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQR  235
            F+IPRLV+GV++QVLCSYSTLP+YA+VTQMG+ FKK IFDE +   +  W +  + +
Sbjct  389  FLIPRLVMGVLVQVLCSYSTLPLYALVTQMGSKFKKGIFDELVHSAIDLWVEDTRNK  445



>ref|XP_010247041.1| PREDICTED: MLO-like protein 13 isoform X2 [Nelumbo nucifera]
Length=525

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 149/214 (70%), Gaps = 1/214 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VV ISWYLW+FVVIFLLLN +GWHT+FW++F P ILLL VG KLEH+I +LA +V +++ 
Sbjct  276  VVTISWYLWLFVVIFLLLNEHGWHTFFWLSFSPLILLLLVGAKLEHIITRLAEDVEQRNK  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
                   V+PSDEHFWFGRPQIVL+LIHFILF+NAFEIAFF WI   +GF SC++  + +
Sbjct  336  NDPTAPPVKPSDEHFWFGRPQIVLYLIHFILFENAFEIAFFAWIWCTFGFKSCMVEKLGY  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPR++IGV +QVLCSYSTLP++AIVTQMG+ FKK IF  H++  +VGWA   +  +   
Sbjct  396  VIPRIIIGVAVQVLCSYSTLPLFAIVTQMGSAFKKGIFS-HLEDDIVGWAATRRMTRRTS  454

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
                G N         ++ ++ G     E  S  
Sbjct  455  TVKSGGNTTDEREPSRTSTMKHGRNTMSEPSSNS  488



>ref|XP_008798739.1| PREDICTED: MLO-like protein 13 [Phoenix dactylifera]
Length=529

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 123/200 (62%), Positives = 149/200 (75%), Gaps = 4/200 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN++GWHTYFW++F+P ILLL VG KLEH+I +LAH       
Sbjct  287  VVGISWYLWLFVVIFLLLNVHGWHTYFWLSFLPLILLLVVGAKLEHIITRLAHLAVMPGD  346

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
               G   V+PSDEHFWF RP IVL+LIHFILFQNAFEIAFFFWI   YGF SCIM  V +
Sbjct  347  DKGGAARVKPSDEHFWFNRPDIVLYLIHFILFQNAFEIAFFFWIWTTYGFKSCIMESVGY  406

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRK---  232
            ++PRLV GVIIQ+LCSYSTLP+YAIV+QMG  FK++IF E + + L GW + A++RK   
Sbjct  407  LVPRLVFGVIIQLLCSYSTLPLYAIVSQMGDMFKRAIFAERLHLLLHGWVEGARKRKRAG  466

Query  231  -GLKAAFGGINHGGALTDGS  175
             GL +  G   H    ++ S
Sbjct  467  PGLSSVLGWFGHKDKKSNHS  486



>ref|XP_010247040.1| PREDICTED: MLO-like protein 13 isoform X1 [Nelumbo nucifera]
Length=529

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/214 (53%), Positives = 149/214 (70%), Gaps = 1/214 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VV ISWYLW+FVVIFLLLN +GWHT+FW++F P ILLL VG KLEH+I +LA +V +++ 
Sbjct  280  VVTISWYLWLFVVIFLLLNEHGWHTFFWLSFSPLILLLLVGAKLEHIITRLAEDVEQRNK  339

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
                   V+PSDEHFWFGRPQIVL+LIHFILF+NAFEIAFF WI   +GF SC++  + +
Sbjct  340  NDPTAPPVKPSDEHFWFGRPQIVLYLIHFILFENAFEIAFFAWIWCTFGFKSCMVEKLGY  399

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            +IPR++IGV +QVLCSYSTLP++AIVTQMG+ FKK IF  H++  +VGWA   +  +   
Sbjct  400  VIPRIIIGVAVQVLCSYSTLPLFAIVTQMGSAFKKGIFS-HLEDDIVGWAATRRMTRRTS  458

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTD  121
                G N         ++ ++ G     E  S  
Sbjct  459  TVKSGGNTTDEREPSRTSTMKHGRNTMSEPSSNS  492



>dbj|BAJ97456.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=489

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 152/221 (69%), Gaps = 5/221 (2%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGI WY W+FV+IFLL+N+ GWH+YFWI+ +P  LLL +GTKLEH+I Q+A+EV  K  
Sbjct  273  VVGIKWYYWIFVMIFLLINVTGWHSYFWISLVPLTLLLVIGTKLEHIITQMAYEVNRKRA  332

Query  582  AIE-GELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVK  406
            A+E G++ V PSD+ FWF  P+I+L L+HFILFQNAFE A+ FW +  +G++SCIM  + 
Sbjct  333  AVEAGDIAVDPSDDLFWFRSPRILLILVHFILFQNAFEFAYLFWTIAMFGYNSCIMDKLG  392

