BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038N18

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO80165.1|  hypothetical protein CISIN_1g005652mg                   337   2e-111   Citrus sinensis [apfelsine]
gb|KDO80164.1|  hypothetical protein CISIN_1g005652mg                   340   7e-111   Citrus sinensis [apfelsine]
gb|KDO80158.1|  hypothetical protein CISIN_1g005652mg                   342   5e-110   Citrus sinensis [apfelsine]
gb|KDO80159.1|  hypothetical protein CISIN_1g005652mg                   342   9e-110   Citrus sinensis [apfelsine]
ref|XP_006475896.1|  PREDICTED: TBC1 domain family member 17-like       342   1e-109   Citrus sinensis [apfelsine]
ref|XP_006381119.1|  hypothetical protein POPTR_0006s06520g             330   2e-109   
gb|KDO80156.1|  hypothetical protein CISIN_1g005652mg                   342   3e-109   Citrus sinensis [apfelsine]
ref|XP_006450870.1|  hypothetical protein CICLE_v10007683mg             341   4e-109   Citrus clementina [clementine]
ref|XP_003542634.1|  PREDICTED: TBC1 domain family member 15-like       340   1e-108   Glycine max [soybeans]
gb|KHN22122.1|  TBC1 domain family member 15                            340   1e-108   Glycine soja [wild soybean]
ref|XP_007155039.1|  hypothetical protein PHAVU_003G167800g             338   3e-108   Phaseolus vulgaris [French bean]
ref|XP_004508468.1|  PREDICTED: TBC1 domain family member 17-like...    340   3e-108   Cicer arietinum [garbanzo]
ref|XP_006401806.1|  hypothetical protein EUTSA_v10012867mg             338   5e-108   
ref|XP_006401805.1|  hypothetical protein EUTSA_v10012867mg             338   6e-108   Eutrema salsugineum [saltwater cress]
ref|XP_002285365.1|  PREDICTED: TBC1 domain family member 17 isof...    338   6e-108   Vitis vinifera
ref|XP_009624893.1|  PREDICTED: TBC1 domain family member 15-like       337   7e-108   Nicotiana tomentosiformis
ref|XP_007013521.1|  RabGAP/TBC domain-containing protein isoform 2     337   8e-108   
ref|XP_003549744.1|  PREDICTED: TBC1 domain family member 15-like       337   9e-108   
ref|XP_010656459.1|  PREDICTED: TBC1 domain family member 17 isof...    338   1e-107   Vitis vinifera
ref|XP_009758337.1|  PREDICTED: TBC1 domain family member 15-like       337   1e-107   Nicotiana sylvestris
ref|XP_006372159.1|  hypothetical protein POPTR_0018s12770g             336   1e-107   
ref|XP_010656458.1|  PREDICTED: GTPase-activating protein GYP7 is...    338   1e-107   Vitis vinifera
emb|CDY65323.1|  BnaC02g44880D                                          337   2e-107   Brassica napus [oilseed rape]
ref|XP_002324638.2|  hypothetical protein POPTR_0018s12770g             336   2e-107   
ref|XP_006280129.1|  hypothetical protein CARUB_v10026023mg             336   4e-107   Capsella rubella
ref|XP_010557604.1|  PREDICTED: TBC1 domain family member 15            336   4e-107   Tarenaya hassleriana [spider flower]
dbj|BAA98077.1|  unnamed protein product                                325   4e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003609386.1|  TBC1 domain family member                          335   5e-107   Medicago truncatula
gb|KCW80045.1|  hypothetical protein EUGRSUZ_C01375                     331   6e-107   Eucalyptus grandis [rose gum]
ref|XP_009127224.1|  PREDICTED: TBC1 domain family member 15            335   6e-107   Brassica rapa
emb|CDY27056.1|  BnaA02g10760D                                          335   6e-107   Brassica napus [oilseed rape]
ref|XP_002864184.1|  hypothetical protein ARALYDRAFT_495330             335   6e-107   Arabidopsis lyrata subsp. lyrata
gb|AIU48656.1|  RabGAP/TBC domain-containing protein                    334   8e-107   Glycine max [soybeans]
ref|XP_007013520.1|  RabGAP/TBC domain-containing protein isoform 1     337   1e-106   
ref|XP_010442797.1|  PREDICTED: TBC1 domain family member 15-like       334   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010482626.1|  PREDICTED: TBC1 domain family member 15-like...    334   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010482625.1|  PREDICTED: TBC1 domain family member 15-like...    334   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010482627.1|  PREDICTED: TBC1 domain family member 15-like...    334   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010241556.1|  PREDICTED: TBC1 domain family member 15 isof...    334   3e-106   Nelumbo nucifera [Indian lotus]
ref|XP_010445073.1|  PREDICTED: TBC1 domain family member 15-like...    334   3e-106   Camelina sativa [gold-of-pleasure]
gb|AIU48673.1|  RabGAP/TBC domain-containing protein                    332   3e-106   Phaseolus vulgaris [French bean]
ref|XP_010445069.1|  PREDICTED: TBC1 domain family member 15-like...    333   4e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010047970.1|  PREDICTED: TBC1 domain family member 15            333   4e-106   Eucalyptus grandis [rose gum]
ref|XP_011017816.1|  PREDICTED: TBC1 domain family member 15-like...    333   4e-106   Populus euphratica
ref|XP_011017818.1|  PREDICTED: TBC1 domain family member 15-like...    333   5e-106   Populus euphratica
ref|XP_010323291.1|  PREDICTED: GTPase-activating protein gyp7          333   5e-106   Solanum lycopersicum
ref|XP_010241554.1|  PREDICTED: TBC1 domain family member 17 isof...    334   5e-106   Nelumbo nucifera [Indian lotus]
gb|KJB54007.1|  hypothetical protein B456_009G016100                    333   6e-106   Gossypium raimondii
ref|XP_008362894.1|  PREDICTED: TBC1 domain family member 17-like       332   6e-106   
ref|XP_006358298.1|  PREDICTED: GTPase-activating protein gyp7-like     333   8e-106   Solanum tuberosum [potatoes]
ref|XP_010241555.1|  PREDICTED: TBC1 domain family member 17 isof...    333   8e-106   Nelumbo nucifera [Indian lotus]
ref|XP_011084120.1|  PREDICTED: TBC1 domain family member 15            332   9e-106   Sesamum indicum [beniseed]
emb|CDP10442.1|  unnamed protein product                                333   1e-105   Coffea canephora [robusta coffee]
ref|XP_009363991.1|  PREDICTED: TBC1 domain family member 15            332   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_011017820.1|  PREDICTED: TBC1 domain family member 17-like...    331   1e-105   Populus euphratica
gb|EYU18249.1|  hypothetical protein MIMGU_mgv1a002604mg                331   2e-105   Erythranthe guttata [common monkey flower]
ref|XP_004251725.1|  PREDICTED: TBC1 domain family member 17-like       331   2e-105   Solanum lycopersicum
ref|XP_006345222.1|  PREDICTED: TBC1 domain family member 15-like       331   3e-105   Solanum tuberosum [potatoes]
ref|XP_011020167.1|  PREDICTED: TBC1 domain family member 15            331   3e-105   Populus euphratica
gb|AIU48681.1|  RabGAP/TBC domain-containing protein                    330   4e-105   Vitis vinifera
ref|XP_002527173.1|  conserved hypothetical protein                     330   4e-105   
ref|NP_200071.2|  RabGAP/TBC domain-containing protein                  331   4e-105   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48680.1|  RabGAP/TBC domain-containing protein                    329   6e-105   Schrenkiella parvula
ref|NP_001190524.1|  RabGAP/TBC domain-containing protein               331   6e-105   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26862.1|  hypothetical protein AALP_AA8G303600                    330   7e-105   Arabis alpina [alpine rockcress]
gb|AIU48654.1|  RabGAP/TBC domain-containing protein                    329   7e-105   Citrus sinensis [apfelsine]
gb|AIU48647.1|  RabGAP/TBC domain-containing protein                    328   9e-105   Theobroma cacao [chocolate]
gb|AIU48658.1|  RabGAP/TBC domain-containing protein                    328   2e-104   Buxus sinica
gb|KJB64719.1|  hypothetical protein B456_010G061900                    328   2e-104   Gossypium raimondii
gb|AIU48650.1|  RabGAP/TBC domain-containing protein                    328   2e-104   Citrus clementina [clementine]
gb|AIU48640.1|  RabGAP/TBC domain-containing protein                    327   6e-104   Arabidopsis lyrata [lyrate rockcress]
gb|AIU48653.1|  RabGAP/TBC domain-containing protein                    327   6e-104   Capsella rubella
gb|AIU48670.1|  RabGAP/TBC domain-containing protein                    326   8e-104   Populus trichocarpa [western balsam poplar]
gb|AIU48666.1|  RabGAP/TBC domain-containing protein                    326   9e-104   Medicago truncatula
gb|AIU48675.1|  RabGAP/TBC domain-containing protein                    325   1e-103   Ricinus communis
ref|XP_009593351.1|  PREDICTED: TBC1 domain family member 15 isof...    323   2e-103   
gb|AIU48682.1|  RabGAP/TBC domain-containing protein                    316   3e-103   Lactuca sativa [cultivated lettuce]
ref|XP_008785780.1|  PREDICTED: TBC1 domain family member 15            325   7e-103   Phoenix dactylifera
gb|AIU48668.1|  RabGAP/TBC domain-containing protein                    323   8e-103   Manihot esculenta [manioc]
ref|XP_010911930.1|  PREDICTED: TBC1 domain family member 17 isof...    321   8e-103   Elaeis guineensis
ref|XP_009789610.1|  PREDICTED: TBC1 domain family member 15-like...    321   1e-102   Nicotiana sylvestris
gb|KJB27078.1|  hypothetical protein B456_004G276400                    323   2e-102   Gossypium raimondii
ref|XP_004173869.1|  PREDICTED: TBC1 domain family member 15-like       308   2e-102   
gb|KJB27077.1|  hypothetical protein B456_004G276400                    323   2e-102   Gossypium raimondii
gb|AIU48649.1|  RabGAP/TBC domain-containing protein                    313   3e-102   Sarcandra glabra
ref|XP_009593349.1|  PREDICTED: TBC1 domain family member 17 isof...    323   3e-102   Nicotiana tomentosiformis
gb|AIU48639.1|  RabGAP/TBC domain-containing protein                    322   3e-102   Aquilegia coerulea [Rocky Mountain columbine]
ref|XP_010911929.1|  PREDICTED: TBC1 domain family member 15 isof...    323   3e-102   Elaeis guineensis
gb|KJB27079.1|  hypothetical protein B456_004G276400                    323   4e-102   Gossypium raimondii
gb|AIU48655.1|  RabGAP/TBC domain-containing protein                    322   4e-102   Eucalyptus grandis [rose gum]
gb|AIU48641.1|  RabGAP/TBC domain-containing protein                    322   4e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287286.1|  PREDICTED: TBC1 domain family member 15            322   5e-102   Fragaria vesca subsp. vesca
gb|AIU48669.1|  RabGAP/TBC domain-containing protein                    321   7e-102   Erythranthe guttata [common monkey flower]
gb|AIU48652.1|  RabGAP/TBC domain-containing protein                    321   1e-101   Carica papaya [mamon]
gb|KHG01737.1|  TBC1 domain family member 15                            322   1e-101   Gossypium arboreum [tree cotton]
ref|XP_007204093.1|  hypothetical protein PRUPE_ppa002904mg             320   1e-101   
ref|XP_009789608.1|  PREDICTED: TBC1 domain family member 17-like...    322   2e-101   Nicotiana sylvestris
ref|XP_008242808.1|  PREDICTED: TBC1 domain family member 17            321   2e-101   Prunus mume [ume]
gb|AIU48667.1|  RabGAP/TBC domain-containing protein                    320   2e-101   Canna indica [canna]
ref|XP_008377303.1|  PREDICTED: TBC1 domain family member 17            320   7e-101   
gb|AIU48644.1|  RabGAP/TBC domain-containing protein                    308   1e-100   Musa acuminata [banana]
gb|AIU48691.1|  RabGAP/TBC domain-containing protein                    311   1e-100   Cabomba caroliniana
gb|AIU48662.1|  RabGAP/TBC domain-containing protein                    317   4e-100   Chimonanthus praecox [wintersweet]
ref|XP_008456989.1|  PREDICTED: TBC1 domain family member 15            317   9e-100   Cucumis melo [Oriental melon]
gb|AIU48671.1|  RabGAP/TBC domain-containing protein                    315   9e-100   Prunus persica
ref|XP_009420718.1|  PREDICTED: TBC1 domain family member 15            316   2e-99    
gb|AIU48690.1|  RabGAP/TBC domain-containing protein                    315   2e-99    Trachycarpus fortunei
gb|AIU48648.1|  RabGAP/TBC domain-containing protein                    312   2e-99    Acorus calamus [flagroot]
gb|AIU48645.1|  RabGAP/TBC domain-containing protein                    314   3e-99    Pinellia ternata
ref|XP_004139297.1|  PREDICTED: TBC1 domain family member 15-like       315   4e-99    Cucumis sativus [cucumbers]
gb|AIU48660.1|  RabGAP/TBC domain-containing protein                    313   9e-99    Chloranthus japonicus
gb|AIU48651.1|  RabGAP/TBC domain-containing protein                    313   1e-98    Gossypium raimondii
ref|XP_011469988.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    313   2e-98    Fragaria vesca subsp. vesca
gb|AIU48677.1|  RabGAP/TBC domain-containing protein                    312   2e-98    Yucca filamentosa [Adam's-needle]
gb|AIU48664.1|  RabGAP/TBC domain-containing protein                    311   3e-98    Asparagus officinalis
gb|AIU48657.1|  RabGAP/TBC domain-containing protein                    311   6e-98    Illicium henryi
gb|AIU48686.1|  RabGAP/TBC domain-containing protein                    310   1e-97    Ginkgo biloba [ginkgo]
gb|AIU48684.1|  RabGAP/TBC domain-containing protein                    308   2e-97    Cinnamomum camphora
gb|AIU48687.1|  RabGAP/TBC domain-containing protein                    309   3e-97    Houttuynia cordata [chameleon-plant]
gb|AIU48665.1|  RabGAP/TBC domain-containing protein                    308   7e-97    Aristolochia tagala
ref|XP_010687933.1|  PREDICTED: TBC1 domain family member 15 isof...    308   8e-97    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010687932.1|  PREDICTED: TBC1 domain family member 15 isof...    309   9e-97    Beta vulgaris subsp. vulgaris [field beet]
gb|AIU48676.1|  RabGAP/TBC domain-containing protein                    308   1e-96    Dioscorea oppositifolia
gb|AIU48642.1|  RabGAP/TBC domain-containing protein                    305   8e-96    Lilium brownii [Hong Kong lily]
gb|AIU48661.1|  RabGAP/TBC domain-containing protein                    304   2e-95    Ceratophyllum demersum [hornwort]
gb|AIU48683.1|  RabGAP/TBC domain-containing protein                    304   2e-95    Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU48689.1|  RabGAP/TBC domain-containing protein                    303   1e-94    Alisma plantago-aquatica
gb|AIU48659.1|  RabGAP/TBC domain-containing protein                    300   9e-94    Iris japonica
ref|XP_006647781.1|  PREDICTED: TBC1 domain family member 15-like       299   3e-93    Oryza brachyantha
gb|AIU48688.1|  RabGAP/TBC domain-containing protein                    293   3e-93    Zea mays [maize]
gb|KDP30256.1|  hypothetical protein JCGZ_17038                         300   5e-93    Jatropha curcas
gb|AIU48672.1|  RabGAP/TBC domain-containing protein                    297   1e-92    Panicum virgatum
gb|AIU48679.1|  RabGAP/TBC domain-containing protein                    296   2e-92    Sorghum bicolor [broomcorn]
ref|XP_004953647.1|  PREDICTED: TBC1 domain family member 15-like       298   2e-92    Setaria italica
gb|AIU48678.1|  RabGAP/TBC domain-containing protein                    296   2e-92    Setaria italica
ref|XP_002452666.1|  hypothetical protein SORBIDRAFT_04g030250          296   9e-92    
gb|AIU48646.1|  RabGAP/TBC domain-containing protein                    294   2e-91    Brachypodium distachyon [annual false brome]
ref|XP_003570212.1|  PREDICTED: TBC1 domain family member 15            295   2e-91    Brachypodium distachyon [annual false brome]
ref|XP_006855176.1|  hypothetical protein AMTR_s00051p00106780          295   3e-91    Amborella trichopoda
ref|NP_001168835.1|  uncharacterized protein LOC100382640               294   4e-91    Zea mays [maize]
gb|AIU48643.1|  RabGAP/TBC domain-containing protein                    293   7e-91    Magnolia denudata [haku-mokuren]
ref|NP_001047892.1|  Os02g0709800                                       291   1e-89    
ref|XP_001783529.1|  predicted protein                                  282   2e-88    
dbj|BAK05291.1|  predicted protein                                      283   8e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002972350.1|  hypothetical protein SELMODRAFT_97576              266   6e-84    
ref|XP_002971826.1|  hypothetical protein SELMODRAFT_96534              266   6e-84    
ref|XP_010112474.1|  TBC1 domain family member 15                       264   7e-81    
gb|EMT03185.1|  TBC1 domain family member 15                            253   3e-76    
gb|EEC73873.1|  hypothetical protein OsI_08649                          244   5e-72    Oryza sativa Indica Group [Indian rice]
ref|XP_009789609.1|  PREDICTED: TBC1 domain family member 17-like...    235   4e-69    Nicotiana sylvestris
ref|XP_009593350.1|  PREDICTED: TBC1 domain family member 17 isof...    234   1e-68    Nicotiana tomentosiformis
gb|EMS58117.1|  TBC1 domain family member 15                            219   2e-63    Triticum urartu
emb|CBI28233.3|  unnamed protein product                                171   2e-49    Vitis vinifera
ref|XP_001692974.1|  RabGAP/TBC protein                                 173   2e-48    Chlamydomonas reinhardtii
ref|XP_005649420.1|  RabGAP/TBC                                         178   9e-48    Coccomyxa subellipsoidea C-169
gb|ABK92630.1|  unknown                                                 164   3e-47    Populus trichocarpa [western balsam poplar]
emb|CEG81743.1|  hypothetical protein RMATCC62417_15905                 174   3e-46    Rhizopus microsporus
ref|XP_002609518.1|  hypothetical protein BRAFLDRAFT_95612              169   2e-45    Branchiostoma floridae
emb|CEG74578.1|  hypothetical protein RMATCC62417_09764                 172   3e-45    Rhizopus microsporus
emb|CEG74577.1|  hypothetical protein RMATCC62417_09764                 172   3e-45    Rhizopus microsporus
emb|CEI91235.1|  hypothetical protein RMCBS344292_05533                 171   7e-45    Rhizopus microsporus
gb|KIM49181.1|  hypothetical protein M413DRAFT_438347                   170   2e-44    Hebeloma cylindrosporum h7
emb|CEI91236.1|  hypothetical protein RMCBS344292_05534                 166   2e-44    Rhizopus microsporus
emb|CEI91237.1|  hypothetical protein RMCBS344292_05534                 166   2e-44    Rhizopus microsporus
ref|XP_007764671.1|  GTPase-activating protein gyp7                     169   4e-44    Coniophora puteana RWD-64-598 SS2
ref|XP_009542802.1|  hypothetical protein HETIRDRAFT_471290             169   4e-44    Heterobasidion irregulare TC 32-1
gb|EPS74110.1|  hypothetical protein M569_00644                         159   4e-44    Genlisea aurea
gb|EPT06212.1|  hypothetical protein FOMPIDRAFT_1110507                 168   6e-44    Fomitopsis pinicola FP-58527 SS1
ref|XP_006633652.1|  PREDICTED: TBC1 domain family member 15-like       167   9e-44    
gb|KIO13611.1|  hypothetical protein M404DRAFT_993164                   168   9e-44    Pisolithus tinctorius Marx 270
gb|KIM21739.1|  hypothetical protein M408DRAFT_29311                    167   1e-43    Serendipita vermifera MAFF 305830
ref|XP_003848770.1|  hypothetical protein MYCGRDRAFT_76044              168   1e-43    Zymoseptoria tritici IPO323
gb|KIM62089.1|  hypothetical protein SCLCIDRAFT_1178195                 167   1e-43    Scleroderma citrinum Foug A
gb|EMD38374.1|  hypothetical protein CERSUDRAFT_113536                  167   1e-43    Gelatoporia subvermispora B
gb|KDQ60762.1|  hypothetical protein JAAARDRAFT_204574                  167   2e-43    Jaapia argillacea MUCL 33604
gb|KFH67583.1|  hypothetical protein MVEG_06315                         167   2e-43    Mortierella verticillata NRRL 6337
gb|KII88599.1|  hypothetical protein PLICRDRAFT_41787                   167   2e-43    Plicaturopsis crispa FD-325 SS-3
ref|XP_007805043.1|  hypothetical protein EPUS_03989                    169   2e-43    Endocarpon pusillum Z07020
ref|XP_010656460.1|  PREDICTED: GTPase-activating protein GYP7-like     154   2e-43    Vitis vinifera
emb|CCA66945.1|  probable GTPase activating protein                     166   2e-43    Serendipita indica DSM 11827
gb|EWC44833.1|  hypothetical protein DRE_06471                          166   3e-43    Drechslerella stenobrocha 248
ref|XP_007385727.1|  RabGAP/TBC                                         167   3e-43    Punctularia strigosozonata HHB-11173 SS5
emb|CAN75817.1|  hypothetical protein VITISV_033040                     153   3e-43    Vitis vinifera
gb|KDR81554.1|  hypothetical protein GALMADRAFT_221417                  166   4e-43    Galerina marginata CBS 339.88
gb|EPB92968.1|  hypothetical protein HMPREF1544_00042                   166   4e-43    Mucor circinelloides f. circinelloides 1006PhL
gb|KIP09589.1|  hypothetical protein PHLGIDRAFT_67361                   166   5e-43    Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_002950778.1|  hypothetical protein VOLCADRAFT_60703              159   5e-43    Volvox carteri f. nagariensis
emb|CCX13007.1|  Similar to GTPase-activating protein GYP7; acc. ...    166   5e-43    Pyronema omphalodes CBS 100304
ref|XP_009063579.1|  hypothetical protein LOTGIDRAFT_221303             164   5e-43    Lottia gigantea
dbj|GAN09723.1|  GTPase activating protein (Gyp7)                       166   6e-43    Mucor ambiguus
gb|KIO32502.1|  hypothetical protein M407DRAFT_241400                   165   6e-43    Tulasnella calospora MUT 4182
ref|XP_007776922.1|  hypothetical protein W97_00820                     166   6e-43    Coniosporium apollinis CBS 100218
ref|XP_011448760.1|  PREDICTED: TBC1 domain family member 15-like...    164   7e-43    Crassostrea gigas
gb|EKG21073.1|  hypothetical protein MPH_01617                          166   7e-43    Macrophomina phaseolina MS6
ref|XP_011111334.1|  hypothetical protein H072_5454                     165   7e-43    
ref|XP_011448761.1|  PREDICTED: TBC1 domain family member 15-like...    164   7e-43    Crassostrea gigas
gb|EPS72188.1|  hypothetical protein M569_02568                         153   8e-43    Genlisea aurea
ref|XP_007300987.1|  RabGAP/TBC                                         165   8e-43    Stereum hirsutum FP-91666 SS1
gb|KIK30947.1|  hypothetical protein PISMIDRAFT_86279                   165   8e-43    Pisolithus microcarpus 441
ref|XP_007361169.1|  RabGAP/TBC                                         165   9e-43    Dichomitus squalens LYAD-421 SS1
ref|XP_008045239.1|  RabGAP/TBC                                         165   1e-42    Trametes versicolor FP-101664 SS1
ref|XP_006458178.1|  hypothetical protein AGABI2DRAFT_183265            167   1e-42    Agaricus bisporus var. bisporus H97
ref|XP_007862850.1|  RabGAP/TBC                                         166   1e-42    Gloeophyllum trabeum ATCC 11539
ref|XP_007326252.1|  hypothetical protein AGABI1DRAFT_68626             167   1e-42    Agaricus bisporus var. burnettii JB137-S8
ref|XP_007345802.1|  RabGAP/TBC                                         165   1e-42    
dbj|GAM83758.1|  hypothetical protein ANO11243_017480                   164   2e-42    fungal sp. No.11243
gb|KIK08687.1|  hypothetical protein K443DRAFT_84333                    164   2e-42    Laccaria amethystina LaAM-08-1
emb|CEG04196.1|  unnamed protein product                                164   2e-42    Fusarium sp. FIESC_5 CS3069
gb|KJA20210.1|  hypothetical protein HYPSUDRAFT_167151                  164   2e-42    Hypholoma sublateritium FD-334 SS-4
gb|EIE81059.1|  hypothetical protein RO3G_05764                         163   2e-42    Rhizopus delemar RA 99-880
ref|XP_011121238.1|  hypothetical protein AOL_s00076g384                164   2e-42    Arthrobotrys oligospora ATCC 24927
ref|XP_007684557.1|  hypothetical protein COCMIDRAFT_85923              164   3e-42    Bipolaris oryzae ATCC 44560
gb|KIY69995.1|  RabGAP/TBC                                              164   4e-42    Cylindrobasidium torrendii FP15055 ss-10
gb|KIL69693.1|  hypothetical protein M378DRAFT_1048890                  163   4e-42    Amanita muscaria Koide BX008
gb|KDO80161.1|  hypothetical protein CISIN_1g005652mg                   161   4e-42    Citrus sinensis [apfelsine]
ref|XP_001642096.1|  predicted protein                                  160   4e-42    Nematostella vectensis
gb|EJU05764.1|  RabGAP/TBC                                              163   4e-42    Dacryopinax primogenitus
ref|XP_001875369.1|  predicted protein                                  163   5e-42    Laccaria bicolor S238N-H82
gb|KDO80160.1|  hypothetical protein CISIN_1g005652mg                   161   5e-42    Citrus sinensis [apfelsine]
gb|KEP45951.1|  GTPase-activating protein Gyp7                          163   6e-42    Rhizoctonia solani 123E
gb|EME47991.1|  hypothetical protein DOTSEDRAFT_69807                   163   6e-42    Dothistroma septosporum NZE10
ref|XP_007705031.1|  hypothetical protein COCSADRAFT_127796             162   7e-42    Bipolaris sorokiniana ND90Pr
gb|KFA46459.1|  hypothetical protein S40293_04279                       162   7e-42    Stachybotrys chartarum IBT 40293
gb|KEY73259.1|  hypothetical protein S7711_01380                        162   8e-42    Stachybotrys chartarum IBT 7711
gb|EUN32280.1|  hypothetical protein COCVIDRAFT_22116                   162   8e-42    Bipolaris victoriae FI3