Query  405  FIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL  226
            + + R+ I V++QVLCSYSTLP+YAIV+ MG+ FK ++F + +   L  WA  A++R G 
Sbjct  393  YSVSRIAICVVVQVLCSYSTLPLYAIVSHMGSSFKSAVFADDVVEHLRSWANDARER-GR  451

Query  225  KAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRA  103
                GG    GA   GSS   + G   + +  + + A+ R+
Sbjct  452  GTDGGGCLGAGATATGSS---REGSRTQPQDKAEEPAAERS  489



>gb|EMS64374.1| MLO-like protein 1 [Triticum urartu]
Length=469

 Score =   228 bits (581),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 152/204 (75%), Gaps = 0/204 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  +++FLLLN+ G + Y WI+ +PFI+LL VG+K+EH+I +LA+EVA+KH 
Sbjct  258  VVGISWYLWALLMVFLLLNVQGLYVYIWISLVPFIMLLLVGSKMEHIITELAYEVAQKHT  317

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AI+G+LVV PSD+ FWF RP++VL LIH +LFQNAFEIA FFW+LV YGF SCIMG+  +
Sbjct  318  AIQGDLVVAPSDDFFWFHRPKLVLLLIHVVLFQNAFEIALFFWLLVTYGFKSCIMGNRAY  377

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             I R+VI VI Q++C Y TLP+YA+V+ MG+ F++ +FDE++  GLV WA+KA++R  + 
Sbjct  378  AIARVVISVISQLVCCYITLPLYAVVSHMGSSFRRVMFDENVTEGLVNWAEKARRRTRIP  437

Query  222  AAFGGINHGGALTDGSSTGVQMGG  151
            +          + + S   VQ+  
Sbjct  438  SKTPADVGNSQVDESSGVAVQITN  461



>ref|XP_008345009.1| PREDICTED: MLO-like protein 1 isoform X2 [Malus domestica]
Length=457

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 128/146 (88%), Gaps = 5/146 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV+F+LLN++GWH YFWIAF+PF LLLAVGTKL+HVI QLAHEVAEKH+
Sbjct  284  VVGISWYLWIFVVLFMLLNVDGWHAYFWIAFVPFFLLLAVGTKLQHVITQLAHEVAEKHI  343

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEGEL+VQPSD+HFWFG+P+ VLFLIHFILFQNAFE+AFFFWI VQYGF SCIMG V +
Sbjct  344  AIEGELIVQPSDKHFWFGKPKFVLFLIHFILFQNAFEMAFFFWIWVQYGFTSCIMGKVXY  403

Query  402  IIPRLVIG--VIIQVLCSYSTLPIYA  331
            I+PRLVIG   I +  CS   + IYA
Sbjct  404  IVPRLVIGWEPISRKQCS---MRIYA  426



>ref|XP_004959126.1| PREDICTED: MLO-like protein 1-like [Setaria italica]
Length=479

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 153/205 (75%), Gaps = 7/205 (3%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW  +V+FLLLN++GW+ Y W+   PFILLL VG+K+EH+I +LA +VA+KH 
Sbjct  276  VVGISWYLWALLVVFLLLNVHGWYVYIWLTLAPFILLLVVGSKMEHIITELAVQVAQKHT  335

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG++VV PSD+ FWF +P++VL LIH +LFQNAFEIAFFFW+LV +GF SCIMG   +
Sbjct  336  AIEGDVVVTPSDDFFWFHQPKLVLHLIHIVLFQNAFEIAFFFWLLVTFGFKSCIMGKPGY  395

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             I RLVI VI Q+LC YSTLP+YAIV+ MG  FKK+IFD+++  GLV WAQ A++RKG  
Sbjct  396  AISRLVISVISQLLCGYSTLPLYAIVSHMGNSFKKAIFDDNVSEGLVTWAQNARRRKGK-  454

Query  222  AAFGGINHGGALTDGSSTGVQMGGV  148
                  N   A +  SS   + GG 
Sbjct  455  ------NTTNADSSASSVDGRYGGA  473



>gb|KCW71438.1| hypothetical protein EUGRSUZ_E000081, partial [Eucalyptus grandis]
Length=264

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 148/208 (71%), Gaps = 14/208 (7%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLL                +LLLAVGTKLEHVI QLA +VAEKH 
Sbjct  56   VVGISWYLWIFVVIFLLLMS--------------MLLLAVGTKLEHVINQLAQDVAEKHA  101

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A+EG+LVVQPSD+HFWF RP+IVL LIH +LFQNAFE+AFFF+I VQY  DSCIMG V F
Sbjct  102  AVEGDLVVQPSDDHFWFHRPRIVLLLIHILLFQNAFELAFFFFICVQYSSDSCIMGQVGF  161