gb|KFA60970.1|  hypothetical protein S40285_02773                       162   8e-42    Stachybotrys chlorohalonata IBT 40285
ref|XP_009258695.1|  hypothetical protein FPSE_07302                    162   8e-42    Fusarium pseudograminearum CS3096
ref|XP_007707138.1|  hypothetical protein COCCADRAFT_772                162   8e-42    Bipolaris zeicola 26-R-13
gb|KIJ69240.1|  hypothetical protein HYDPIDRAFT_105840                  162   9e-42    Hydnomerulius pinastri MD-312
ref|XP_011323699.1|  GTPase-activating protein GYP7                     162   9e-42    Fusarium graminearum PH-1
ref|XP_005833659.1|  hypothetical protein GUITHDRAFT_70335              157   9e-42    Guillardia theta CCMP2712
ref|XP_007054875.1|  PREDICTED: TBC1 domain family member 15            161   1e-41    
emb|CEP17529.1|  hypothetical protein                                   162   1e-41    Parasitella parasitica
ref|XP_007267802.1|  RabGAP/TBC                                         162   1e-41    Fomitiporia mediterranea MF3/22
ref|XP_007676059.1|  hypothetical protein BAUCODRAFT_33679              162   1e-41    Baudoinia panamericana UAMH 10762
ref|XP_002117757.1|  hypothetical protein TRIADDRAFT_38489              159   1e-41    Trichoplax adhaerens
gb|ENI06740.1|  hypothetical protein COCC4DRAFT_192817                  162   1e-41    Bipolaris maydis ATCC 48331
gb|KIV99936.1|  hypothetical protein PV09_08456                         162   1e-41    Verruconis gallopava
ref|XP_010312019.1|  PREDICTED: TBC1 domain family member 15            156   1e-41    Balearica regulorum gibbericeps
ref|XP_007395913.1|  hypothetical protein PHACADRAFT_173743             162   2e-41    Phanerochaete carnosa HHB-10118-sp
ref|XP_003302157.1|  hypothetical protein PTT_13880                     162   2e-41    
gb|KIM87015.1|  hypothetical protein PILCRDRAFT_95906                   162   2e-41    Piloderma croceum F 1598
ref|XP_010752960.1|  PREDICTED: TBC1 domain family member 15 isof...    160   2e-41    
ref|XP_010752961.1|  PREDICTED: TBC1 domain family member 15 isof...    160   2e-41    
gb|KEQ79017.1|  RabGAP/TBC                                              161   2e-41    Aureobasidium pullulans EXF-150
gb|EFX01643.1|  GTPase activating protein                               162   2e-41    Grosmannia clavigera kw1407
ref|XP_009223960.1|  GTPase-activating protein GYP7                     162   2e-41    Gaeumannomyces tritici R3-111a-1
gb|EPE09161.1|  gtpase-activating protein gyp7                          162   2e-41    Ophiostoma piceae UAMH 11346
ref|XP_010890362.1|  PREDICTED: TBC1 domain family member 15-like       160   2e-41    
ref|XP_008023866.1|  hypothetical protein SETTUDRAFT_168350             161   2e-41    Exserohilum turcica Et28A
ref|XP_003292326.1|  hypothetical protein DICPUDRAFT_89768              161   2e-41    Dictyostelium purpureum
ref|XP_009848362.1|  GTPase-activating protein GYP7                     161   2e-41    Neurospora tetrasperma FGSC 2508
gb|KIH87159.1|  GTPase-activating protein GYP7                          162   2e-41    Sporothrix brasiliensis 5110
gb|KIK59737.1|  hypothetical protein GYMLUDRAFT_44173                   161   3e-41    Gymnopus luxurians FD-317 M1
ref|XP_001911856.1|  hypothetical protein                               161   3e-41    Podospora anserina S mat+
ref|XP_007847684.1|  gtpase-activating protein gyp7                     161   3e-41    
emb|CCM02409.1|  predicted protein                                      161   3e-41    Fibroporia radiculosa
gb|KJB64721.1|  hypothetical protein B456_010G061900                    159   3e-41    Gossypium raimondii
gb|EMF15935.1|  RabGAP/TBC                                              161   3e-41    Sphaerulina musiva SO2202
gb|ERS95154.1|  hypothetical protein HMPREF1624_08364                   161   3e-41    Sporothrix schenckii ATCC 58251
ref|XP_007586932.1|  putative gtpase-activating protein gyp7 protein    160   3e-41    
ref|XP_003050169.1|  predicted protein                                  161   3e-41    [Nectria] haematococca mpVI 77-13-4
gb|KIM95971.1|  hypothetical protein OIDMADRAFT_183435                  161   3e-41    Oidiodendron maius Zn
gb|EHK41792.1|  hypothetical protein TRIATDRAFT_147224                  160   3e-41    Trichoderma atroviride IMI 206040
ref|XP_003719772.1|  GTPase-activating protein GYP7                     161   4e-41    Magnaporthe oryzae 70-15
ref|XP_960741.3|  GTPase-activating protein GYP7                        161   4e-41    Neurospora crassa OR74A
gb|KIK49290.1|  hypothetical protein CY34DRAFT_797241                   161   4e-41    Suillus luteus UH-Slu-Lm8-n1
emb|CAC18154.2|  probable GTPase activating protein                     161   4e-41    Neurospora crassa
emb|CAB75666.1|  hypothetical protein                                   152   4e-41    Homo sapiens [man]
ref|XP_004069404.1|  PREDICTED: TBC1 domain family member 15            159   4e-41    Oryzias latipes [Japanese rice fish]
gb|KFW83412.1|  TBC1 domain family member 15                            159   5e-41    Manacus vitellinus
emb|CDO69529.1|  hypothetical protein BN946_scf184785.g34               160   5e-41    Trametes cinnabarina
gb|KDQ18528.1|  hypothetical protein BOTBODRAFT_127404                  160   5e-41    Botryobasidium botryosum FD-172 SS1
gb|ENH88280.1|  GTPase-activating protein gyp7                          160   5e-41    
ref|XP_006696481.1|  GTPase-activating protein gyp7-like protein        160   5e-41    Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_008501845.1|  PREDICTED: TBC1 domain family member 15-like       152   5e-41    Calypte anna
gb|ELR08750.1|  hypothetical protein GMDG_03429                         160   6e-41    Pseudogymnoascus destructans 20631-21
gb|EMR80986.1|  putative gtpase-activating protein gyp7 protein         160   7e-41    Botrytis cinerea BcDW1
ref|XP_006026311.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    159   7e-41    Alligator sinensis
ref|XP_006258530.1|  PREDICTED: TBC1 domain family member 15            159   7e-41    
ref|XP_002911878.1|  GTPase-activating protein gyp7                     160   7e-41    
ref|XP_007284657.1|  GTPase-activating protein gyp7                     160   8e-41    
gb|KEQ99263.1|  hypothetical protein AUEXF2481DRAFT_409411              159   8e-41    
ref|XP_008925123.1|  PREDICTED: TBC1 domain family member 15            159   9e-41    
gb|EIE92219.1|  hypothetical protein RO3G_17026                         158   9e-41    
ref|XP_007321851.1|  hypothetical protein SERLADRAFT_452033             159   1e-40    
ref|XP_006121609.1|  PREDICTED: TBC1 domain family member 15 isof...    158   1e-40    
ref|XP_007293593.1|  GTPase-activating protein GYP7                     159   1e-40    
ref|XP_008083948.1|  Ypt/Rab-GAP of gyp1p                               160   1e-40    
ref|XP_003352101.1|  hypothetical protein SMAC_02536                    159   1e-40    
ref|XP_005039952.1|  PREDICTED: TBC1 domain family member 15            158   1e-40    
gb|EFQ29904.1|  GTPase-activating protein GYP7                          159   1e-40    
ref|XP_007822425.1|  RasGAP protein                                     159   1e-40    
ref|XP_003662116.1|  hypothetical protein MYCTH_2302291                 160   1e-40    
gb|EGN95360.1|  hypothetical protein SERLA73DRAFT_162269                159   1e-40    
gb|KFU93704.1|  TBC1 domain family member 15                            157   1e-40    
gb|EXK97364.1|  hypothetical protein FOQG_02584                         159   1e-40    
ref|XP_005305159.1|  PREDICTED: TBC1 domain family member 15 isof...    158   1e-40    
gb|KEZ44130.1|  GTPase-activating protein GYP7                          159   1e-40    
ref|XP_005514233.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    158   1e-40    
gb|KID94181.1|  Rab-GAP/TBC domain protein                              159   1e-40    
ref|XP_009808653.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    156   1e-40    
gb|KFG86284.1|  putative GTPase activating protein                      159   1e-40    
gb|EXK97365.1|  hypothetical protein FOQG_02584                         159   1e-40    
gb|KID79339.1|  Rab-GAP/TBC domain protein                              159   1e-40    
ref|XP_004316834.1|  PREDICTED: TBC1 domain family member 15-like       153   1e-40    
ref|XP_006121607.1|  PREDICTED: TBC1 domain family member 15 isof...    158   1e-40    
ref|XP_006121608.1|  PREDICTED: TBC1 domain family member 15 isof...    157   1e-40    
gb|EXU95631.1|  Rab GTPase-TBC domain protein                           159   2e-40    
ref|XP_005305158.1|  PREDICTED: TBC1 domain family member 15 isof...    157   2e-40    
ref|XP_009085252.1|  PREDICTED: TBC1 domain family member 15            157   2e-40    
gb|KIL91611.1|  hypothetical protein FAVG1_05228                        159   2e-40    
ref|XP_009484857.1|  PREDICTED: TBC1 domain family member 15            156   2e-40    
gb|EXK45381.1|  hypothetical protein FOMG_03838                         159   2e-40    
gb|EWZ48057.1|  hypothetical protein FOZG_03761                         159   2e-40    
gb|KFZ52722.1|  TBC1 domain family member 15                            156   2e-40    
gb|EWZ01992.1|  hypothetical protein FOYG_01424                         159   2e-40    
gb|EWZ48058.1|  hypothetical protein FOZG_03761                         159   2e-40    
gb|KFZ23787.1|  hypothetical protein V502_01744                         159   2e-40    
gb|KFY87267.1|  hypothetical protein V500_07070                         159   2e-40    
gb|KFY49624.1|  hypothetical protein V495_00520                         159   2e-40    
gb|KFX86963.1|  hypothetical protein V490_08692                         159   2e-40    
ref|XP_003798993.1|  PREDICTED: TBC1 domain family member 15 isof...    157   2e-40    
ref|XP_003036056.1|  hypothetical protein SCHCODRAFT_65991              159   2e-40    
gb|KID91980.1|  Rab-GAP/TBC domain protein                              159   2e-40    
ref|XP_010001382.1|  PREDICTED: TBC1 domain family member 15            157   2e-40    
gb|EQB54704.1|  GTPase-activating protein GYP7                          160   2e-40    
ref|XP_005480662.1|  PREDICTED: TBC1 domain family member 15            157   2e-40    
gb|EWZ01993.1|  hypothetical protein FOYG_01424                         159   2e-40    
gb|EXK45382.1|  hypothetical protein FOMG_03838                         159   2e-40    
ref|XP_010176692.1|  PREDICTED: TBC1 domain family member 15            156   2e-40    
emb|CCT67233.1|  probable GTPase activating protein                     159   2e-40    
gb|EXA42369.1|  hypothetical protein FOVG_07627                         159   2e-40    
ref|XP_001590252.1|  hypothetical protein SS1G_09016                    160   2e-40    
gb|EXM25992.1|  hypothetical protein FOTG_07675                         159   2e-40    
gb|KFP37050.1|  TBC1 domain family member 15                            157   2e-40    
gb|EXM25993.1|  hypothetical protein FOTG_07675                         158   3e-40    
gb|EXA42370.1|  hypothetical protein FOVG_07627                         158   3e-40    
gb|EXM06665.1|  hypothetical protein FOIG_03387                         158   3e-40    
ref|XP_003798994.1|  PREDICTED: TBC1 domain family member 15 isof...    157   3e-40    
ref|XP_009863167.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    156   3e-40    
gb|EMT68461.1|  GTPase-activating protein GYP7                          158   3e-40    
ref|XP_010123979.1|  PREDICTED: TBC1 domain family member 15            157   3e-40    
ref|XP_007923993.1|  hypothetical protein MYCFIDRAFT_162455             158   3e-40    
gb|ENH68472.1|  GTPase-activating protein GYP7                          158   3e-40    
gb|KFY71427.1|  hypothetical protein V499_08379                         159   3e-40    
gb|KIK93712.1|  hypothetical protein PAXRUDRAFT_144473                  158   3e-40    
gb|KFQ50653.1|  TBC1 domain family member 15                            156   3e-40    
ref|XP_010014050.1|  PREDICTED: TBC1 domain family member 15            156   3e-40    
dbj|GAD91559.1|  GTPase activating protein (Gyp7), putative             158   4e-40    
ref|NP_989223.1|  TBC1 domain family member 15                          156   4e-40    
ref|XP_010706484.1|  PREDICTED: TBC1 domain family member 15            156   4e-40    
ref|XP_007602678.1|  GTPase-activating protein GYP7                     158   4e-40    
ref|XP_010078295.1|  PREDICTED: TBC1 domain family member 15            156   4e-40    
gb|KFY17694.1|  hypothetical protein V492_00470                         159   4e-40    
ref|XP_008631121.1|  PREDICTED: TBC1 domain family member 15            156   4e-40    
gb|EKV12198.1|  hypothetical protein PDIG_45230                         157   4e-40    
gb|KFZ14516.1|  hypothetical protein V501_03215                         158   4e-40    
gb|KFO58466.1|  TBC1 domain family member 15                            156   4e-40    
ref|XP_007664518.1|  PREDICTED: TBC1 domain family member 15            156   4e-40    
ref|XP_009975733.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
gb|AAH76966.1|  TBC1 domain family, member 15                           156   5e-40    
ref|XP_002190300.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
ref|XP_010285040.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
ref|XP_009271513.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
ref|XP_009069186.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    156   5e-40    
gb|KGL95544.1|  TBC1 domain family member 15                            156   5e-40    
gb|KIW75834.1|  hypothetical protein Z517_10579                         158   5e-40    
gb|KFV12457.1|  TBC1 domain family member 15                            156   5e-40    
gb|KFV88938.1|  TBC1 domain family member 15                            156   5e-40    
gb|KFP76577.1|  TBC1 domain family member 15                            156   5e-40    
ref|XP_009461518.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    156   5e-40    
gb|KFQ74636.1|  TBC1 domain family member 15                            156   5e-40    
ref|XP_009658420.1|  GTPase-activating protein GYP7                     157   5e-40    
gb|KFV67974.1|  TBC1 domain family member 15                            156   5e-40    
ref|XP_009946918.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
gb|KFP22081.1|  TBC1 domain family member 15                            156   5e-40    
gb|KFY32446.1|  hypothetical protein V493_00179                         157   5e-40    
ref|XP_005143065.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
ref|XP_009584974.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
ref|XP_009644606.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
ref|XP_005519422.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
gb|EOA97812.1|  TBC1 domain family member 15                            156   5e-40    
gb|KFM03402.1|  TBC1 domain family member 15                            156   5e-40    
gb|ESZ91462.1|  GTPase-activating protein GYP7                          158   5e-40    
ref|XP_009899605.1|  PREDICTED: TBC1 domain family member 15            156   5e-40    
gb|EHK26045.1|  hypothetical protein TRIVIDRAFT_79653                   157   5e-40    
gb|EIE80740.1|  hypothetical protein RO3G_05445                         152   5e-40    
gb|KFZ49120.1|  TBC1 domain family member 15                            156   6e-40    
ref|XP_010560090.1|  PREDICTED: TBC1 domain family member 15 isof...    155   6e-40    
ref|XP_008717453.1|  hypothetical protein HMPREF1541_04887              157   6e-40    
gb|KFY33553.1|  hypothetical protein V494_07514                         157   6e-40    
gb|KDN68210.1|  putative GTPase-activating protein GYP7                 157   6e-40    
ref|XP_005419335.1|  PREDICTED: TBC1 domain family member 15            156   6e-40    
ref|XP_009667915.1|  PREDICTED: TBC1 domain family member 15            155   7e-40    
ref|XP_010131193.1|  PREDICTED: TBC1 domain family member 15            155   7e-40    
gb|KFQ85381.1|  TBC1 domain family member 15                            155   7e-40    
gb|KFV78597.1|  TBC1 domain family member 15                            155   7e-40    
ref|XP_005431957.1|  PREDICTED: TBC1 domain family member 15            155   7e-40    
ref|XP_003840393.1|  similar to GTPase-activating protein gyp7          157   7e-40    
ref|XP_009325940.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    155   7e-40    
gb|KFO87733.1|  TBC1 domain family member 15                            155   7e-40    
ref|XP_009504749.1|  PREDICTED: TBC1 domain family member 15            155   7e-40    
gb|KIW57240.1|  hypothetical protein PV05_05817                         157   7e-40    
gb|KFP53694.1|  TBC1 domain family member 15                            155   7e-40    
ref|XP_005024460.1|  PREDICTED: TBC1 domain family member 15            156   7e-40    
gb|KGO74275.1|  protein of unknown function DUF3548                     157   8e-40    
gb|KHN95685.1|  Rab-GAP/TBC domain protein                              157   8e-40    
ref|XP_007731781.1|  hypothetical protein A1O3_03453                    157   8e-40    
gb|KFQ10699.1|  TBC1 domain family member 15                            155   8e-40    
gb|KFY18154.1|  hypothetical protein V491_04839                         158   8e-40    
ref|XP_006964672.1|  RasGAP protein                                     157   8e-40    
ref|XP_010412149.1|  PREDICTED: TBC1 domain family member 15            157   8e-40    
gb|KFR06581.1|  TBC1 domain family member 15                            155   8e-40    
gb|KFY52836.1|  hypothetical protein V496_08122                         157   8e-40    
gb|ETS03039.1|  putative GTPase activating protein                      157   8e-40    
ref|XP_005242171.1|  PREDICTED: TBC1 domain family member 15            155   8e-40    
gb|KEF61744.1|  hypothetical protein A1O9_03314                         157   8e-40    
ref|XP_568367.1|  Rab GTPase activator                                  157   8e-40    
gb|KIX10380.1|  hypothetical protein Z518_01462                         157   9e-40    
emb|CDM37395.1|  GTPase-activating protein GYP7                         157   9e-40    
ref|XP_010560088.1|  PREDICTED: TBC1 domain family member 15 isof...    155   9e-40    
gb|EEH33536.2|  GTPase-activating protein GYP7                          157   9e-40    
ref|XP_009962025.1|  PREDICTED: TBC1 domain family member 15            155   9e-40    
gb|KFV47134.1|  TBC1 domain family member 15                            155   9e-40    
gb|KIW17270.1|  hypothetical protein PV08_04461                         157   1e-39    
ref|XP_010178473.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    155   1e-39    
ref|XP_009564626.1|  PREDICTED: TBC1 domain family member 15            155   1e-39    
gb|KIJ16899.1|  hypothetical protein PAXINDRAFT_168334                  157   1e-39    
ref|XP_004583095.1|  PREDICTED: TBC1 domain family member 15 isof...    155   1e-39    
gb|KJB27076.1|  hypothetical protein B456_004G276400                    155   1e-39    
ref|XP_007441051.1|  PREDICTED: TBC1 domain family member 15            155   1e-39    
ref|XP_009886127.1|  PREDICTED: TBC1 domain family member 15            156   1e-39    
gb|KFY03953.1|  hypothetical protein O988_01112                         158   1e-39    
ref|XP_008938492.1|  PREDICTED: TBC1 domain family member 21            154   1e-39    
gb|KFQ18609.1|  TBC1 domain family member 15                            154   1e-39    
ref|XP_636536.1|  RabGAP/TBC domain-containing protein                  156   1e-39    
ref|XP_005104242.1|  PREDICTED: TBC1 domain family member 15-like...    155   1e-39    
ref|XP_005104241.1|  PREDICTED: TBC1 domain family member 15-like...    155   1e-39    
gb|KDQ33241.1|  hypothetical protein PLEOSDRAFT_1060916                 158   1e-39    
dbj|GAN03755.1|  GTPase-activating protein GYP7                         156   1e-39    
ref|XP_007918529.1|  putative gtpase-activating protein gyp7 protein    156   1e-39    
ref|XP_009925542.1|  PREDICTED: LOW QUALITY PROTEIN: TBC1 domain ...    155   1e-39    
gb|KGO62085.1|  protein of unknown function DUF3548                     156   1e-39    
gb|EXX64804.1|  Gyp7p                                                   154   1e-39    
gb|KGO49159.1|  protein of unknown function DUF3548                     156   1e-39    
ref|XP_004583094.1|  PREDICTED: TBC1 domain family member 15 isof...    155   1e-39    
gb|KGL84754.1|  TBC1 domain family member 15                            155   2e-39    
gb|EXX64805.1|  Gyp7p                                                   154   2e-39    
ref|XP_010760538.1|  hypothetical protein PADG_11819                    156   2e-39    
dbj|GAA90625.1|  GTPase-activating protein Gyp7                         156   2e-39    
ref|XP_010223867.1|  PREDICTED: TBC1 domain family member 15            155   2e-39    
gb|EWG43354.1|  hypothetical protein FVEG_04864                         156   2e-39    
gb|EWG43355.1|  hypothetical protein FVEG_04864                         156   2e-39    
ref|XP_009929915.1|  PREDICTED: TBC1 domain family member 15            155   2e-39    
ref|XP_007950655.1|  PREDICTED: TBC1 domain family member 15 isof...    154   2e-39    
gb|KIV85239.1|  hypothetical protein PV11_00962                         156   2e-39    
ref|XP_001396696.1|  GTPase-activating protein gyp7                     156   2e-39    
ref|NP_001012827.1|  TBC1 domain family member 15                       154   2e-39    
emb|CCE29138.1|  probable GTPase activating protein                     155   2e-39    
ref|XP_001224860.1|  hypothetical protein CHGG_07204                    156   2e-39    
ref|XP_007950654.1|  PREDICTED: TBC1 domain family member 15 isof...    154   2e-39    
gb|EEH22146.1|  hypothetical protein PABG_04357                         155   3e-39    
ref|XP_002143396.1|  GTPase activating protein (Gyp7), putative         155   3e-39    
gb|KFH46971.1|  GTPase-activating protein-like protein                  155   3e-39    
ref|XP_003770985.1|  PREDICTED: TBC1 domain family member 15-like       154   3e-39    
gb|KFX49045.1|  GTPase-activating protein GYP7                          155   3e-39    
ref|XP_004338737.1|  TBC domain containing protein                      152   3e-39    
gb|KEQ65027.1|  RabGAP/TBC                                              155   3e-39    
ref|XP_007503117.1|  PREDICTED: TBC1 domain family member 15 isof...    154   3e-39    
gb|EUC67275.1|  GTPase-activating protein GYP7                          155   3e-39    
gb|KDN51536.1|  hypothetical protein RSAG8_00081                        155   3e-39    
dbj|BAE00843.1|  unnamed protein product                                152   3e-39    
gb|EDL21763.1|  TBC1 domain family, member 15                           154   3e-39    
ref|XP_007743419.1|  hypothetical protein A1O5_04625                    155   3e-39    
ref|XP_001934026.1|  GTPase-activating protein GYP7                     154   3e-39    
ref|XP_008255015.1|  PREDICTED: TBC1 domain family member 15            154   3e-39    
gb|KIY50870.1|  GTPase-activating protein gyp7                          155   4e-39    
gb|KIW97060.1|  hypothetical protein Z519_02452                         155   4e-39    
gb|KIX98113.1|  hypothetical protein Z520_06193                         155   4e-39    
ref|XP_004602734.1|  PREDICTED: TBC1 domain family member 15 isof...    154   4e-39    
ref|XP_007503116.1|  PREDICTED: TBC1 domain family member 15 isof...    154   4e-39    
gb|AAY53531.1|  TBC1 domain family member 15                            154   4e-39    
gb|ERE88321.1|  TBC1 domain family member 15-like protein               153   4e-39    
gb|EPS28577.1|  hypothetical protein PDE_03523                          155   4e-39    
ref|NP_079982.3|  TBC1 domain family member 15                          154   4e-39    
gb|AAH53395.1|  TBC1 domain family, member 15                           153   4e-39    
ref|XP_007727483.1|  hypothetical protein A1O1_08431                    155   5e-39    
ref|XP_009424060.1|  PREDICTED: TBC1 domain family member 15 isof...    153   5e-39    
tpe|CBF71108.1|  TPA: GTPase activating protein (Gyp7), putative ...    155   5e-39    
ref|XP_006514020.1|  PREDICTED: TBC1 domain family member 15 isof...    154   5e-39    
gb|KIW27123.1|  hypothetical protein PV07_06894                         155   5e-39    
gb|KEQ68644.1|  RabGAP/TBC                                              155   5e-39    
ref|XP_002378356.1|  GTPase activating protein (Gyp7), putative         155   5e-39    
ref|XP_008002230.1|  PREDICTED: TBC1 domain family member 15 isof...    153   5e-39    
ref|XP_001823032.1|  GTPase-activating protein gyp7                     155   5e-39    
ref|XP_006672355.1|  GTPase-activating protein GYP7                     154   5e-39    
ref|XP_002563791.1|  Pc20g13090                                         154   5e-39    
gb|EIT80559.1|  Ypt/Rab-specific GTPase-activating protein              154   5e-39    
ref|XP_004675942.1|  PREDICTED: TBC1 domain family member 15 isof...    153   5e-39    



>gb|KDO80165.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=356

 Score =   337 bits (864),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  164  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  223

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  224  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  283

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  284  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  343

Query  228  NLLLFSQEDDDVM  190
            N LL+SQ++D+V+
Sbjct  344  NGLLYSQQEDEVL  356



>gb|KDO80164.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=496

 Score =   340 bits (873),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  304  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  363

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  364  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  423

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  424  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  483

Query  228  NLLLFSQEDDDVM  190
            N LL+SQ++D+V+
Sbjct  484  NGLLYSQQEDEVL  496



>gb|KDO80158.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=638

 Score =   342 bits (878),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  446  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  505

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  506  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  565

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  566  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  625

Query  228  NLLLFSQEDDDVM  190
            N LL+SQ++D+V+
Sbjct  626  NGLLYSQQEDEVL  638



>gb|KDO80159.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=630

 Score =   342 bits (876),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  438  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  497

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  498  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  557

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  558  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  617

Query  228  NLLLFSQEDDDVM  190
            N LL+SQ++D+V+
Sbjct  618  NGLLYSQQEDEVL  630



>ref|XP_006475896.1| PREDICTED: TBC1 domain family member 17-like [Citrus sinensis]
 gb|KDO80157.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=658

 Score =   342 bits (877),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  466  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  526  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  585

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  586  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  645

Query  228  NLLLFSQEDDDVM  190
            N LL+SQ++D+V+
Sbjct  646  NGLLYSQQEDEVL  658



>ref|XP_006381119.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 ref|XP_006381120.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58916.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
 gb|ERP58917.1| hypothetical protein POPTR_0006s06520g [Populus trichocarpa]
Length=315

 Score =   330 bits (847),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 2/192 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  122  QGMSDLLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDCPL  181

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  182  HNYFKQNDCLNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  241

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-  232
            R KI+GE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP  
Sbjct  242  RKKIMGEHMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAAHIPPGTPPSLPTE  301

Query  231  -QNLLLFSQEDD  199
             +N LL++Q+D+
Sbjct  302  NENALLYAQDDE  313



>gb|KDO80156.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=685

 Score =   342 bits (877),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/193 (81%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  493  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  552

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  553  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  612

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  613  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  672

Query  228  NLLLFSQEDDDVM  190
            N LL+SQ++D+V+
Sbjct  673  NGLLYSQQEDEVL  685



>ref|XP_006450870.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
 gb|ESR64110.1| hypothetical protein CICLE_v10007683mg [Citrus clementina]
Length=658

 Score =   341 bits (874),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 156/193 (81%), Positives = 176/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD   
Sbjct  466  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPF  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  526  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  585

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  586  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  645

Query  228  NLLLFSQEDDDVM  190
            N LL+SQ++D+V+
Sbjct  646  NGLLYSQQEDEVL  658



>ref|XP_003542634.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
Length=656

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  463  QGMSDLLSPILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  522

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  523  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRY  582

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTPPSLP++
Sbjct  583  RGKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTPPSLPVE  642

Query  228  NLLLFSQEDDD  196
            +   ++Q++ D
Sbjct  643  DGSFYAQQEQD  653



>gb|KHN22122.1| TBC1 domain family member 15 [Glycine soja]
Length=656

 Score =   340 bits (871),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  463  QGMSDLLSPILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  522

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  523  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRY  582

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTPPSLP++
Sbjct  583  RGKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTPPSLPVE  642

Query  228  NLLLFSQEDDD  196
            +   ++Q++ D
Sbjct  643  DGSFYAQQEQD  653



>ref|XP_007155039.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
 gb|ESW27033.1| hypothetical protein PHAVU_003G167800g [Phaseolus vulgaris]
Length=652

 Score =   338 bits (868),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  461  QGMSDLLSPILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  520

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLY+CVAILKRY
Sbjct  521  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYLCVAILKRY  580

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLPI 
Sbjct  581  RGKIVGEGMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTPPSLPID  640

Query  228  NLLLFSQEDD  199
            +  +++Q+D+
Sbjct  641  DGSVYAQQDE  650



>ref|XP_004508468.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Cicer 
arietinum]
Length=705

 Score =   340 bits (871),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+V+ DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVE+LD  L
Sbjct  513  QGMSDLLSPILFVIDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVEMLDSPL  572

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFEFEKTLRLWEVLWT + +EHLHLYVCVA+LKR+
Sbjct  573  HNYFKQRDCLNYFFCFRWILIQFKREFEFEKTLRLWEVLWTHYPSEHLHLYVCVAVLKRF  632

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFD+LL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLP+ 
Sbjct  633  RSKIMGEEMDFDSLLKFINELSGHIDLDATLRDAEALCICAGEEGAARIPPGTPPSLPVD  692

Query  228  NLLLFSQEDDDVM  190
            +   + Q+DD+V+
Sbjct  693  DGSFYIQQDDEVL  705



>ref|XP_006401806.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43259.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=681

 Score =   338 bits (868),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  490  QGMSDYLSPILFVMGDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  549

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR 
Sbjct  550  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRC  609

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  610  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  669

Query  228  NLLLFSQEDD  199
              +L+ Q+DD
Sbjct  670  EGILYPQDDD  679



>ref|XP_006401805.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
 gb|ESQ43258.1| hypothetical protein EUTSA_v10012867mg [Eutrema salsugineum]
Length=675

 Score =   338 bits (867),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  484  QGMSDYLSPILFVMGDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  543

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR 
Sbjct  544  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRC  603

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  604  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  663

Query  228  NLLLFSQEDD  199
              +L+ Q+DD
Sbjct  664  EGILYPQDDD  673



>ref|XP_002285365.1| PREDICTED: TBC1 domain family member 17 isoform X3 [Vitis vinifera]
Length=657

 Score =   338 bits (866),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  L
Sbjct  466  QGMSDLLSPILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPL  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  526  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRY  585

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  586  RNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPID  645

Query  228  NLLLFSQEDD  199
            + LL  Q+DD
Sbjct  646  SGLLCPQQDD  655



>ref|XP_009624893.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana tomentosiformis]
Length=649

 Score =   337 bits (865),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  456  QGMSDLLSPILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  515

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQKDCLNY FCFRW+LIQFKREFEFEKT+RLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  516  HNYFKQKDCLNYFFCFRWVLIQFKREFEFEKTMRLWEVLWTHYRSEHLHLYVCVAILKRY  575

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKII E+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ 
Sbjct  576  RSKIIREEMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPLD  635

Query  228  NLLLFSQEDDD  196
            +  ++ Q+DDD
Sbjct  636  DASMYYQQDDD  646



>ref|XP_007013521.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY31140.1| RabGAP/TBC domain-containing protein isoform 2 [Theobroma cacao]
Length=656

 Score =   337 bits (865),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  465  QGMSDLLSPILFVMEEESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  524

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVA+LKRY
Sbjct  525  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAVLKRY  584

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  585  RGKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSLPVD  644

Query  228  NLLLFSQEDD  199
            N L +SQ+D+
Sbjct  645  NGLFYSQQDE  654



>ref|XP_003549744.1| PREDICTED: TBC1 domain family member 15-like [Glycine max]
 gb|KHN15067.1| TBC1 domain family member 15 [Glycine soja]
Length=655

 Score =   337 bits (865),  Expect = 9e-108, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM +ESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  462  QGMSDLLSPILFVMDNESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  521

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  522  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRY  581

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLP +
Sbjct  582  RGKIIGEQMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTPPSLPHE  641

Query  228  NLLLFSQEDDD  196
            +   ++Q++ D
Sbjct  642  DGSFYAQQEQD  652



>ref|XP_010656459.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Vitis vinifera]
 emb|CBI28236.3| unnamed protein product [Vitis vinifera]
Length=684

 Score =   338 bits (867),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  L
Sbjct  493  QGMSDLLSPILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPL  552

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  553  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRY  612

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  613  RNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPID  672

Query  228  NLLLFSQEDD  199
            + LL  Q+DD
Sbjct  673  SGLLCPQQDD  682



>ref|XP_009758337.1| PREDICTED: TBC1 domain family member 15-like [Nicotiana sylvestris]
Length=649

 Score =   337 bits (864),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  456  QGMSDLLSPILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  515

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQKDCLNY FCFRW+LIQFKREFEFEKT+RLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  516  HNYFKQKDCLNYFFCFRWVLIQFKREFEFEKTMRLWEVLWTHYRSEHLHLYVCVAILKRY  575

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKII E+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ 
Sbjct  576  RSKIIREEMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPLD  635

Query  228  NLLLFSQEDDD  196
            +  ++ Q+DDD
Sbjct  636  DASMYYQQDDD  646



>ref|XP_006372159.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|ERP49956.1| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=630

 Score =   336 bits (862),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 177/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALM RLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  436  QGMSDLLSPILFVMEDESEAFWCFVALMARLGPNFNRDQNGMHSQLFALSKLVELLDSPL  495

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  496  HNYFKQNDCLNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  555

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-  232
            R+KI+GE MDFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  556  RNKIMGEHMDFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIE  615

Query  231  -QNLLLFSQEDDDVM  190
             +N LL++QE+D+V+
Sbjct  616  NENALLYTQEEDEVL  630



>ref|XP_010656458.1| PREDICTED: GTPase-activating protein GYP7 isoform X1 [Vitis vinifera]
Length=696

 Score =   338 bits (866),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  L
Sbjct  505  QGMSDLLSPILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPL  564

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  565  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRY  624

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  625  RNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPID  684

Query  228  NLLLFSQEDD  199
            + LL  Q+DD
Sbjct  685  SGLLCPQQDD  694



>emb|CDY65323.1| BnaC02g44880D [Brassica napus]
Length=672

 Score =   337 bits (864),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  481  QGMSDYLSPILFVMEDESEAFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  540