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGV +Q +CSYSTLP+YAIVTQMG+ FKK+IF+EHI  GL  W Q AK +K  +
Sbjct  162  IIPRLVIGVSVQFMCSYSTLPLYAIVTQMGSSFKKAIFEEHIHEGLSVWTQHAKMKKNAR  221

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRK  139
                G        D   T   +G   ++
Sbjct  222  MTATGTGSTTLPVDPKVTSQSLGEPTKE  249



>ref|XP_011087587.1| PREDICTED: MLO-like protein 13 [Sesamum indicum]
Length=485

 Score =   227 bits (578),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 153/218 (70%), Gaps = 22/218 (10%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            ++GISWYLW+FVVIFLLLNI GWH YFW++F+P +LLL VG KLEH+I +LA + AE+  
Sbjct  262  IIGISWYLWLFVVIFLLLNIAGWHAYFWLSFLPLVLLLIVGAKLEHIITELAQDAAERAG  321

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
              EG   V+PSDE FWF RP IVL+LIHFILFQN+FEIAFFFWI   YGF SCIM  + F
Sbjct  322  DAEGT-PVRPSDELFWFHRPAIVLYLIHFILFQNSFEIAFFFWIWATYGFRSCIMEGLHF  380

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
            IIPRLVIGVI+QVLCSYSTLP+YA+VTQMG+ FK+++FDE  Q  +  WA+ +K      
Sbjct  381  IIPRLVIGVIVQVLCSYSTLPLYALVTQMGSMFKQTVFDEFTQELIRTWAKDSK------  434

Query  222  AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASV  109
                          GSSTG +     R  +  TD  S+
Sbjct  435  -------------PGSSTGRRT--TSRLTTEPTDTISI  457



>ref|XP_009392168.1| PREDICTED: MLO-like protein 13 isoform X3 [Musa acuminata subsp. 
malaccensis]
Length=369

 Score =   223 bits (569),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 121/221 (55%), Positives = 159/221 (72%), Gaps = 1/221 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLL+N++GWHTYFW++F+P ILLL VG KL+H+I +LA E+ EK  
Sbjct  136  VVGISWYLWLFVVIFLLMNVHGWHTYFWLSFLPLILLLVVGAKLDHIITKLALELQEKPR  195

Query  582  AIEGELV-VQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVK  406
              +GE   V+ S+EHFWF +P IVL+LI FILFQN+FEIAFFFWI   YGF SCIM  + 
Sbjct  196  GPKGETQHVKLSNEHFWFKKPGIVLYLIQFILFQNSFEIAFFFWIWSTYGFHSCIMEGLG  255

Query  405  FIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGL  226
            ++IPRLVIGVIIQVLCSYSTLP+YAIVTQMG  FK+SIF+  +Q  L  WA + K+++  
Sbjct  256  YLIPRLVIGVIIQVLCSYSTLPLYAIVTQMGEGFKESIFNATVQHTLHDWATQVKEKRKH  315

Query  225  KAAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRA  103
            +  F    +       ++  +QM  +  + + ++ G    A
Sbjct  316  QYGFLSFLNFHRKDKKNNNEIQMQTLASRAAEASHGIQQSA  356



>ref|XP_008812869.1| PREDICTED: MLO-like protein 1 isoform X2 [Phoenix dactylifera]
Length=420

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/128 (82%), Positives = 117/128 (91%), Gaps = 0/128 (0%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVVIFLLLN+NGWHTYFWIAFIP +LLLAVGTKLEHVI QLAHEVAEKH 
Sbjct  280  VVGISWYLWIFVVIFLLLNVNGWHTYFWIAFIPLLLLLAVGTKLEHVITQLAHEVAEKHS  339

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            AIEG+L+V+PSD+HFWF RP+++L+LIHFILFQNAFE AFFFWIL  YGF+SCIM H  F
Sbjct  340  AIEGDLIVKPSDDHFWFHRPRVILYLIHFILFQNAFEFAFFFWILTTYGFNSCIMDHAGF  399

Query  402  IIPRLVIG  379
            II RLVIG
Sbjct  400  IISRLVIG  407



>ref|XP_007023831.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
 gb|EOY26453.1| Glycosyl hydrolase 9A1 [Theobroma cacao]
Length=1080

 Score =   233 bits (593),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/225 (55%), Positives = 153/225 (68%), Gaps = 16/225 (7%)
 Frame = -2

Query  762   VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
             VVGISWYLW+FVV+FLLLN+ GWHTYFW++F+P +LLL VG KLEH+II+LA +V EK  
Sbjct  854   VVGISWYLWLFVVVFLLLNVKGWHTYFWLSFLPVVLLLLVGAKLEHIIIRLAQDVIEKRE  913