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR 
Sbjct  541  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRC  600

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RS I+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  601  RSTIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  660

Query  228  NLLLFSQEDD  199
            + +++S EDD
Sbjct  661  DGIVYSLEDD  670



>ref|XP_002324638.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
 gb|EEF03203.2| hypothetical protein POPTR_0018s12770g [Populus trichocarpa]
Length=661

 Score =   336 bits (862),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 177/195 (91%), Gaps = 2/195 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALM RLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  467  QGMSDLLSPILFVMEDESEAFWCFVALMARLGPNFNRDQNGMHSQLFALSKLVELLDSPL  526

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  527  HNYFKQNDCLNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  586

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-  232
            R+KI+GE MDFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  587  RNKIMGEHMDFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIE  646

Query  231  -QNLLLFSQEDDDVM  190
             +N LL++QE+D+V+
Sbjct  647  NENALLYTQEEDEVL  661



>ref|XP_006280129.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
 gb|EOA13027.1| hypothetical protein CARUB_v10026023mg [Capsella rubella]
Length=672

 Score =   336 bits (862),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  481  QGMSDYLSPILYVMENESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPL  540

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWT + +EHLHLYVCVAILKR 
Sbjct  541  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYHSEHLHLYVCVAILKRC  600

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDLE+T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  601  RSKIMGEQMDFDTLLKFINELSGHIDLESTVRDAEALCICAGENGAASIPPGTPPSLPLD  660

Query  228  NLLLFSQEDD  199
            +++L+  EDD
Sbjct  661  DIMLYPLEDD  670



>ref|XP_010557604.1| PREDICTED: TBC1 domain family member 15 [Tarenaya hassleriana]
Length=669

 Score =   336 bits (861),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  478  QGMSDYLSPILFVMEDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  537

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF Q DCLNY FCFRWILIQFKREFE+ KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  538  HNYFSQNDCLNYFFCFRWILIQFKREFEYGKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  597

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL+FINEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  598  RRKIIGEQMDFDTLLKFINELSGHIDLDSVLRDAEALCICAGENGAASIPPGTPPSLPVD  657

Query  228  NLLLFSQEDD  199
            + +L+ Q+D+
Sbjct  658  DGMLYPQQDE  667



>dbj|BAA98077.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42472.1| unknown protein [Arabidopsis thaliana]
 gb|ABH11525.1| rabGAP [Arabidopsis thaliana]
Length=338

 Score =   325 bits (833),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  147  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  206

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR 
Sbjct  207  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRC  266

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+ 
Sbjct  267  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLD  326

Query  228  NLLLFSQEDD  199
            +  L+ QEDD
Sbjct  327  DGTLYPQEDD  336



>ref|XP_003609386.1| TBC1 domain family member [Medicago truncatula]
 gb|AES91583.1| RabGAP/TBC domain protein [Medicago truncatula]
Length=666

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 174/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  474  QGMSDLLSPILFVMEDESEAFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  533

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVA+LKR 
Sbjct  534  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAVLKRC  593

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFD+LL+FINEL GHIDL+ TLRDAEAL +CAGE GAARIPPGTPPSLP+ 
Sbjct  594  RGKIIGEEMDFDSLLKFINELSGHIDLDATLRDAEALSICAGEEGAARIPPGTPPSLPVD  653

Query  228  NLLLFSQEDDDVM  190
            +   + Q+DD+V+
Sbjct  654  DGSFYYQQDDEVL  666



>gb|KCW80045.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=527

 Score =   331 bits (849),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  336  QGMSDLLSPILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDLPL  395

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EK + LWEV WT HL+EHLHLYVCV+ILKRY
Sbjct  396  HNYFKQNDCLNYFFCFRWLLIQFKREFEYEKVMSLWEVFWTHHLSEHLHLYVCVSILKRY  455

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  456  RKKIMGEQMDFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTPPSLPIE  515

Query  228  NLLLFSQEDD  199
            + LL+ Q+DD
Sbjct  516  SSLLYPQQDD  525



>ref|XP_009127224.1| PREDICTED: TBC1 domain family member 15 [Brassica rapa]
Length=672

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 174/190 (92%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  481  QGMSDYLSPILFVMEDESEAFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  540

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR 
Sbjct  541  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRC  600

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RS I+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  601  RSTIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  660

Query  228  NLLLFSQEDD  199
            + +++S +DD
Sbjct  661  DGIVYSLDDD  670



>emb|CDY27056.1| BnaA02g10760D [Brassica napus]
Length=672

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  481  QGMSDYLSPILFVMEDESEAFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  540

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWTQ+LTEH HLYVCVAILKR 
Sbjct  541  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHFHLYVCVAILKRC  600

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RS IIGE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  601  RSTIIGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  660

Query  228  NLLLFSQEDD  199
            + +++S +DD
Sbjct  661  DGIVYSLDDD  670



>ref|XP_002864184.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40443.1| hypothetical protein ARALYDRAFT_495330 [Arabidopsis lyrata subsp. 
lyrata]
Length=674

 Score =   335 bits (860),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  483  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPL  542

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR 
Sbjct  543  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRC  602

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  603  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  662

Query  228  NLLLFSQEDD  199
            +  L+ QEDD
Sbjct  663  DGTLYPQEDD  672



>gb|AIU48656.1| RabGAP/TBC domain-containing protein, partial [Glycine max]
Length=625

 Score =   334 bits (856),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 169/182 (93%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  440  QGMSDLLSPILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  499

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  500  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAILKRY  559

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE GAARIPPGTPPSLP++
Sbjct  560  RGKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGAARIPPGTPPSLPVE  619

Query  228  NL  223
            + 
Sbjct  620  SF  621



>ref|XP_007013520.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY31139.1| RabGAP/TBC domain-containing protein isoform 1 [Theobroma cacao]
Length=743

 Score =   337 bits (864),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/190 (82%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  552  QGMSDLLSPILFVMEEESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  611

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVA+LKRY
Sbjct  612  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAVLKRY  671

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  672  RGKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSLPVD  731

Query  228  NLLLFSQEDD  199
            N L +SQ+D+
Sbjct  732  NGLFYSQQDE  741



>ref|XP_010442797.1| PREDICTED: TBC1 domain family member 15-like [Camelina sativa]
Length=672

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  481  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  540

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  541  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRC  600

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  601  RSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLD  660

Query  228  NLLLFSQEDD  199
             ++L+  EDD
Sbjct  661  EVMLYPLEDD  670



>ref|XP_010482626.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  481  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  540

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  541  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRC  600

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  601  RSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLD  660

Query  228  NLLLFSQEDD  199
             ++L+  EDD
Sbjct  661  EVMLYPLEDD  670



>ref|XP_010482625.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  487  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  546

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  547  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRC  606

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  607  RSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLD  666

Query  228  NLLLFSQEDD  199
             ++L+  EDD
Sbjct  667  EVMLYPLEDD  676



>ref|XP_010482627.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Camelina 
sativa]
Length=679

 Score =   334 bits (857),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 173/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  488  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  547

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  548  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYLSEHLHLYVCVAILKRC  607

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  608  RSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLD  667

Query  228  NLLLFSQEDD  199
             ++L+  EDD
Sbjct  668  EVMLYPLEDD  677



>ref|XP_010241556.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nelumbo nucifera]
Length=673

 Score =   334 bits (856),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  482  QGMSDLLSPILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  541

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQKDCLNY FCFRW+LIQFKREFE+EK + LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  542  HNYFKQKDCLNYFFCFRWVLIQFKREFEYEKIMLLWEVLWTHYLSEHLHLYVCVAILKRY  601

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+G++MDFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTPPSLPI+
Sbjct  602  RKKIMGDQMDFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTPPSLPIE  661

Query  228  NL-LLFSQEDDD  196
            +   L+ Q+DDD
Sbjct  662  DTGSLYPQQDDD  673



>ref|XP_010445073.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Camelina 
sativa]
Length=672

 Score =   334 bits (856),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  481  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  540

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT+ LWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  541  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMELWEVLWTHYLSEHLHLYVCVAILKRC  600

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  601  RSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLD  660

Query  228  NLLLFSQEDD  199
             ++L+  EDD
Sbjct  661  EVMLYPLEDD  670



>gb|AIU48673.1| RabGAP/TBC domain-containing protein, partial [Phaseolus vulgaris]
Length=623

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  438  QGMSDLLSPILFVMDDESEAFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  497

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLY+CVAILKRY
Sbjct  498  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYLCVAILKRY  557

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAARIPPGTPPSLPI 
Sbjct  558  RGKIVGEGMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGAARIPPGTPPSLPID  617

Query  228  NL  223
            ++
Sbjct  618  SV  619



>ref|XP_010445069.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Camelina 
sativa]
Length=678

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 154/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  487  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  546

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT+ LWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  547  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMELWEVLWTHYLSEHLHLYVCVAILKRC  606

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  607  RSKIMGEQMDFDTLLKFINELSGHIDLDSTIRDAEALCICAGENGAASIPPGTPPSLPLD  666

Query  228  NLLLFSQEDD  199
             ++L+  EDD
Sbjct  667  EVMLYPLEDD  676



>ref|XP_010047970.1| PREDICTED: TBC1 domain family member 15 [Eucalyptus grandis]
 gb|KCW80044.1| hypothetical protein EUGRSUZ_C01375 [Eucalyptus grandis]
Length=654

 Score =   333 bits (853),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/190 (82%), Positives = 170/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  463  QGMSDLLSPILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDLPL  522

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EK + LWEV WT HL+EHLHLYVCV+ILKRY
Sbjct  523  HNYFKQNDCLNYFFCFRWLLIQFKREFEYEKVMSLWEVFWTHHLSEHLHLYVCVSILKRY  582

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  583  RKKIMGEQMDFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTPPSLPIE  642

Query  228  NLLLFSQEDD  199
            + LL+ Q+DD
Sbjct  643  SSLLYPQQDD  652



>ref|XP_011017816.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
 ref|XP_011017817.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Populus 
euphratica]
Length=676

 Score =   333 bits (855),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSK VELLD  L
Sbjct  482  QGMSDLLSPILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKRVELLDSPL  541

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCL+Y FCFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  542  HNYFKQNDCLSYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  601

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-  232
            R+KI+GE MDFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTPPSLP  
Sbjct  602  RNKIMGEHMDFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTPPSLPTE  661

Query  231  -QNLLLFSQEDDDVM  190
             +N LL++QE+D+V+
Sbjct  662  NENALLYTQEEDEVL  676



>ref|XP_011017818.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Populus 
euphratica]
Length=661

 Score =   333 bits (854),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 176/195 (90%), Gaps = 2/195 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSK VELLD  L
Sbjct  467  QGMSDLLSPILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKRVELLDSPL  526

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCL+Y FCFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  527  HNYFKQNDCLSYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  586

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-  232
            R+KI+GE MDFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTPPSLP  
Sbjct  587  RNKIMGEHMDFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTPPSLPTE  646

Query  231  -QNLLLFSQEDDDVM  190
             +N LL++QE+D+V+
Sbjct  647  NENALLYTQEEDEVL  661



>ref|XP_010323291.1| PREDICTED: GTPase-activating protein gyp7 [Solanum lycopersicum]
Length=678

 Score =   333 bits (855),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DES+SFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  L
Sbjct  485  QGMSDLLSPILYVMGDESQSFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPL  544

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+QKDCLNY FCFRW+LIQFKREF+FEKT+RLWEVLWT +L+EHLHLYVCVAIL+R+
Sbjct  545  HNYFQQKDCLNYFFCFRWVLIQFKREFDFEKTMRLWEVLWTHYLSEHLHLYVCVAILRRH  604

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL GHI+L+ TLR+AEALC+CAGE G A IPPGTPPSLP +
Sbjct  605  RSKIIGEEMDFDTLLKFINELSGHINLDATLREAEALCICAGENGEACIPPGTPPSLPFE  664

Query  228  NLLLFSQEDDD  196
               +++Q+DDD
Sbjct  665  ITSMYNQQDDD  675



>ref|XP_010241554.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nelumbo nucifera]
Length=707

 Score =   334 bits (856),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  516  QGMSDLLSPILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  575

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQKDCLNY FCFRW+LIQFKREFE+EK + LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  576  HNYFKQKDCLNYFFCFRWVLIQFKREFEYEKIMLLWEVLWTHYLSEHLHLYVCVAILKRY  635

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+G++MDFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTPPSLPI+
Sbjct  636  RKKIMGDQMDFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTPPSLPIE  695

Query  228  NL-LLFSQEDDD  196
            +   L+ Q+DDD
Sbjct  696  DTGSLYPQQDDD  707



>gb|KJB54007.1| hypothetical protein B456_009G016100 [Gossypium raimondii]
Length=657

 Score =   333 bits (853),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 153/193 (79%), Positives = 173/193 (90%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  464  QGMSDLLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDAPL  523

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQKDCLNY  CFRWIL+QFKRE E+++T+RLWEVLWT HL+EHLHLYVCVA+LKRY
Sbjct  524  HNYFKQKDCLNYFICFRWILLQFKRELEYDQTMRLWEVLWTHHLSEHLHLYVCVALLKRY  583

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+M+FDTLL+FINEL GHID++ TLRDAEALCLCAGE G+A IPPGTPPSLP +
Sbjct  584  RGKIIGEQMEFDTLLKFINELSGHIDIDVTLRDAEALCLCAGENGSACIPPGTPPSLPRE  643

Query  228  NLLLFSQEDDDVM  190
            +  LF+ E DD +
Sbjct  644  DGFLFNSELDDTV  656



>ref|XP_008362894.1| PREDICTED: TBC1 domain family member 17-like [Malus domestica]
Length=659

 Score =   332 bits (852),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 152/194 (78%), Positives = 176/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFV+LMERLGPNF  DQ+GM++QLFA++KLVELLD  L
Sbjct  466  QGMSDLLSPILYVMEDESESFWCFVSLMERLGPNFNRDQSGMHSQLFAITKLVELLDAPL  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HN+F QKDCLNY FCFRW+LIQFKREFEF+KT+RLWEVLWT + +EHLHLYVCVAILKR+
Sbjct  526  HNHFTQKDCLNYFFCFRWVLIQFKREFEFDKTMRLWEVLWTHYPSEHLHLYVCVAILKRH  585

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  586  RSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAASIPPGTPPSLPVD  645

Query  228  NLLLFS-QEDDDVM  190
            ++LL+  QE DD++
Sbjct  646  DVLLYPXQELDDIL  659



>ref|XP_006358298.1| PREDICTED: GTPase-activating protein gyp7-like [Solanum tuberosum]
Length=678

 Score =   333 bits (853),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DE +SFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  L
Sbjct  485  QGMSDLLSPILYVMGDEPQSFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPL  544

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+QKDCLNY FCFRW+LIQFKREF+FEKT+RLWEVLWT +L+EHLHLYVCVAIL+R+
Sbjct  545  HNYFQQKDCLNYFFCFRWVLIQFKREFDFEKTMRLWEVLWTHYLSEHLHLYVCVAILRRH  604

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL GHI+L+ TLRDAEALC+CAGE G A IPPGTPPSLP +
Sbjct  605  RSKIIGEEMDFDTLLKFINELSGHINLDATLRDAEALCICAGENGEACIPPGTPPSLPFE  664

Query  228  NLLLFSQEDDD  196
               +++Q+DDD
Sbjct  665  ITSMYNQQDDD  675



>ref|XP_010241555.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nelumbo nucifera]
Length=700

 Score =   333 bits (855),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 174/192 (91%), Gaps = 1/192 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  509  QGMSDLLSPILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  568

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQKDCLNY FCFRW+LIQFKREFE+EK + LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  569  HNYFKQKDCLNYFFCFRWVLIQFKREFEYEKIMLLWEVLWTHYLSEHLHLYVCVAILKRY  628

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+G++MDFDT+L+FINEL GHIDL+ TL+DAEALC+CAGE G A IPPGTPPSLPI+
Sbjct  629  RKKIMGDQMDFDTVLKFINELSGHIDLDATLKDAEALCMCAGENGEACIPPGTPPSLPIE  688

Query  228  NL-LLFSQEDDD  196
            +   L+ Q+DDD
Sbjct  689  DTGSLYPQQDDD  700



>ref|XP_011084120.1| PREDICTED: TBC1 domain family member 15 [Sesamum indicum]
Length=654

 Score =   332 bits (851),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 177/193 (92%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVMRDESESFWCFV+LMERLGPNF  DQ+GM+TQLFALSKLVELLD  L
Sbjct  462  QGMSDLLSPILYVMRDESESFWCFVSLMERLGPNFNRDQSGMHTQLFALSKLVELLDKPL  521

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YF++ DCLNY FCFRWILIQFKREFE+EKT+RLWEV+WT HL+EHLHLYVCVAILKR+
Sbjct  522  HHYFERNDCLNYFFCFRWILIQFKREFEYEKTMRLWEVMWTHHLSEHLHLYVCVAILKRH  581

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL G I+L+ TLR+AEALC+CAGE G A IPPGTPPSLPI+
Sbjct  582  RSKIMGEQMDFDTLLKFINELSGQIELDATLREAEALCICAGENGEACIPPGTPPSLPIE  641

Query  228  NLLLFSQEDDDVM  190
            + L++ Q +DD++
Sbjct  642  DGLVYPQLEDDIL  654



>emb|CDP10442.1| unnamed protein product [Coffea canephora]
Length=692

 Score =   333 bits (854),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/199 (77%), Positives = 175/199 (88%), Gaps = 6/199 (3%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DESESFWCFV+LM+RLGPNF  DQNGM++QLFALSKLVE+LD  L
Sbjct  494  QGMSDLLSPILFVMKDESESFWCFVSLMDRLGPNFNRDQNGMHSQLFALSKLVEILDSPL  553

Query  588  HNYFKQKDCLNYLFCFRWILIQFKR------EFEFEKTLRLWEVLWTQHLTEHLHLYVCV  427
            HNYF Q DCLNY FCFRWILIQFKR      E E+EKT+RLWEVLWT +L+EHLHLYVCV
Sbjct  554  HNYFNQNDCLNYFFCFRWILIQFKRQVRLFLELEYEKTMRLWEVLWTHYLSEHLHLYVCV  613

Query  426  AILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  247
            AILKRYRSKI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALCLCAGE GAA IPPGTP
Sbjct  614  AILKRYRSKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCLCAGENGAACIPPGTP  673

Query  246  PSLPIQNLLLFSQEDDDVM  190
            PSLP++   ++ Q+DDD++
Sbjct  674  PSLPVEEASMYPQQDDDIL  692



>ref|XP_009363991.1| PREDICTED: TBC1 domain family member 15 [Pyrus x bretschneideri]
Length=658

 Score =   332 bits (851),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/194 (78%), Positives = 177/194 (91%), Gaps = 1/194 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFV+LMERLGPNF  DQ+GM++QLFA++KLVELLD  L
Sbjct  465  QGMSDLLSPILYVMEDESESFWCFVSLMERLGPNFNRDQSGMHSQLFAVTKLVELLDVPL  524

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HN+F QKDCLNY FCFRW+LIQFKREFEF+KTLRLWE+LWT + +EHLHLYVCVAILKR+
Sbjct  525  HNHFTQKDCLNYFFCFRWVLIQFKREFEFDKTLRLWEILWTHYPSEHLHLYVCVAILKRH  584

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  585  RSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAASIPPGTPPSLPVD  644

Query  228  NLLLFSQED-DDVM  190
            ++LL+ Q++ DD++
Sbjct  645  DVLLYPQQELDDIL  658



>ref|XP_011017820.1| PREDICTED: TBC1 domain family member 17-like isoform X3 [Populus 
euphratica]
Length=637

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 154/194 (79%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -2

Query  765  GMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLH  586
            GMSDLLSPIL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSK VELLD  LH
Sbjct  444  GMSDLLSPILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKRVELLDSPLH  503

Query  585  NYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYR  406
            NYFKQ DCL+Y FCFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRYR
Sbjct  504  NYFKQNDCLSYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRYR  563

Query  405  SKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI--  232
            +KI+GE MDFDTLL+FINEL GHIDL++ LRDAEALCLCAGE GAA IPPGTPPSLP   
Sbjct  564  NKIMGEHMDFDTLLKFINELSGHIDLDSILRDAEALCLCAGENGAACIPPGTPPSLPTEN  623

Query  231  QNLLLFSQEDDDVM  190
            +N LL++QE+D+V+
Sbjct  624  ENALLYTQEEDEVL  637



>gb|EYU18249.1| hypothetical protein MIMGU_mgv1a002604mg [Erythranthe guttata]
Length=655