Query  582   AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
               EG  V +PSDEHFWFGRP IVL LIHFILFQN+FE+AFFFWIL  YGF SCIM  V +
Sbjct  914   RGEGAQV-KPSDEHFWFGRPGIVLHLIHFILFQNSFELAFFFWILCTYGFRSCIMEKVGY  972

Query  402   IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQKAKQRKGLK  223
             IIPRL++GV++QVLCSY TLP+Y +VTQMG+ FK+ +FD+ +   L  W Q  +      
Sbjct  973   IIPRLIMGVMVQVLCSYITLPLYVLVTQMGSKFKEGMFDDFVVESLGKWRQGRR------  1026

Query  222   AAFGGINHGGALTDGSSTGVQMGGVGRKESGSTDGASVRALQQMG  88
                      G  + G S+   +G V R    S     +   Q M 
Sbjct  1027  ---------GETSMGGSSSAHVGQVHRITKESCQSIQIEEKQTMN  1062



>ref|XP_002266927.3| PREDICTED: endoglucanase 25 [Vitis vinifera]
Length=1061

 Score =   232 bits (591),  Expect = 3e-66, Method: Composition-based stats.
 Identities = 113/171 (66%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  762   VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
             VVGISWYLW+FVV FLLL++ GWHTYFW+AF+P ILLL VG KLEH+I +LA EV E+  
Sbjct  887   VVGISWYLWLFVVFFLLLDVEGWHTYFWLAFLPLILLLLVGAKLEHIITRLAQEVDEEK-  945

Query  582   AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
             A   E  V+PSDEHFWF RP IVL+LIHFILFQN+FEIAFFFWI   YGF+SCIM  + +
Sbjct  946   AKGHEARVKPSDEHFWFRRPSIVLYLIHFILFQNSFEIAFFFWIWSTYGFNSCIMEKLGY  1005

Query  402   IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
             IIPRL++G ++QVLCSYSTLP+Y IVTQMG+ FK+ +F +H+   ++GWA 
Sbjct  1006  IIPRLLMGALVQVLCSYSTLPLYVIVTQMGSMFKEGMFHQHVHQSILGWAH  1056



>emb|CBI29605.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   223 bits (569),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 139/171 (81%), Gaps = 1/171 (1%)
 Frame = -2

Query  762  VVGISWYLWVFVVIFLLLNINGWHTYFWIAFIPFILLLAVGTKLEHVIIQLAHEVAEKHV  583
            VVGISWYLW+FVV FLLL++ GWHTYFW+AF+P ILLL VG KLEH+I +LA EV E+  
Sbjct  272  VVGISWYLWLFVVFFLLLDVEGWHTYFWLAFLPLILLLLVGAKLEHIITRLAQEVDEEK-  330

Query  582  AIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNAFEIAFFFWILVQYGFDSCIMGHVKF  403
            A   E  V+PSDEHFWF RP IVL+LIHFILFQN+FEIAFFFWI   YGF+SCIM  + +
Sbjct  331  AKGHEARVKPSDEHFWFRRPSIVLYLIHFILFQNSFEIAFFFWIWSTYGFNSCIMEKLGY  390

Query  402  IIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKKSIFDEHIQVGLVGWAQ  250
            IIPRL++G ++QVLCSYSTLP+Y IVTQMG+ FK+ +F +H+   ++GWA 
Sbjct  391  IIPRLLMGALVQVLCSYSTLPLYVIVTQMGSMFKEGMFHQHVHQSILGWAH  441



>gb|KDO49759.1| hypothetical protein CISIN_1g0474502mg, partial [Citrus sinensis]
Length=178

 Score =   214 bits (545),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = -2

Query  657  LLLAVGTKLEHVIIQLAHEVAEKHVAIEGELVVQPSDEHFWFGRPQIVLFLIHFILFQNA  478
            LL+ VGTKL+H++ QLA +VAEKH+A+EG+LVV+PSD+HFW  +P++VL LIH ILFQN+
Sbjct  1    LLICVGTKLQHILTQLAQDVAEKHMAVEGDLVVKPSDDHFWLHKPKLVLTLIHIILFQNS  60

Query  477  FEIAFFFWILVQYGFDSCIMGHVKFIIPRLVIGVIIQVLCSYSTLPIYAIVTQMGTHFKK  298
            FE+A FFWILVQYGF SCIMG V++IIPRLVIGV +QVLCSYS LP+YAIV QMG+ FKK
Sbjct  61   FELAVFFWILVQYGFHSCIMGSVEYIIPRLVIGVFVQVLCSYSILPLYAIVVQMGSKFKK  120

Query  297  SIFDEHIQVGLVGWAQKAKQRKGLKAAFGG  208
            +IF E+IQ GL+ WA+KA++    +    G
Sbjct  121  AIFKENIQEGLIHWAKKARKNIERRNRLDG  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680