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 175/193 (91%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVMRDES+SFWCFV+LMERLGPNF  DQ+GM++QLFALSKLVELLD  L
Sbjct  463  QGMSDLLSPILYVMRDESKSFWCFVSLMERLGPNFNRDQSGMHSQLFALSKLVELLDLPL  522

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YFKQ DCLNY FCFRWILIQFKREFE++KTL LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  523  HDYFKQNDCLNYFFCFRWILIQFKREFEYDKTLLLWEVLWTHYLSEHLHLYVCVAILKRY  582

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+ TLR+AEALC+CAGE G A IPPGTPPSLP++
Sbjct  583  RNKIMGEQMDFDTLLKFINELSGQIDLDATLREAEALCICAGENGEASIPPGTPPSLPLE  642

Query  228  NLLLFSQEDDDVM  190
            +  ++ Q DDDV+
Sbjct  643  DASVYPQLDDDVL  655



>ref|XP_004251725.1| PREDICTED: TBC1 domain family member 17-like [Solanum lycopersicum]
Length=656

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL++M DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  462  QGMSDLLSPILFIMGDESETFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPL  521

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQKDCLNY FCFRW+LIQFKREFEFE+T+RLWEVLWT + +EHLHLYVCVAILKR+
Sbjct  522  HNYFKQKDCLNYFFCFRWVLIQFKREFEFEQTMRLWEVLWTHYGSEHLHLYVCVAILKRH  581

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ 
Sbjct  582  RSKIIGEGMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPVD  641

Query  228  NLLLFSQEDDD  196
            +  ++ Q+DDD
Sbjct  642  DASMYYQQDDD  652



>ref|XP_006345222.1| PREDICTED: TBC1 domain family member 15-like [Solanum tuberosum]
Length=656

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/191 (80%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  463  QGMSDLLSPILFVMGDESETFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPL  522

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+QKDCLNY FCFRW+LIQFKREFEFE+T+RLWEVLWT + +EHLHLYVCVAILKR+
Sbjct  523  HNYFEQKDCLNYFFCFRWVLIQFKREFEFEQTMRLWEVLWTHYGSEHLHLYVCVAILKRH  582

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE G + IPPGTPPSLP+ 
Sbjct  583  RSKIIGEGMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGESCIPPGTPPSLPVD  642

Query  228  NLLLFSQEDDD  196
            +  ++ Q+DDD
Sbjct  643  DASMYYQQDDD  653



>ref|XP_011020167.1| PREDICTED: TBC1 domain family member 15 [Populus euphratica]
Length=660

 Score =   331 bits (848),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 172/192 (90%), Gaps = 2/192 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLG NF  DQNGM++QLFALSKLVELLD  L
Sbjct  467  QGMSDLLSPILFVMEDESESFWCFVALMERLGANFNRDQNGMHSQLFALSKLVELLDCPL  526

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FC RW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  527  HNYFKQNDCLNYFFCLRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  586

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-  232
            R KI+GE MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAARIPPGTPPSLP  
Sbjct  587  RKKIMGEHMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAARIPPGTPPSLPTE  646

Query  231  -QNLLLFSQEDD  199
             +N LL++Q+D+
Sbjct  647  NENALLYAQDDE  658



>gb|AIU48681.1| RabGAP/TBC domain-containing protein, partial [Vitis vinifera]
Length=629

 Score =   330 bits (845),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 150/179 (84%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DE+ESFWCFVALMERLGPNF  DQNGM+TQLFA+SKLVELLD  L
Sbjct  444  QGMSDLLSPILFVMKDEAESFWCFVALMERLGPNFNRDQNGMHTQLFAISKLVELLDSPL  503

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT++LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  504  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMKLWEVLWTHYLSEHLHLYVCVAILKRY  563

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
            R+KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLPI
Sbjct  564  RNKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAANIPPGTPPSLPI  622



>ref|XP_002527173.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF35186.1| conserved hypothetical protein [Ricinus communis]
Length=645

 Score =   330 bits (846),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 176/192 (92%), Gaps = 2/192 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLDG L
Sbjct  452  QGMSDLLSPILFVMEDESKSFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDGPL  511

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHL+ CV+ILKRY
Sbjct  512  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLFACVSILKRY  571

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  572  RNKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACIPPGTPPSLPLE  631

Query  228  NL--LLFSQEDD  199
            N   LL++Q+D+
Sbjct  632  NENGLLYAQQDE  643



>ref|NP_200071.2| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96237.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=673

 Score =   331 bits (848),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  482  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  541

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR 
Sbjct  542  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRC  601

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+ 
Sbjct  602  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLD  661

Query  228  NLLLFSQEDD  199
            +  L+ QEDD
Sbjct  662  DGTLYPQEDD  671



>gb|AIU48680.1| RabGAP/TBC domain-containing protein, partial [Schrenkiella parvula]
Length=628

 Score =   329 bits (844),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/179 (85%), Positives = 167/179 (93%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESE+FWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  443  QGMSDYLSPILFVMGDESETFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWTQ+LTEHLHLYVCVAILKR 
Sbjct  503  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTQYLTEHLHLYVCVAILKRC  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+
Sbjct  563  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPL  621



>ref|NP_001190524.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
 gb|AED96238.1| RabGAP/TBC domain-containing protein [Arabidopsis thaliana]
Length=690

 Score =   331 bits (848),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 171/190 (90%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  499  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  558

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR 
Sbjct  559  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRC  618

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+ 
Sbjct  619  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLD  678

Query  228  NLLLFSQEDD  199
            +  L+ QEDD
Sbjct  679  DGTLYPQEDD  688



>gb|KFK26862.1| hypothetical protein AALP_AA8G303600 [Arabis alpina]
Length=675

 Score =   330 bits (847),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/190 (81%), Positives = 172/190 (91%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM+DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  484  QGMSDYLSPILFVMKDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDLPL  543

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT+ LWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  544  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMLLWEVLWTHYLSEHLHLYVCVAILKRC  603

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+G++MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  604  RSKIMGDQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  663

Query  228  NLLLFSQEDD  199
              +L+  +DD
Sbjct  664  EEILYPLDDD  673



>gb|AIU48654.1| RabGAP/TBC domain-containing protein, partial [Citrus sinensis]
Length=629

 Score =   329 bits (843),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 171/188 (91%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  444  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  503

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  504  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  563

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  564  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  623

Query  228  NLLLFSQE  205
              LL+S++
Sbjct  624  --LLYSED  629



>gb|AIU48647.1| RabGAP/TBC domain-containing protein, partial [Theobroma cacao]
Length=603

 Score =   328 bits (841),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 169/188 (90%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  418  QGMSDLLSPILFVMEEESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDIPL  477

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVA+LKRY
Sbjct  478  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAVLKRY  537

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  538  RGKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSLPVD  597

Query  228  NLLLFSQE  205
              L +S E
Sbjct  598  --LFYSDE  603



>gb|AIU48658.1| RabGAP/TBC domain-containing protein, partial [Buxus sinica]
Length=629

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  444  QGMSDLLSPILFVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPL  503

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF Q DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  504  HNYFNQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  563

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G IDL+ TLRDAEALC+CAGE GAA IPPGTPPS+PI+
Sbjct  564  RKKIMGEQMDFDTLLKFINELSGQIDLDATLRDAEALCICAGENGAACIPPGTPPSMPIE  623

Query  228  NLLL  217
             L L
Sbjct  624  LLYL  627



>gb|KJB64719.1| hypothetical protein B456_010G061900 [Gossypium raimondii]
Length=653

 Score =   328 bits (842),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/193 (79%), Positives = 172/193 (89%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  461  QGMSDLLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDRPL  520

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H YF+Q DCLNY FCFRWILIQFKRE E+E+T+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  521  HKYFEQNDCLNYFFCFRWILIQFKRELEYEQTMRLWEVLWTHYLSEHLHLYVCVAILKRY  580

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGT PSLP+ 
Sbjct  581  RGKIMGEQMDFDTLLKFINELSGQIELDAILRDAEALCICAGENGAACIPPGTVPSLPVD  640

Query  228  NLLLFSQEDDDVM  190
            N L +SQ+DD+V+
Sbjct  641  NGLFYSQQDDEVL  653



>gb|AIU48650.1| RabGAP/TBC domain-containing protein, partial [Citrus clementina]
Length=629

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 170/188 (90%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD   
Sbjct  444  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPF  503

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  504  HNYFKQNDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  563

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLPI 
Sbjct  564  RNKIMGEQMDFDTLLKFINELSGRIDLDAILRDAEALCICAGENGAASIPPGTPPSLPID  623

Query  228  NLLLFSQE  205
              LL+S++
Sbjct  624  --LLYSED  629



>gb|AIU48640.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis lyrata]
Length=627

 Score =   327 bits (837),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  442  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPL  501

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR 
Sbjct  502  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRC  561

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  562  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCICAGENGAASIPPGTPPSLPLD  621

Query  228  NL  223
             L
Sbjct  622  TL  623



>gb|AIU48653.1| RabGAP/TBC domain-containing protein, partial [Capsella rubella]
Length=626

 Score =   327 bits (837),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 152/182 (84%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM +ESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  441  QGMSDYLSPILYVMENESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDTPL  500

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT++LWEVLWT + +EHLHLYVCVAILKR 
Sbjct  501  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMQLWEVLWTHYHSEHLHLYVCVAILKRC  560

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDLE+T+RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  561  RSKIMGEQMDFDTLLKFINELSGHIDLESTVRDAEALCICAGENGAASIPPGTPPSLPLD  620

Query  228  NL  223
             L
Sbjct  621  ML  622



>gb|AIU48670.1| RabGAP/TBC domain-containing protein, partial [Populus trichocarpa]
Length=627

 Score =   326 bits (836),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 171/188 (91%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFVALM RLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  442  QGMSDLLSPILFVMEDESEAFWCFVALMARLGPNFNRDQNGMHSQLFALSKLVELLDSPL  501

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE++KT+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  502  HNYFKQNDCLNYFFCFRWVLIQFKREFEYKKTMRLWEVLWTHYLSEHLHLYVCVAILKRY  561

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE MDFDTLL+F NEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  562  RNKIMGEHMDFDTLLKFTNELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIE  621

Query  228  NLLLFSQE  205
              LL++++
Sbjct  622  --LLYTED  627



>gb|AIU48666.1| RabGAP/TBC domain-containing protein, partial [Medicago truncatula]
Length=626

 Score =   326 bits (836),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 166/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  441  QGMSDLLSPILFVMEDESEAFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  500

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ+DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT + +EHLHLYVCVA+LKR 
Sbjct  501  HNYFKQRDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYPSEHLHLYVCVAVLKRC  560

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFD+LL+FINEL GHIDL+ TLRDAEAL +CAGE GAARIPPGTPPSLP+ 
Sbjct  561  RGKIIGEEMDFDSLLKFINELSGHIDLDATLRDAEALSICAGEEGAARIPPGTPPSLPVD  620

Query  228  NL  223
            + 
Sbjct  621  SF  622



>gb|AIU48675.1| RabGAP/TBC domain-containing protein, partial [Ricinus communis]
Length=610

 Score =   325 bits (833),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 172/188 (91%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLDG L
Sbjct  425  QGMSDLLSPILFVMEDESKSFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDGPL  484

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT +L+EHLHL+ CV+ILKRY
Sbjct  485  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTMRLWEVLWTHYLSEHLHLFACVSILKRY  544

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  545  RNKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACIPPGTPPSLPLE  604

Query  228  NLLLFSQE  205
              LL++ E
Sbjct  605  --LLYADE  610



>ref|XP_009593351.1| PREDICTED: TBC1 domain family member 15 isoform X3 [Nicotiana 
tomentosiformis]
Length=563

 Score =   323 bits (828),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM DE ESFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  L
Sbjct  370  QGMSDFLSPILYVMEDEPESFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPL  429

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YFKQKDCLNY FCFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RY
Sbjct  430  HDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRY  489

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IPPGTPPS P +
Sbjct  490  RSKIIGEEMDFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIPPGTPPSFPFE  549

Query  228  NLLLFSQEDDD  196
               ++ Q+DDD
Sbjct  550  GTSMYYQQDDD  560



>gb|AIU48682.1| RabGAP/TBC domain-containing protein, partial [Lactuca sativa]
Length=351

 Score =   316 bits (810),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/182 (80%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL++M+DESE+FWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  166  QGMSDLLSPILFIMQDESEAFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  225

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE++KTLRLWEVLWT +L+EHLHLYVC+AILKR+
Sbjct  226  HNYFKQNDCLNYFFCFRWILIQFKREFEYDKTLRLWEVLWTHYLSEHLHLYVCIAILKRH  285

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGTPP+LPI 
Sbjct  286  RGKIMGEEMDFDTLLKFINELSGQIELDPVLRDAEALCVCAGENGAASIPPGTPPALPIP  345

Query  228  NL  223
            ++
Sbjct  346  SI  347



>ref|XP_008785780.1| PREDICTED: TBC1 domain family member 15 [Phoenix dactylifera]
Length=666

 Score =   325 bits (832),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 169/191 (88%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  L
Sbjct  474  QGMSDLLSPILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPL  533

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVA+LKRY
Sbjct  534  HNYLKQADCLNYFFCFRWILIQFKREFEYTKVMHLWEVLWTHYLSEHFHLYMCVAVLKRY  593

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  594  RKKIMGEQMDFDTLLKFINELSGHIDLDGMIRDAEALCVCAGESGAACIPPGTPPSLPVE  653

Query  228  -NLLLFSQEDD  199
             ++ L+ QEDD
Sbjct  654  TDMGLYPQEDD  664



>gb|AIU48668.1| RabGAP/TBC domain-containing protein, partial [Manihot esculenta]
Length=627

 Score =   323 bits (829),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 169/188 (90%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLD  L
Sbjct  442  QGMSDLLSPILFVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDSPL  501

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+ KTL LWEVLWT +L+EHLHLY CVAILKRY
Sbjct  502  HNYFKQNDCLNYFFCFRWILIQFKREFEYGKTLCLWEVLWTHYLSEHLHLYACVAILKRY  561

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  562  RNKIMGEQMDFDTLLKFINELSGHIDLDAVLRDAEALCICAGENGAAAIPPGTPPSLPLE  621

Query  228  NLLLFSQE  205
              LL+S E
Sbjct  622  --LLYSDE  627



>ref|XP_010911930.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Elaeis guineensis]
Length=532

 Score =   321 bits (822),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  L
Sbjct  340  QGMSDFLSPILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPL  399

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVAILKRY
Sbjct  400  HNYLKQADCLNYFFCFRWILIQFKREFEYLKVMHLWEVLWTHYLSEHFHLYMCVAILKRY  459

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL GHIDL+ T+RDAEALC CAGE G A IPPGTPPSLP++
Sbjct  460  RKKIMGEQMDFDTLLKFINELSGHIDLDGTIRDAEALCACAGENGTACIPPGTPPSLPVE  519

Query  228  NLLLFSQEDDDVM  190
              +    +DDDV+
Sbjct  520  TDMGLYPQDDDVL  532



>ref|XP_009789610.1| PREDICTED: TBC1 domain family member 15-like isoform X3 [Nicotiana 
sylvestris]
Length=563

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 1/194 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM +E ESFWCFV LMERLGPNF  DQNG+++QLFALSKLVELLD  L
Sbjct  370  QGMSDFLSPILYVMENEPESFWCFVVLMERLGPNFNRDQNGVHSQLFALSKLVELLDNPL  429

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YFKQKDCLNY FCFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RY
Sbjct  430  HDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRY  489

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IPPGTPPS P +
Sbjct  490  RSKIIGEEMDFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIPPGTPPSFPFE  549

Query  228  NL-LLFSQEDDDVM  190
               + + Q+DDDV+
Sbjct  550  GTSMCYQQDDDDVL  563



>gb|KJB27078.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=656

 Score =   323 bits (829),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALME LGPNF  DQ+G+++QLFALSKLVELLD  L
Sbjct  465  QGMSDLLSPILFVMEDESESFWCFVALMECLGPNFNRDQSGLHSQLFALSKLVELLDNPL  524

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKRE E+EKT+RLWEVLWT +L+EH+HLYV VAILKRY
Sbjct  525  HNYFKQNDCLNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHIHLYVSVAILKRY  584

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIG++MDFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ 
Sbjct  585  RGKIIGDQMDFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTPPSLPVD  644

Query  228  NLLLFSQEDD  199
            N LL+SQ+D+
Sbjct  645  NGLLYSQQDE  654



>ref|XP_004173869.1| PREDICTED: TBC1 domain family member 15-like, partial [Cucumis 
sativus]
Length=191

 Score =   308 bits (789),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 141/189 (75%), Positives = 163/189 (86%), Gaps = 0/189 (0%)
 Frame = -2

Query  765  GMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLH  586
            GMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQ GM+ QLFA+SKLVELLD  LH
Sbjct  1    GMSDFLSPILFVMGDESESFWCFVALMERLGPNFNRDQTGMHCQLFAISKLVELLDTPLH  60

Query  585  NYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYR  406
            NYF Q DCLNY FCFRW+LIQFKREF +EK + LWEVLWT + +EHLHLY+CVA+LKRYR
Sbjct  61   NYFSQHDCLNYFFCFRWVLIQFKREFAYEKVMHLWEVLWTHYPSEHLHLYICVAVLKRYR  120

Query  405  SKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN  226
            +KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ +
Sbjct  121  NKIMGEQMDFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTPPSLPLDD  180

Query  225  LLLFSQEDD  199
               + Q+D+
Sbjct  181  GSYYIQQDE  189



>gb|KJB27077.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=639

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALME LGPNF  DQ+G+++QLFALSKLVELLD  L
Sbjct  448  QGMSDLLSPILFVMEDESESFWCFVALMECLGPNFNRDQSGLHSQLFALSKLVELLDNPL  507

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKRE E+EKT+RLWEVLWT +L+EH+HLYV VAILKRY
Sbjct  508  HNYFKQNDCLNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHIHLYVSVAILKRY  567

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIG++MDFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ 
Sbjct  568  RGKIIGDQMDFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTPPSLPVD  627

Query  228  NLLLFSQEDD  199
            N LL+SQ+D+
Sbjct  628  NGLLYSQQDE  637



>gb|AIU48649.1| RabGAP/TBC domain-containing protein, partial [Sarcandra glabra]
Length=355

 Score =   313 bits (803),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 166/188 (88%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  170  QGMSDLLSPILFVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  229

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+EKT+ LWEVLWT +L+EH HLY+C+AILKRY
Sbjct  230  HNYLKQADCLNYFFCFRWILIQFKREFEYEKTMYLWEVLWTHYLSEHFHLYICIAILKRY  289

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+ E+MDFDTLL+FINEL G IDL+  LRDAEALC+ AGE GAA IPPGTPPSLP++
Sbjct  290  RKKIVDEEMDFDTLLKFINELSGQIDLDAALRDAEALCIVAGENGAACIPPGTPPSLPVE  349

Query  228  NLLLFSQE  205
              LL+S +
Sbjct  350  --LLYSDD  355



>ref|XP_009593349.1| PREDICTED: TBC1 domain family member 17 isoform X1 [Nicotiana 
tomentosiformis]
Length=676

 Score =   323 bits (829),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 149/191 (78%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM DE ESFWCFVALMERLGPNF  DQNG+++QLFALSKLVELLD  L
Sbjct  483  QGMSDFLSPILYVMEDEPESFWCFVALMERLGPNFNRDQNGVHSQLFALSKLVELLDNPL  542

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YFKQKDCLNY FCFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RY
Sbjct  543  HDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRY  602

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IPPGTPPS P +
Sbjct  603  RSKIIGEEMDFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIPPGTPPSFPFE  662

Query  228  NLLLFSQEDDD  196
               ++ Q+DDD
Sbjct  663  GTSMYYQQDDD  673



>gb|AIU48639.1| RabGAP/TBC domain-containing protein, partial [Aquilegia coerulea]
Length=625

 Score =   322 bits (825),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 170/188 (90%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DESESFWCFV+LMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  440  QGMSDLLSPILFVMKDESESFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  499

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF++EK +RLWEVLWT +L+EH HLYVCVAILK++
Sbjct  500  HNYFRQNDCLNYFFCFRWVLIQFKREFDYEKMMRLWEVLWTHYLSEHFHLYVCVAILKKH  559

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAA IPPGTP SLPI+
Sbjct  560  RAKIMGEQMDFDTLLKFINELSGHIDLDVTLRDAEALCVCAGENGAACIPPGTPASLPIE  619

Query  228  NLLLFSQE  205
              LL+  E
Sbjct  620  --LLYPDE  625



>ref|XP_010911929.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Elaeis guineensis]
Length=667

 Score =   323 bits (828),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/193 (77%), Positives = 166/193 (86%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  L
Sbjct  475  QGMSDFLSPILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPL  534

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVAILKRY
Sbjct  535  HNYLKQADCLNYFFCFRWILIQFKREFEYLKVMHLWEVLWTHYLSEHFHLYMCVAILKRY  594

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL GHIDL+ T+RDAEALC CAGE G A IPPGTPPSLP++
Sbjct  595  RKKIMGEQMDFDTLLKFINELSGHIDLDGTIRDAEALCACAGENGTACIPPGTPPSLPVE  654

Query  228  NLLLFSQEDDDVM  190
              +    +DDDV+
Sbjct  655  TDMGLYPQDDDVL  667



>gb|KJB27079.1| hypothetical protein B456_004G276400 [Gossypium raimondii]
Length=683

 Score =   323 bits (829),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/190 (78%), Positives = 169/190 (89%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALME LGPNF  DQ+G+++QLFALSKLVELLD  L
Sbjct  492  QGMSDLLSPILFVMEDESESFWCFVALMECLGPNFNRDQSGLHSQLFALSKLVELLDNPL  551

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKRE E+EKT+RLWEVLWT +L+EH+HLYV VAILKRY
Sbjct  552  HNYFKQNDCLNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHIHLYVSVAILKRY  611

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIG++MDFDTLL FINEL G +DL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ 
Sbjct  612  RGKIIGDQMDFDTLLRFINELSGRVDLDATLRDAEALCICAGEKGADCIPPGTPPSLPVD  671

Query  228  NLLLFSQEDD  199
            N LL+SQ+D+
Sbjct  672  NGLLYSQQDE  681



>gb|AIU48655.1| RabGAP/TBC domain-containing protein, partial [Eucalyptus grandis]
Length=624

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 150/180 (83%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  440  QGMSDLLSPILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDLPL  499

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKREFE+EK + LWEV WT HL+EHLHLYVCV+ILKRY
Sbjct  500  HNYFKQNDCLNYFFCFRWLLIQFKREFEYEKVMSLWEVFWTHHLSEHLHLYVCVSILKRY  559

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G IDL T LRDAEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  560  RKKIMGEQMDFDTLLKFINELSGLIDLNTILRDAEALCICAGENGAACIPPGTPPSLPIE  619



>gb|AIU48641.1| RabGAP/TBC domain-containing protein, partial [Arabidopsis thaliana]
Length=626

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 165/182 (91%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM+TQLFALSKLVELLD  L
Sbjct  441  QGMSDYLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHTQLFALSKLVELLDSPL  500

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFK+ DCLNY FCFRWILIQFKREFE+EKT++LWEV+WT +L+EH HLYVCVA+LKR 
Sbjct  501  HNYFKENDCLNYFFCFRWILIQFKREFEYEKTMQLWEVMWTHYLSEHFHLYVCVAVLKRC  560

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKI+GE+MDFDTLL+FINEL GHIDL++T+RDAEALC+ AGE GAA IPPGTPPSLP+ 
Sbjct  561  RSKIMGEQMDFDTLLKFINELSGHIDLDSTVRDAEALCIEAGENGAASIPPGTPPSLPLD  620

Query  228  NL  223
             L
Sbjct  621  TL  622



>ref|XP_004287286.1| PREDICTED: TBC1 domain family member 15 [Fragaria vesca subsp. 
vesca]
Length=659

 Score =   322 bits (826),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFV LMERLGPNF  DQNGM++QLFA++KLVE+LD  L
Sbjct  466  QGMSDLLSPILFVMGDESESFWCFVKLMERLGPNFNRDQNGMHSQLFAITKLVEMLDSPL  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF Q+DCLNY FCFRW+LIQFKREFEF KTLRLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  526  HNYFTQRDCLNYFFCFRWVLIQFKREFEFNKTLRLWEVLWTHYPSEHLHLYVCVAILKRY  585

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL G I+L+  +RDAEALC+CAGE G A IPPGTPPSLP+ 
Sbjct  586  RSKIIGEQMDFDTLLKFINELSGQINLDAVVRDAEALCICAGENGDACIPPGTPPSLPVD  645

Query  228  NLLLFSQED-DDVM  190
            + LL+ Q++ D+V+
Sbjct  646  DGLLYPQQELDEVL  659



>gb|AIU48669.1| RabGAP/TBC domain-containing protein, partial [Erythranthe guttata]
Length=624

 Score =   321 bits (823),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVMRDES+SFWCFV+LMERLGPNF  DQ+GM++QLFALSKLVELLD  L
Sbjct  439  QGMSDLLSPILYVMRDESKSFWCFVSLMERLGPNFNRDQSGMHSQLFALSKLVELLDLPL  498

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YFKQ DCLNY FCFRWILIQFKREFE++KTL LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  499  HDYFKQNDCLNYFFCFRWILIQFKREFEYDKTLLLWEVLWTHYLSEHLHLYVCVAILKRY  558

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL G IDL+ TLR+AEALC+CAGE G A IPPGTPPSLP++
Sbjct  559  RNKIMGEQMDFDTLLKFINELSGQIDLDATLREAEALCICAGENGEASIPPGTPPSLPLE  618

Query  228  NL  223
            ++
Sbjct  619  SV  620



>gb|AIU48652.1| RabGAP/TBC domain-containing protein, partial [Carica papaya]
Length=628

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 150/182 (82%), Positives = 164/182 (90%), Gaps = 0/182 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFV LMERLGPNF  DQNGM+TQLFA+SKLVELLD  L
Sbjct  443  QGMSDLLSPILFVMEDESESFWCFVKLMERLGPNFNRDQNGMHTQLFAVSKLVELLDIPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+ KT+ LWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  503  HNYFKQNDCLNYFFCFRWILIQFKREFEYGKTMLLWEVLWTHYLSEHLHLYVCVAILKRY  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R  I+GE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE G+A IPPGTPPSLPI 
Sbjct  563  RGMIMGEQMDFDTLLKFINELSGHIDLDATLRDAEALCICAGENGSACIPPGTPPSLPID  622

Query  228  NL  223
            +L
Sbjct  623  SL  624



>gb|KHG01737.1| TBC1 domain family member 15 [Gossypium arboreum]
Length=683

 Score =   322 bits (826),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/190 (79%), Positives = 168/190 (88%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL VM DESESFWCFVALME LGPNF  DQ+GM++QLFALSKLVELLD  L
Sbjct  492  QGMSDLLSPILLVMEDESESFWCFVALMECLGPNFNRDQSGMHSQLFALSKLVELLDNPL  551

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRW+LIQFKRE E+EKT+RLWEVLWT +L+EHLHLY+ VAILKRY
Sbjct  552  HNYFKQNDCLNYFFCFRWMLIQFKRELEYEKTMRLWEVLWTHYLSEHLHLYLSVAILKRY  611

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTL+ FINEL G IDL+ TLRDAEALC+CAGE GA  IPPGTPPSLP+ 
Sbjct  612  RGKIIGEQMDFDTLIRFINELSGWIDLDATLRDAEALCICAGERGADCIPPGTPPSLPVD  671

Query  228  NLLLFSQEDD  199
            N LL+SQ+D+
Sbjct  672  NGLLYSQQDE  681



>ref|XP_007204093.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
 gb|EMJ05292.1| hypothetical protein PRUPE_ppa002904mg [Prunus persica]
Length=622

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/195 (76%), Positives = 175/195 (90%), Gaps = 3/195 (2%)
 Frame = -2

Query  765  GMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLH  586
            GMSDLLSPIL+VM DES++FWCFV+LMERLGPNF  DQNGM++QLFA++KLVELLD  LH
Sbjct  428  GMSDLLSPILFVMEDESDTFWCFVSLMERLGPNFNRDQNGMHSQLFAITKLVELLDIPLH  487

Query  585  NYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYR  406
            N+F Q+DCLNY FCFRW+LIQFKREFEF+KT+RLWEVLW  + +EHLHLYVCVAILKR+R
Sbjct  488  NHFTQRDCLNYFFCFRWVLIQFKREFEFDKTMRLWEVLWAHYPSEHLHLYVCVAILKRHR  547

Query  405  SKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQN  226
            SKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ +
Sbjct  548  SKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTPPSLPVDD  607

Query  225  --LLLFSQED-DDVM  190
              LLL+ Q++ DDV+
Sbjct  608  YGLLLYPQQELDDVL  622



>ref|XP_009789608.1| PREDICTED: TBC1 domain family member 17-like isoform X1 [Nicotiana 
sylvestris]
Length=676

 Score =   322 bits (824),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/194 (77%), Positives = 170/194 (88%), Gaps = 1/194 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM +E ESFWCFV LMERLGPNF  DQNG+++QLFALSKLVELLD  L
Sbjct  483  QGMSDFLSPILYVMENEPESFWCFVVLMERLGPNFNRDQNGVHSQLFALSKLVELLDNPL  542

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YFKQKDCLNY FCFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHLYVCVAIL+RY
Sbjct  543  HDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHLYVCVAILRRY  602

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IPPGTPPS P +
Sbjct  603  RSKIIGEEMDFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIPPGTPPSFPFE  662

Query  228  NL-LLFSQEDDDVM  190
               + + Q+DDDV+
Sbjct  663  GTSMCYQQDDDDVL  676



>ref|XP_008242808.1| PREDICTED: TBC1 domain family member 17 [Prunus mume]
Length=661

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 175/196 (89%), Gaps = 3/196 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES++FWCFV+LMERLGPNF  DQNGM++QLFA++KLVELLD  L
Sbjct  466  QGMSDLLSPILFVMEDESDTFWCFVSLMERLGPNFNRDQNGMHSQLFAITKLVELLDIPL  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HN+F Q DCLNY FCFRW+LIQFKREFEF+KT+RLWEVLW  + +EHLHLYVCVAILKR+
Sbjct  526  HNHFTQHDCLNYFFCFRWVLIQFKREFEFDKTMRLWEVLWAHYPSEHLHLYVCVAILKRH  585

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  586  RSKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTPPSLPVD  645

Query  228  N--LLLFSQED-DDVM  190
            +  LLL+ Q++ DDV+
Sbjct  646  DYGLLLYPQQELDDVL  661



>gb|AIU48667.1| RabGAP/TBC domain-containing protein, partial [Canna indica]
Length=628

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVE+LD  L
Sbjct  443  QGMSDLLSPILYVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVEILDSPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+++ + LWEVLWT HL+EHLHLY+CVAILKR+
Sbjct  503  HNYFKQADCLNYFFCFRWILIQFKREFEYDQIMHLWEVLWTHHLSEHLHLYMCVAILKRH  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL GHIDL+ T+R+AEALC CAGE GAA IPPGTPPSLPI+
Sbjct  563  RKKIMGEQMDFDTLLKFINELSGHIDLDWTIREAEALCTCAGENGAACIPPGTPPSLPIE  622



>ref|XP_008377303.1| PREDICTED: TBC1 domain family member 17 [Malus domestica]
Length=660

 Score =   320 bits (819),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 147/194 (76%), Positives = 172/194 (89%), Gaps = 1/194 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM DESESFWCFV+LMERLGPNF  DQ+GM++QLFA+ KLVELLD  L
Sbjct  467  QGMSDLLSPILYVMEDESESFWCFVSLMERLGPNFNRDQSGMHSQLFAIMKLVELLDAPL  526

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HN+F QKDCLNY FCFRW+LIQFKREFEF+KT+RLWE+LWT +  EHLHLYV VAILKR+
Sbjct  527  HNHFTQKDCLNYFFCFRWVLIQFKREFEFDKTMRLWELLWTHYPAEHLHLYVXVAILKRH  586

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RSKIIGE+MDFDTLL+FINEL  HIDL+  +RDAEALC+ AGE GAA IPPGTPPSLP+ 
Sbjct  587  RSKIIGEQMDFDTLLKFINELSXHIDLDAVVRDAEALCIXAGENGAASIPPGTPPSLPVD  646

Query  228  NLLLFSQED-DDVM  190
            ++LL+ Q++ DD++
Sbjct  647  DVLLYPQQELDDIL  660



>gb|AIU48644.1| RabGAP/TBC domain-containing protein, partial [Musa acuminata]
Length=319

 Score =   308 bits (789),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM+DE+ESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVE+LD  L
Sbjct  134  QGMSDFLSPILYVMKDEAESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVEILDSPL  193

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+++ + LWEVLWT +L+EHLHLY+CVAILK +
Sbjct  194  HNYFKQTDCLNYFFCFRWILIQFKREFEYDQVMHLWEVLWTHYLSEHLHLYMCVAILKSH  253

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G+IDL+ T+R+AEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  254  RKKIMGEQMDFDTLLKFINELSGNIDLDWTIREAEALCICAGENGAACIPPGTPPSLPIE  313



>gb|AIU48691.1| RabGAP/TBC domain-containing protein, partial [Cabomba caroliniana]
Length=409

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  L
Sbjct  230  QGMSDFLSPILYVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDLPL  289

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+EK + LWEVLWT +L+EH HLYVCVAILKRY
Sbjct  290  HNYLKQADCLNYFFCFRWILIQFKREFEYEKIMHLWEVLWTHYLSEHFHLYVCVAILKRY  349

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KII E+MDFDTLL+FINEL  HI L++TLRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  350  RRKIIDEQMDFDTLLKFINELSCHIHLDSTLRDAEALCVCAGENGAALIPPGTPPSLPVE  409



>gb|AIU48662.1| RabGAP/TBC domain-containing protein, partial [Chimonanthus praecox]
Length=627

 Score =   317 bits (811),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 148/190 (78%), Positives = 166/190 (87%), Gaps = 4/190 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFV+LMERLGPNF  DQNGM++QLFALSKLV+LLD  L
Sbjct  442  QGMSDLLSPILFVMEDESQSFWCFVSLMERLGPNFNRDQNGMHSQLFALSKLVQLLDSPL  501

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+EK + LWEVLWT +L+EH HLYVCVAILKR+
Sbjct  502  HNYLKQADCLNYFFCFRWILIQFKREFEYEKIMHLWEVLWTHYLSEHFHLYVCVAILKRF  561

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
              +IIGE+MDFDTLL+FINEL GHIDL+ TLRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  562  CKRIIGEQMDFDTLLKFINELSGHIDLDRTLRDAEALCICAGENGAACIPPGTPPSLPVE  621

Query  228  NLLLFSQEDD  199
                FS  DD
Sbjct  622  ----FSYPDD  627



>ref|XP_008456989.1| PREDICTED: TBC1 domain family member 15 [Cucumis melo]
Length=655

 Score =   317 bits (811),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 143/190 (75%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQ GM+ QLFA+SKLVELLD  L
Sbjct  464  QGMSDFLSPILFVMGDESESFWCFVALMERLGPNFNRDQTGMHCQLFAISKLVELLDTPL  523

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF Q DCLNY FCFRW+LIQFKREFE+EK + LWEVLWT + +EHLHLY+CVA+LKRY
Sbjct  524  HNYFSQHDCLNYFFCFRWVLIQFKREFEYEKVMHLWEVLWTHYPSEHLHLYICVAVLKRY  583

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  584  RNKIMGEQMDFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTPPSLPLD  643

Query  228  NLLLFSQEDD  199
            +   + Q D+
Sbjct  644  DGSYYIQHDE  653



>gb|AIU48671.1| RabGAP/TBC domain-containing protein, partial [Prunus persica]
Length=589

 Score =   315 bits (806),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = -2

Query  765  GMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLH  586
            GMSDLLSPIL+VM DES++FWCFV+LMERLGPNF  DQNGM++QLFA++KLVELLD  LH
Sbjct  405  GMSDLLSPILFVMEDESDTFWCFVSLMERLGPNFNRDQNGMHSQLFAITKLVELLDIPLH  464

Query  585  NYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYR  406
            N+F Q+DCLNY FCFRW+LIQFKREFEF+KT+RLWEVLW  + +EHLHLYVCVAILKR+R
Sbjct  465  NHFTQRDCLNYFFCFRWVLIQFKREFEFDKTMRLWEVLWAHYPSEHLHLYVCVAILKRHR  524

Query  405  SKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
            SKIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+
Sbjct  525  SKIIGEQMDFDTLLKFINELSGHIDLDAVVRDAEALCICAGENGAACIPPGTPPSLPV  582



>ref|XP_009420718.1| PREDICTED: TBC1 domain family member 15 [Musa acuminata subsp. 
malaccensis]
Length=667

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 172/191 (90%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPILYVM+DE+ESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVE+LD  L
Sbjct  475  QGMSDFLSPILYVMKDEAESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVEILDSPL  534

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+++ + LWEVLWT +L+EHLHLY+CVAILK +
Sbjct  535  HNYFKQTDCLNYFFCFRWILIQFKREFEYDQVMHLWEVLWTHYLSEHLHLYMCVAILKSH  594

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G+IDL+ T+R+AEALC+CAGE GAA IPPGTPPSLPI+
Sbjct  595  RKKIMGEQMDFDTLLKFINELSGNIDLDWTIREAEALCICAGENGAACIPPGTPPSLPIE  654

Query  228  -NLLLFSQEDD  199
             ++ L+ QED+
Sbjct  655  PDMGLYPQEDE  665



>gb|AIU48690.1| RabGAP/TBC domain-containing protein, partial [Trachycarpus fortunei]
Length=627

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM+DESESFWCFVALMERLGPNF  DQNGM++QL ALSKLVELLD  L
Sbjct  442  QGMSDLLSPILYVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLLALSKLVELLDSPL  501

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+ K + LWEVLWT +L+EH HLY+CVAILKRY
Sbjct  502  HNYLKQADCLNYFFCFRWILIQFKREFEYTKIMHLWEVLWTHYLSEHFHLYMCVAILKRY  561

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL GHI+L+ T+RDAEALC+CAGE GAA IPPGTP SLP++
Sbjct  562  RKKIMGEQMDFDTLLKFINELSGHINLDGTIRDAEALCVCAGENGAACIPPGTPASLPVE  621



>gb|AIU48648.1| RabGAP/TBC domain-containing protein, partial [Acorus calamus]
Length=550

 Score =   312 bits (800),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FW FVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  365  QGMSDLLSPILFVMEDESEAFWSFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDSPL  424

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+E+ + LWEV WT +L+EH HLYVCVAILKRY
Sbjct  425  HNYLKQADCLNYFFCFRWILIQFKREFEYEQVMYLWEVFWTHYLSEHFHLYVCVAILKRY  484

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
              KIIGE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE G A IPPGTPPSLPI+
Sbjct  485  SKKIIGEQMDFDTLLKFINELSGHIDLDGIIRDAEALCVCAGENGEACIPPGTPPSLPIE  544

Query  228  NLLL  217
            ++ L
Sbjct  545  SMYL  548



>gb|AIU48645.1| RabGAP/TBC domain-containing protein, partial [Pinellia ternata]
Length=624

 Score =   314 bits (805),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 168/188 (89%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DE ESFWCFV LMERLGPNF  DQ+GM+ QLFALSKLVE+LD  L
Sbjct  439  QGMSDLLSPILFVMGDEPESFWCFVELMERLGPNFNRDQSGMHAQLFALSKLVEILDCPL  498

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY +Q DCLNY FCFRWILIQFKREFE+EK +RLWEVLWT++L+EHLHLYVCVA+LKRY
Sbjct  499  HNYLRQADCLNYFFCFRWILIQFKREFEYEKVMRLWEVLWTRYLSEHLHLYVCVAVLKRY  558

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL GHI+L+  LRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  559  RKKIMGEQMDFDTLLKFINELSGHINLDDILRDAEALCICAGENGAACIPPGTPPSLPME  618

Query  228  NLLLFSQE  205
              LL+S++
Sbjct  619  --LLYSEQ  624



>ref|XP_004139297.1| PREDICTED: TBC1 domain family member 15-like [Cucumis sativus]
 gb|KGN60701.1| hypothetical protein Csa_2G007450 [Cucumis sativus]
Length=655

 Score =   315 bits (807),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 164/190 (86%), Gaps = 0/190 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQ GM+ QLFA+SKLVELLD  L
Sbjct  464  QGMSDFLSPILFVMGDESESFWCFVALMERLGPNFNRDQTGMHCQLFAISKLVELLDTPL  523

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF Q DCLNY FCFRW+LIQFKREF +EK + LWEVLWT + +EHLHLY+CVA+LKRY
Sbjct  524  HNYFSQHDCLNYFFCFRWVLIQFKREFAYEKVMHLWEVLWTHYPSEHLHLYICVAVLKRY  583

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL GHIDL+  +RDAEALC+CAGE GAA IPPGTPPSLP+ 
Sbjct  584  RNKIMGEQMDFDTLLKFINELSGHIDLDAAIRDAEALCVCAGENGAANIPPGTPPSLPLD  643

Query  228  NLLLFSQEDD  199
            +   + Q+D+
Sbjct  644  DGSYYIQQDE  653



>gb|AIU48660.1| RabGAP/TBC domain-containing protein, partial [Chloranthus japonicus]
Length=627

 Score =   313 bits (802),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 165/188 (88%), Gaps = 2/188 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DE+ESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  442  QGMSDLLSPILFVMNDEAESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDVPL  501

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+EKT+ LWEVLWT +L+EH HLY+C+AILKRY
Sbjct  502  HNYLKQADCLNYFFCFRWILIQFKREFEYEKTMYLWEVLWTHYLSEHFHLYICIAILKRY  561

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
              KI+ E+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  562  HKKIMDEEMDFDTLLKFINELSGRIDLDAALRDAEALCICAGENGAACIPPGTPPSLPVE  621

Query  228  NLLLFSQE  205
              LL+S +
Sbjct  622  --LLYSDD  627



>gb|AIU48651.1| RabGAP/TBC domain-containing protein, partial [Gossypium raimondii]
Length=624

 Score =   313 bits (802),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/189 (78%), Positives = 165/189 (87%), Gaps = 3/189 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  439  QGMSDLLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDRPL  498

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H YF+Q DCLNY FCFRWILIQFKRE E+E+T+RLWEVLWT +L+EHLHLYVCVAILKRY
Sbjct  499  HKYFEQNDCLNYFFCFRWILIQFKRELEYEQTMRLWEVLWTHYLSEHLHLYVCVAILKRY  558

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGT PSLP+ 
Sbjct  559  RGKIMGEQMDFDTLLKFINELSGQIELDAILRDAEALCICAGENGAACIPPGTVPSLPVD  618

Query  228  NLLLFSQED  202
               LF  +D
Sbjct  619  ---LFYSDD  624



>ref|XP_011469988.1| PREDICTED: LOW QUALITY PROTEIN: TBC1 domain family member 15-like 
[Fragaria vesca subsp. vesca]
Length=634

 Score =   313 bits (801),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/191 (76%), Positives = 168/191 (88%), Gaps = 0/191 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+V+ DESESFWCFV LMERLGPNF LDQNGM+ QLFA++KLVE+LD  L
Sbjct  441  QGMSDLLSPILFVLGDESESFWCFVKLMERLGPNFNLDQNGMHFQLFAITKLVEMLDKPL  500

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YF Q+DCLNY FCFRW+LIQFKREFEF+KTLRLWEVLWT + +EHLHLYVCVAILKRY
Sbjct  501  HSYFTQRDCLNYFFCFRWVLIQFKREFEFDKTLRLWEVLWTHYPSEHLHLYVCVAILKRY  560

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
             SKIIGE+MDFDTLL+FINEL G I+L+  +RDAEALC+CAGE G A IPP TPPSLP+ 
Sbjct  561  GSKIIGEQMDFDTLLKFINELSGQINLDAVVRDAEALCICAGENGDACIPPETPPSLPVD  620

Query  228  NLLLFSQEDDD  196
            + LL+ Q++ D
Sbjct  621  DGLLYPQQEVD  631



>gb|AIU48677.1| RabGAP/TBC domain-containing protein, partial [Yucca filamentosa]
Length=624

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  441  QGMSDLLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDQPL  500

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY +QKDCLNY FCFRWILIQFKREFE+EK + LWEVLWT +L+EH HLY+CVAILK+Y
Sbjct  501  HNYLRQKDCLNYFFCFRWILIQFKREFEYEKIMHLWEVLWTYYLSEHFHLYMCVAILKKY  560

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL++INEL G I+L+  +RDAEALCLCAGE GAA IPPGTPPS+P++
Sbjct  561  RKKIIGEQMDFDTLLKYINELSGRINLDEIIRDAEALCLCAGENGAACIPPGTPPSMPLE  620

Query  228  N  226
            +
Sbjct  621  D  621



>gb|AIU48664.1| RabGAP/TBC domain-containing protein, partial [Asparagus officinalis]
Length=625

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  442  QGMSDFLSPILFVMEDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDQPL  501

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY +QKDCLNY FCFRWILIQFKREFE+EK + LWEVLWT +L+EH HLY+CVAILK+Y
Sbjct  502  HNYLRQKDCLNYFFCFRWILIQFKREFEYEKIMHLWEVLWTYYLSEHFHLYMCVAILKKY  561

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +I+GE+MDFDTLL+FINEL GHI+L+  +RDAEALC CAGE GAA IPPGTPPS+P++
Sbjct  562  RQRIVGEQMDFDTLLKFINELSGHINLDDIIRDAEALCNCAGEQGAACIPPGTPPSMPLE  621

Query  228  N  226
            +
Sbjct  622  D  622



>gb|AIU48657.1| RabGAP/TBC domain-containing protein, partial [Illicium henryi]
Length=619

 Score =   311 bits (796),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 161/179 (90%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM+DESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVE+LDG L
Sbjct  440  QGMSDLLSPILFVMKDESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVEILDGPL  499

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            ++Y  Q DCLNY FCFRWILIQFKREFE+EK +RLWEVLWT +L+EH HLYVCVAILKRY
Sbjct  500  NSYLTQADCLNYFFCFRWILIQFKREFEYEKIMRLWEVLWTHYLSEHFHLYVCVAILKRY  559

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
              KI+ E+MDFDTLL+FINEL G I+LE TLRDAEALC+CAGE GAA IPPGTPPSLP+
Sbjct  560  HKKIMDEQMDFDTLLKFINELSGRIELEGTLRDAEALCICAGENGAACIPPGTPPSLPL  618



>gb|AIU48686.1| RabGAP/TBC domain-containing protein, partial [Ginkgo biloba]
Length=617

 Score =   310 bits (794),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/179 (79%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL++M DESE+FWCFVALMERLGPNF  DQNGM++QL ALSKLVE LDG L
Sbjct  439  QGMSDLLSPILFIMEDESEAFWCFVALMERLGPNFDRDQNGMHSQLLALSKLVEFLDGPL  498

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRWILIQFKREF++EK +RLWEVLWT +L+EH HLY+CVA+LKR+
Sbjct  499  HNYFRQADCLNYFFCFRWILIQFKREFDYEKVMRLWEVLWTHYLSEHFHLYMCVALLKRH  558

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
            R KII EKMDFDTLL+FINEL  HIDLE TLRDAEALC+CAG+ G+A IP GTPPSLPI
Sbjct  559  RKKIIDEKMDFDTLLKFINELSCHIDLEATLRDAEALCICAGDTGSACIPQGTPPSLPI  617



>gb|AIU48684.1| RabGAP/TBC domain-containing protein, partial [Cinnamomum camphora]
Length=561

 Score =   308 bits (788),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/189 (77%), Positives = 164/189 (87%), Gaps = 3/189 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM  ESESFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  376  QGMSDLLSPILFVMEGESESFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDIPL  435

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKRE E+  T+RLWEVLWT +L+EH HLY+ VAILKR+
Sbjct  436  HNYLKQADCLNYFFCFRWILIQFKRELEYGMTMRLWEVLWTHYLSEHFHLYLSVAILKRH  495

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL+FINEL GH+DL++ LRDAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  496  RKKIIGEQMDFDTLLKFINELSGHLDLDSALRDAEALCICAGENGAACIPPGTPPSLPVE  555

Query  228  NLLLFSQED  202
                F+ +D
Sbjct  556  ---FFNSDD  561



>gb|AIU48687.1| RabGAP/TBC domain-containing protein, partial [Houttuynia cordata]
Length=622

 Score =   309 bits (792),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 141/178 (79%), Positives = 157/178 (88%), Gaps = 0/178 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL PIL+VM DE+ESFWCF ALMERLG NF  DQ+GM++QLFALSKLVELLDG L
Sbjct  437  QGMSDLLGPILFVMEDETESFWCFAALMERLGANFNRDQSGMHSQLFALSKLVELLDGPL  496

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+E  +R+WEVLWT HL+EH HLY+CVAILKR+
Sbjct  497  HNYLKQADCLNYFFCFRWILIQFKREFEYEMLMRMWEVLWTHHLSEHFHLYICVAILKRH  556

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLP  235
            R KI+GE+MDFDTLL+FINEL G IDL+  LRDAEALC+CAGE GAA IPPGTPPSLP
Sbjct  557  RKKIMGEQMDFDTLLKFINELSGQIDLDGILRDAEALCICAGENGAACIPPGTPPSLP  614



>gb|AIU48665.1| RabGAP/TBC domain-containing protein, partial [Aristolochia tagala]
Length=616

 Score =   308 bits (789),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PIL+VMRDE ESFWCFV+LMERLGPNF  DQ+GM++QLFALSKLVE+LD  L
Sbjct  431  QGMSDLLAPILFVMRDEVESFWCFVSLMERLGPNFNRDQSGMHSQLFALSKLVEILDSPL  490

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREF ++  LR+WEVLWT +L+EH  LYVCVAILKRY
Sbjct  491  HNYFKQADCLNYFFCFRWILIQFKREFSYDSILRMWEVLWTYYLSEHFQLYVCVAILKRY  550

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KIIGE+MDFDTLL+FINEL G I+L+  LRDAEALC+CAGE GAA IPPGTPPSLP +
Sbjct  551  RKKIIGEQMDFDTLLKFINELSGSIELDGILRDAEALCICAGENGAACIPPGTPPSLPFE  610

Query  228  N  226
            +
Sbjct  611  S  611



>ref|XP_010687933.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=622

 Score =   308 bits (788),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSP+L+VM DE E FWCF ALMER+GPNF  DQ+GM+ QLFALSKLVEL D  L
Sbjct  430  QGMSDYLSPLLFVMEDEFEVFWCFAALMERVGPNFNRDQSGMHAQLFALSKLVELSDSPL  489

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKRE  +E+T+RLWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  490  HNYLKQNDCLNYFFCFRWILIQFKRELRYEETMRLWEVLWTHYLSEHLHLYVCVAILKRC  549

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KIIGE+MDFDTLL+FIN L GHIDL+  LRDAEALC+C+GE GAA IPPGTPPSLP++
Sbjct  550  RNKIIGEQMDFDTLLKFINGLSGHIDLDAILRDAEALCICSGETGAACIPPGTPPSLPME  609

Query  228  NLLLFSQEDDDVM  190
            N  L SQ +D+++
Sbjct  610  NGPLSSQLEDEIL  622



>ref|XP_010687932.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=656

 Score =   309 bits (791),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 143/193 (74%), Positives = 165/193 (85%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSP+L+VM DE E FWCF ALMER+GPNF  DQ+GM+ QLFALSKLVEL D  L
Sbjct  464  QGMSDYLSPLLFVMEDEFEVFWCFAALMERVGPNFNRDQSGMHAQLFALSKLVELSDSPL  523

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKRE  +E+T+RLWEVLWT +L+EHLHLYVCVAILKR 
Sbjct  524  HNYLKQNDCLNYFFCFRWILIQFKRELRYEETMRLWEVLWTHYLSEHLHLYVCVAILKRC  583

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KIIGE+MDFDTLL+FIN L GHIDL+  LRDAEALC+C+GE GAA IPPGTPPSLP++
Sbjct  584  RNKIIGEQMDFDTLLKFINGLSGHIDLDAILRDAEALCICSGETGAACIPPGTPPSLPME  643

Query  228  NLLLFSQEDDDVM  190
            N  L SQ +D+++
Sbjct  644  NGPLSSQLEDEIL  656



>gb|AIU48676.1| RabGAP/TBC domain-containing protein, partial [Dioscorea oppositifolia]
Length=625

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DE+E+FWCF ALMERLGPNF  DQNGM++QLFAL+KLVE+LD  L
Sbjct  440  QGMSDLLSPILFVMEDEAEAFWCFAALMERLGPNFNRDQNGMHSQLFALAKLVEVLDSPL  499

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY +Q DCLNY FCFRWILIQFKREFE+EK ++LWEVLWT +L+EH HLY+CVAILK+Y
Sbjct  500  HNYLRQADCLNYFFCFRWILIQFKREFEYEKVMQLWEVLWTHYLSEHFHLYICVAILKKY  559

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KII E+MDFDTLL+FINEL G IDL++ ++DAEALC+CAGE GAA IPPGTPPSLP++
Sbjct  560  RKKIIDEQMDFDTLLKFINELSGQIDLDSIIKDAEALCICAGENGAACIPPGTPPSLPLE  619



>gb|AIU48642.1| RabGAP/TBC domain-containing protein, partial [Lilium brownii]
Length=620

 Score =   305 bits (782),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD LSPIL+VM DESESFWCFVALMER+GPNF  DQNGM+ QLFALSKLVELLD  L
Sbjct  435  QGMSDFLSPILFVMEDESESFWCFVALMERMGPNFNRDQNGMHAQLFALSKLVELLDYPL  494

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREF +EK + LWEVLWT +L+EH HLY+CVAILK+Y
Sbjct  495  HNYFKQADCLNYFFCFRWILIQFKREFPYEKIMLLWEVLWTHYLSEHFHLYMCVAILKQY  554

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
            R KI+ E+MDFDTLL+FINEL  HIDL+ T+R+AEALC+ AGE GAA IPPGTPPSLPI
Sbjct  555  RRKIMDEQMDFDTLLKFINELSDHIDLDRTIREAEALCVLAGENGAASIPPGTPPSLPI  613



>gb|AIU48661.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
demersum]
Length=615

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFV+LMERLGPNF  DQ+GM++QLFAL+KLVELLD  L
Sbjct  437  QGMSDLLSPILFVMGDESESFWCFVSLMERLGPNFNRDQSGMHSQLFALTKLVELLDSTL  496

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRW+LIQFKREFE+++ L LWEV WT +L+EH HLYVCVAILKRY
Sbjct  497  HNYLKQADCLNYFFCFRWLLIQFKREFEYDRILYLWEVFWTHYLSEHFHLYVCVAILKRY  556

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
              KI+ EKMDFDTLL+FINEL GHI+L+  LRDAEALC+CAGE G A IPPGTPPSLPI
Sbjct  557  AKKIVNEKMDFDTLLKFINELSGHINLDEALRDAEALCVCAGENGEACIPPGTPPSLPI  615



>gb|AIU48683.1| RabGAP/TBC domain-containing protein, partial [Ceratophyllum 
platyacanthum subsp. oryzetorum]
Length=615

 Score =   304 bits (779),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESESFWCFV+LMERLGPNF  DQ+GM++QLFAL+KLVELLD  L
Sbjct  437  QGMSDLLSPILFVMGDESESFWCFVSLMERLGPNFNRDQSGMHSQLFALTKLVELLDSTL  496

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRW+LIQFKREFE+++ L LWEV WT +L+EH HLYVCVAILKRY
Sbjct  497  HNYLKQADCLNYFFCFRWLLIQFKREFEYDRILYLWEVFWTHYLSEHFHLYVCVAILKRY  556

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI  232
              KI+ EKMDFDTLL+FINEL GHI+L+  LRDAEALC+CAGE G A IPPGTPPSLPI
Sbjct  557  AKKIVNEKMDFDTLLKFINELSGHINLDEALRDAEALCVCAGENGEACIPPGTPPSLPI  615



>gb|AIU48689.1| RabGAP/TBC domain-containing protein, partial [Alisma plantago-aquatica]
Length=628

 Score =   303 bits (775),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSP+L+VM DESESFWCFVALMERLGPNF  DQ+GM++QLF LSKLVELLD  L
Sbjct  443  QGMSDLLSPLLFVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFGLSKLVELLDLPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREF+F + +RLWEVLWT++ +EHLHLY+ VAILKRY
Sbjct  503  HNYLKQADCLNYFFCFRWILIQFKREFDFNQVMRLWEVLWTRYPSEHLHLYLSVAILKRY  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+GE+MDFDTLL+FINEL G +DL++ +RDAEALC+CAGE G A IPPGTPPSLP++
Sbjct  563  RKKIMGEQMDFDTLLKFINELSGRVDLDSIIRDAEALCICAGENGEACIPPGTPPSLPLE  622

Query  228  N  226
            +
Sbjct  623  S  623



>gb|AIU48659.1| RabGAP/TBC domain-containing protein, partial [Iris japonica]
Length=629

 Score =   300 bits (768),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 137/178 (77%), Positives = 158/178 (89%), Gaps = 0/178 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVMRDESE+FW FVALM+RLGPNF  DQ+GM++QLFALSKLVELLD  L
Sbjct  444  QGMSDLLSPILYVMRDESEAFWSFVALMDRLGPNFNRDQSGMHSQLFALSKLVELLDHSL  503

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRWILIQFKREFE+E+ +RLWEVLWT + +EHLHLY+CVAILK +
Sbjct  504  HNYFRQADCLNYFFCFRWILIQFKREFEYEEVMRLWEVLWTHYPSEHLHLYLCVAILKSH  563

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLP  235
            + KI+ E+MDFDTLL+FINEL   IDL++ +RDAEALC+CAGE GAA IPPGTPPS P
Sbjct  564  KKKIMEEQMDFDTLLKFINELSNQIDLDSIIRDAEALCICAGENGAACIPPGTPPSCP  621



>ref|XP_006647781.1| PREDICTED: TBC1 domain family member 15-like [Oryza brachyantha]
Length=635

 Score =   299 bits (766),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 162/191 (85%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF  LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  443  QGMSDFLAPILYVMEDESESFWCFAILMERLGANFNRDQNGMHAQLLALSKLVELLDPAL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ L LWEVLWT +L+EH HLY+CVAILKRY
Sbjct  503  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQILLLWEVLWTHYLSEHFHLYLCVAILKRY  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RS+IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC+ AGE GAA IPPGTPPS+PI+
Sbjct  563  RSRIIGEQMDFDTLLKFINELSGEINLDRAIQDAEALCVIAGEKGAACIPPGTPPSMPIE  622

Query  228  -NLLLFSQEDD  199
             +  L+ Q+D+
Sbjct  623  TDGGLYVQQDE  633



>gb|AIU48688.1| RabGAP/TBC domain-containing protein, partial [Zea mays]
Length=450

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  265  QGMSDFLAPILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPSL  324

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLW+ +L+EH HLY+CVAILK+Y
Sbjct  325  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWSHYLSEHFHLYLCVAILKKY  384

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+P++
Sbjct  385  RQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPVE  444

Query  228  NLLLFSQED  202
               ++ QED
Sbjct  445  ---MYVQED  450



>gb|KDP30256.1| hypothetical protein JCGZ_17038 [Jatropha curcas]
Length=687

 Score =   300 bits (767),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 153/192 (80%), Positives = 172/192 (90%), Gaps = 2/192 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QG SDLLSPIL+VM DESESFWCFVALMERLGPNF  DQ+GM++QLFALSKLVELLD  L
Sbjct  494  QGTSDLLSPILFVMEDESESFWCFVALMERLGPNFNRDQSGMHSQLFALSKLVELLDSPL  553

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYFKQ DCLNY FCFRWILIQFKREFE+EKT+RLWEVLWT +L EHLHLY CVAILKRY
Sbjct  554  HNYFKQNDCLNYFFCFRWILIQFKREFEYEKTIRLWEVLWTHYLCEHLHLYACVAILKRY  613

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R+KI+GE+MDFDTLL+FINEL GHIDL+  LRDAEALC+CAGE GAA +PPGTPPSLP +
Sbjct  614  RNKIMGEQMDFDTLLKFINELSGHIDLDAILRDAEALCICAGENGAACVPPGTPPSLPPE  673

Query  228  NL--LLFSQEDD  199
            N   LL++Q+D+
Sbjct  674  NENGLLYTQQDE  685



>gb|AIU48672.1| RabGAP/TBC domain-containing protein, partial [Panicum virgatum]
Length=628

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  443  QGMSDFLAPILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILKRY
Sbjct  503  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQVMLLWEVLWTHYLSEHFHLYLCVAILKRY  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+PI+
Sbjct  563  RQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPIE  622

Query  228  NLLLFSQED  202
               L+ QED
Sbjct  623  ---LYVQED  628



>gb|AIU48679.1| RabGAP/TBC domain-containing protein, partial [Sorghum bicolor]
Length=616

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  431  QGMSDFLAPILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPL  490

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILK+Y
Sbjct  491  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKKY  550

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+PI+
Sbjct  551  RQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPIE  610

Query  228  NLLLFSQED  202
               L+ QED
Sbjct  611  ---LYVQED  616



>ref|XP_004953647.1| PREDICTED: TBC1 domain family member 15-like [Setaria italica]
Length=672

 Score =   298 bits (762),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  480  QGMSDFLAPILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPL  539

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILKRY
Sbjct  540  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKRY  599

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE+MDFDTLL+FINEL G I+L+  L+DAEALC  AGE GA+ IPPGTPPS+PI+
Sbjct  600  RQRIIGEQMDFDTLLKFINELSGQINLDRALQDAEALCTIAGENGASCIPPGTPPSMPIE  659

Query  228  -NLLLFSQEDD  199
             +  L+ Q+DD
Sbjct  660  TDGGLYVQQDD  670



>gb|AIU48678.1| RabGAP/TBC domain-containing protein, partial [Setaria italica]
Length=628

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/189 (72%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  443  QGMSDFLAPILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILKRY
Sbjct  503  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKRY  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE+MDFDTLL+FINEL G I+L+  L+DAEALC  AGE GA+ IPPGTPPS+PI+
Sbjct  563  RQRIIGEQMDFDTLLKFINELSGQINLDRALQDAEALCTIAGENGASCIPPGTPPSMPIE  622

Query  228  NLLLFSQED  202
               L+ Q+D
Sbjct  623  ---LYVQQD  628



>ref|XP_002452666.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
 gb|EES05642.1| hypothetical protein SORBIDRAFT_04g030250 [Sorghum bicolor]
Length=661

 Score =   296 bits (757),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 136/191 (71%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  469  QGMSDFLAPILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPPL  528

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLWT +L+EH HLY+CVAILK+Y
Sbjct  529  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYLSEHFHLYLCVAILKKY  588

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+PI+
Sbjct  589  RQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPIE  648

Query  228  -NLLLFSQEDD  199
             +  L+ QED+
Sbjct  649  TDGGLYVQEDE  659



>gb|AIU48646.1| RabGAP/TBC domain-containing protein, partial [Brachypodium distachyon]
Length=628

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 136/189 (72%), Positives = 159/189 (84%), Gaps = 3/189 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PIL+VM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  443  QGMSDFLAPILHVMEDESESFWCFASLMERLGGNFNRDQNGMHAQLLALSKLVELLDPPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLWTQ+L+EH HLY+CVAILKRY
Sbjct  503  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTQYLSEHFHLYLCVAILKRY  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AG+ GAA IPPGTPPSLP++
Sbjct  563  RQRIIGEGMDFDTLLKFINELSGQINIDQAIQDAEALCTIAGDNGAACIPPGTPPSLPVE  622

Query  228  NLLLFSQED  202
               L+ QED
Sbjct  623  ---LYLQED  628



>ref|XP_003570212.1| PREDICTED: TBC1 domain family member 15 [Brachypodium distachyon]
Length=677

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PIL+VM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  485  QGMSDFLAPILHVMEDESESFWCFASLMERLGGNFNRDQNGMHAQLLALSKLVELLDPPL  544

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLWTQ+L+EH HLY+CVAILKRY
Sbjct  545  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTQYLSEHFHLYLCVAILKRY  604

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AG+ GAA IPPGTPPSLP++
Sbjct  605  RQRIIGEGMDFDTLLKFINELSGQINIDQAIQDAEALCTIAGDNGAACIPPGTPPSLPVE  664

Query  228  -NLLLFSQEDD  199
             +  L+ QEDD
Sbjct  665  TDGGLYLQEDD  675



>ref|XP_006855176.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
 gb|ERN16643.1| hypothetical protein AMTR_s00051p00106780 [Amborella trichopoda]
Length=688

 Score =   295 bits (755),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DESE+FWCFV+LMERLGPNF  DQNGM++QL ALSKLVE LD  L
Sbjct  504  QGMSDLLSPILFVMEDESEAFWCFVSLMERLGPNFNRDQNGMHSQLLALSKLVEFLDSPL  563

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H Y +Q DCLN+ FCFRWILIQFKREF +EKT+RLWEVLWT +L+EH HLY+CVAILK++
Sbjct  564  HCYLRQADCLNFFFCFRWILIQFKREFVYEKTMRLWEVLWTHYLSEHFHLYMCVAILKKH  623

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KII E+MDFDTLL+FINEL  HI LE TL+DAEALC+ AGE  AA IPPGTPPSLP++
Sbjct  624  RKKIIEERMDFDTLLKFINELSCHITLEATLKDAEALCIIAGENKAACIPPGTPPSLPVE  683

Query  228  NLLL  217
              LL
Sbjct  684  GGLL  687



>ref|NP_001168835.1| uncharacterized protein LOC100382640 [Zea mays]
 gb|ACN30830.1| unknown [Zea mays]
 gb|AFW63576.2| hypothetical protein ZEAMMB73_375304 [Zea mays]
Length=671

 Score =   294 bits (753),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 161/191 (84%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF +LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  479  QGMSDFLAPILYVMEDESESFWCFASLMERLGANFNRDQNGMHAQLLALSKLVELLDPSL  538

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKREF F++ + LWEVLW+ +L+EH HLY+CVAILK+Y
Sbjct  539  HNYFRQNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWSHYLSEHFHLYLCVAILKKY  598

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AGE GA+ IPPGTPPS+P++
Sbjct  599  RQRIIGEQMDFDTLLKFINELSGQINLDRAIQDAEALCTIAGENGASCIPPGTPPSMPVE  658

Query  228  -NLLLFSQEDD  199
             +  ++ QED+
Sbjct  659  TDGGMYVQEDE  669



>gb|AIU48643.1| RabGAP/TBC domain-containing protein, partial [Magnolia denudata]
Length=622

 Score =   293 bits (749),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM +ESESFWCFVALMERLGPNF  DQNGM++QL AL KLVELLD  L
Sbjct  443  QGMSDLLSPILFVMGNESESFWCFVALMERLGPNFDRDQNGMHSQLLALLKLVELLDSPL  502

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNY KQ DCLNY FCFRWILIQFKREFE+EKT+ LWEVLWT +L+EH HLYVCVAILKRY
Sbjct  503  HNYLKQADCLNYFFCFRWILIQFKREFEYEKTMLLWEVLWTHYLSEHFHLYVCVAILKRY  562

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+G++MDFDTLL+FINEL GHIDL   +RD EALC+CAGE G+A IPPGTPPSLPI 
Sbjct  563  RQKIMGDQMDFDTLLKFINELSGHIDLNGAIRDGEALCICAGENGSACIPPGTPPSLPIN  622



>ref|NP_001047892.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAD72476.1| GTPase activating protein-like [Oryza sativa Japonica Group]
 dbj|BAF09806.1| Os02g0709800 [Oryza sativa Japonica Group]
 dbj|BAG91061.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57667.1| hypothetical protein OsJ_08107 [Oryza sativa Japonica Group]
Length=679

 Score =   291 bits (744),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 158/193 (82%), Gaps = 0/193 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF  LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  487  QGMSDFLAPILYVMEDESESFWCFAILMERLGANFNRDQNGMHAQLLALSKLVELLDPQL  546

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF++ DCLNY FCFRW+LIQFKREF F++ + LWEVLWT + +EH HLY+CVAILKRY
Sbjct  547  HNYFRKNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYWSEHFHLYLCVAILKRY  606

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            RS+IIGE+MDFDTLL+FINEL G I+L+  ++DAEALC  AG  GAA IPPGTPPS+PI+
Sbjct  607  RSRIIGEQMDFDTLLKFINELSGEINLDRAIQDAEALCDQAGPNGAACIPPGTPPSMPIE  666

Query  228  NLLLFSQEDDDVM  190
                   ++D+VM
Sbjct  667  TDGGLYVQEDEVM  679



>ref|XP_001783529.1| predicted protein [Physcomitrella patens]
 gb|EDQ51665.1| predicted protein [Physcomitrella patens]
Length=485

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 131/185 (71%), Positives = 154/185 (83%), Gaps = 0/185 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+V+ +ESE+FWCF ALMER+ PNF  DQ GM  QL A+SKLV+LLD  L
Sbjct  297  QGMSDLLSPILHVVVEESEAFWCFAALMERMAPNFHRDQAGMQAQLSAVSKLVQLLDNPL  356

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H+YFKQ DCLNY FCFRWILI FKREF++   LRLWEVLW+ +L+EH HLY+CVAILKR+
Sbjct  357  HDYFKQNDCLNYFFCFRWILICFKREFDYNDVLRLWEVLWSHYLSEHFHLYMCVAILKRH  416

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R KI+ E+M+FDTLL+FINEL GHI+LE+TLRD EALCL AGE G A IPPGTPPSLP+ 
Sbjct  417  RRKIMDEQMEFDTLLKFINELSGHIELESTLRDTEALCLFAGEKGTACIPPGTPPSLPVV  476

Query  228  NLLLF  214
             +  F
Sbjct  477  EVDAF  481



>dbj|BAK05291.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=680

 Score =   283 bits (725),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/191 (69%), Positives = 155/191 (81%), Gaps = 1/191 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESE+FWCF +LMERLG NF  DQNGM+ QL  LSKLVELLD  L
Sbjct  488  QGMSDFLAPILYVMEDESEAFWCFASLMERLGGNFNRDQNGMHAQLLGLSKLVELLDPSL  547

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQ KREF F++ + LWEVLWT + +EH HLY+CV IL+RY
Sbjct  548  HNYFRQNDCLNYFFCFRWVLIQCKREFSFDQIMLLWEVLWTHYFSEHFHLYLCVGILRRY  607

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTPPS+PI+
Sbjct  608  RLRIIGEGMDFDTLLKFINELSGQINIDRAIQDAEALCTIAGERGADCIPPGTPPSMPIE  667

Query  228  -NLLLFSQEDD  199
             +  L+ QEDD
Sbjct  668  TDGGLYLQEDD  678



>ref|XP_002972350.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
 gb|EFJ26436.1| hypothetical protein SELMODRAFT_97576 [Selaginella moellendorffii]
Length=337

 Score =   266 bits (680),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VMRDE E+FW F +LMERLGPNF  DQNGM++QL ALSKLV+LLD  L
Sbjct  136  QGMSDLLSPILFVMRDEEEAFWSFASLMERLGPNFHRDQNGMHSQLLALSKLVQLLDPPL  195

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
              YF Q +CLNY FCFRWILIQFKREF ++  L LWEVLWT+H++EH HLY+CVA+LKR+
Sbjct  196  QEYFGQVECLNYFFCFRWILIQFKREFVYDDVLALWEVLWTRHMSEHFHLYICVALLKRH  255

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSL  238
            R KI+ E M FDTLL+FINEL GHI+L +TL  AE LC  AG+ GAA IPPGTPP+L
Sbjct  256  RRKIMDEHMVFDTLLKFINELSGHINLVSTLHGAETLCRLAGDAGAACIPPGTPPAL  312



>ref|XP_002971826.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
 gb|EFJ26743.1| hypothetical protein SELMODRAFT_96534 [Selaginella moellendorffii]
Length=351

 Score =   266 bits (681),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 146/177 (82%), Gaps = 0/177 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VMRDE E+FW F +LMERLGPNF  DQNGM++QL ALSKLV+LLD  L
Sbjct  150  QGMSDLLSPILFVMRDEEEAFWSFASLMERLGPNFHRDQNGMHSQLLALSKLVQLLDPPL  209

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
              YF Q +CLNY FCFRWILIQFKREF ++  L LWEVLWT+H++EH HLY+CVA+LKR+
Sbjct  210  QEYFGQVECLNYFFCFRWILIQFKREFVYDDVLALWEVLWTRHMSEHFHLYICVALLKRH  269

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSL  238
            R KI+ E M FDTLL+FINEL GHI+L +TL  AE LC  AG+ GAA IPPGTPP+L
Sbjct  270  RRKIMDEHMVFDTLLKFINELSGHINLVSTLHGAETLCRLAGDAGAACIPPGTPPAL  326



>ref|XP_010112474.1| TBC1 domain family member 15 [Morus notabilis]
 gb|EXC33718.1| TBC1 domain family member 15 [Morus notabilis]
Length=517

 Score =   264 bits (674),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 143/245 (58%), Positives = 165/245 (67%), Gaps = 55/245 (22%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALME-------------------------------  682
            QGMSDLLSPIL+VM DESESFWCFV+LME                               
Sbjct  271  QGMSDLLSPILFVMGDESESFWCFVSLMERLGPNFNRDQNGMHTQLFAISKFSGNISLAY  330

Query  681  --------------------RLGPNFQ-LDQNGMNTQLFALS--KLVELLDGLLHNYFKQ  571
                                RL  N Q +D++  N++       +LVELLD  LH+YFKQ
Sbjct  331  GGSLGSEERKLYKRGKRREKRLSGNKQKVDKSWNNSKQGRKQTLELVELLDSPLHSYFKQ  390

Query  570  KDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIG  391
             DCLNY FCFRW+LIQFKREFE+EKT+RLWEVLWT +L+EHLHLY+CVAILKR R+KII 
Sbjct  391  HDCLNYFFCFRWVLIQFKREFEYEKTMRLWEVLWTHYLSEHLHLYLCVAILKRQRNKIIS  450

Query  390  EKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPI-QNLLLF  214
            E+MDFDTLL+FINEL GHIDL++ LRDAEALC+CAGE GAA IPPGTPPSLPI  N LL+
Sbjct  451  EQMDFDTLLKFINELSGHIDLDSVLRDAEALCICAGENGAACIPPGTPPSLPIADNGLLY  510

Query  213  SQEDD  199
             QEDD
Sbjct  511  PQEDD  515



>gb|EMT03185.1| TBC1 domain family member 15 [Aegilops tauschii]
Length=591

 Score =   253 bits (647),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 142/191 (74%), Gaps = 18/191 (9%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESE+FWCF +LMERLG NF  DQNGM+ QL  LSKLVELLD  L
Sbjct  416  QGMSDFLAPILYVMEDESEAFWCFASLMERLGGNFNRDQNGMHAQLLGLSKLVELLDPSL  475

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQFKR F                  EH HLY+CV ILKRY
Sbjct  476  HNYFRQNDCLNYFFCFRWVLIQFKRFF-----------------AEHFHLYLCVGILKRY  518

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTPPS+PI+
Sbjct  519  RLRIIGEGMDFDTLLKFINELSGQINIDRAIQDAEALCTIAGEAGADCIPPGTPPSMPIE  578

Query  228  -NLLLFSQEDD  199
             +  L+ QEDD
Sbjct  579  TDGGLYLQEDD  589



>gb|EEC73873.1| hypothetical protein OsI_08649 [Oryza sativa Indica Group]
Length=682

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 129/152 (85%), Gaps = 0/152 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESESFWCF  LMERLG NF  DQNGM+ QL ALSKLVELLD  L
Sbjct  485  QGMSDFLAPILYVMEDESESFWCFAILMERLGANFNRDQNGMHAQLLALSKLVELLDPQL  544

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF++ DCLNY FCFRW+LIQFKREF F++ + LWEVLWT + +EH HLY+CVAILKRY
Sbjct  545  HNYFRKNDCLNYFFCFRWVLIQFKREFSFDQIMLLWEVLWTHYWSEHFHLYLCVAILKRY  604

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLR  313
            RS+IIGE+MDFDTLL+FINEL G I+L+  ++
Sbjct  605  RSRIIGEQMDFDTLLKFINELSGEINLDRAIQ  636



>ref|XP_009789609.1| PREDICTED: TBC1 domain family member 17-like isoform X2 [Nicotiana 
sylvestris]
Length=626

 Score =   235 bits (600),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  618  KLVELLDGLLHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHL  439
            +LVELLD  LH+YFKQKDCLNY FCFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHL
Sbjct  483  QLVELLDNPLHDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHL  542

Query  438  YVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  259
            YVCVAIL+RYRSKIIGE+MDFDTLL+FINEL GHIDL+ TLR+AEAL +CAGE G A IP
Sbjct  543  YVCVAILRRYRSKIIGEEMDFDTLLKFINELSGHIDLDATLREAEALFICAGENGEACIP  602

Query  258  PGTPPSLPIQNL-LLFSQEDDDVM  190
            PGTPPS P +   + + Q+DDDV+
Sbjct  603  PGTPPSFPFEGTSMCYQQDDDDVL  626



>ref|XP_009593350.1| PREDICTED: TBC1 domain family member 17 isoform X2 [Nicotiana 
tomentosiformis]
Length=626

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/141 (75%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = -2

Query  618  KLVELLDGLLHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHL  439
            +LVELLD  LH+YFKQKDCLNY FCFRW+LIQFKREF+ EKT+RLWEVLWT +L+EHLHL
Sbjct  483  QLVELLDNPLHDYFKQKDCLNYFFCFRWVLIQFKREFDLEKTMRLWEVLWTHYLSEHLHL  542

Query  438  YVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  259
            YVCVAIL+RYRSKIIGE+MDFDTLL+FINEL G IDL+ TLR+AEAL +CAGE G A IP
Sbjct  543  YVCVAILRRYRSKIIGEEMDFDTLLKFINELSGQIDLDATLREAEALFICAGENGEACIP  602

Query  258  PGTPPSLPIQNLLLFSQEDDD  196
            PGTPPS P +   ++ Q+DDD
Sbjct  603  PGTPPSFPFEGTSMYYQQDDD  623



>gb|EMS58117.1| TBC1 domain family member 15 [Triticum urartu]
Length=583

 Score =   219 bits (559),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 127/192 (66%), Gaps = 36/192 (19%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD L+PILYVM DESE+FWCF +LMERLG NF  DQNGM+ QL  LSKLVELLD  L
Sbjct  383  QGMSDFLAPILYVMEDESEAFWCFASLMERLGGNFNRDQNGMHAQLLGLSKLVELLDPSL  442

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            HNYF+Q DCLNY FCFRW+LIQF                                  KRY
Sbjct  443  HNYFRQNDCLNYFFCFRWVLIQF----------------------------------KRY  468

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            R +IIGE MDFDTLL+FINEL G I+++  ++DAEALC  AGE GA  IPPGTPPS+PI+
Sbjct  469  RLRIIGEGMDFDTLLKFINELSGQINIDRAIQDAEALCSIAGEAGADCIPPGTPPSMPIE  528

Query  228  N--LLLFSQEDD  199
                LL S E D
Sbjct  529  TDGGLLQSPESD  540



>emb|CBI28233.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   171 bits (434),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/108 (71%), Positives = 93/108 (86%), Gaps = 0/108 (0%)
 Frame = -2

Query  522  FKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELG  343
            + REFE+EKT+RLWE+LWT +L++HLHLYVCVAILK YR  I+GE+M FDTLL+FINEL 
Sbjct  43   YDREFEYEKTMRLWEMLWTHYLSKHLHLYVCVAILKGYRDNIMGEQMSFDTLLKFINELR  102

Query  342  GHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQEDD  199
            G IDL+  LRDA+ALC+CAGE GAA IPPGTPPSLPI + LL+ Q+DD
Sbjct  103  GQIDLDAILRDAQALCICAGENGAASIPPGTPPSLPIDSGLLYPQQDD  150



>ref|XP_001692974.1| RabGAP/TBC protein [Chlamydomonas reinhardtii]
 gb|EDP03543.1| RabGAP/TBC protein [Chlamydomonas reinhardtii]
Length=302

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 106/165 (64%), Gaps = 0/165 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDL SP+L VMRDE+E+FW   ALMER GP F  D  GM+ QL AL +LV+LLD  L
Sbjct  130  QGMSDLASPLLVVMRDEAEAFWALAALMERHGPCFAADLAGMSGQLAALRQLVQLLDPPL  189

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H   + +DCL+Y F FRW+LI FKREF+F+  L LWE  W    T HLHLY+  A+L  +
Sbjct  190  HAALEARDCLSYYFAFRWLLIHFKREFKFDDVLSLWESCWACRRTRHLHLYLAAAVLIHH  249

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYG  274
            R  I+   +DFD +L F   L G +DL   L  AEAL    GE G
Sbjct  250  RRLILASDLDFDGMLRFCIGLEGKMDLRPLLDIAEALVGYGGEAG  294



>ref|XP_005649420.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
 gb|EIE24876.1| RabGAP/TBC [Coccomyxa subellipsoidea C-169]
Length=656

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 113/165 (68%), Gaps = 1/165 (1%)
 Frame = -2

Query  765  GMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLH  586
            GMSD+++PILYVM DE+E+FWCF  LME+L  NF  D  GM +QL ALS L+ +LD  L 
Sbjct  482  GMSDMVAPILYVMHDEAEAFWCFACLMEKLEANFHTDCRGMQSQLVALSSLMSILDPQLT  541

Query  585  NYFKQKDCLNYLFCFRWILIQFKREF-EFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            ++ + K+  NY FC+RW+LI FKREF  +E+ LRLWE LW++H++ H H+++C  +L  +
Sbjct  542  SFLESKEATNYYFCYRWLLILFKREFSSYEEVLRLWEALWSRHISPHFHIFMCAGVLGLH  601

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYG  274
            R  I+   +DFD +L +  +L G +DL   LR AE L L AG  G
Sbjct  602  RRAIMDADLDFDGILRYCIQLSGKLDLHQVLRCAEKLALLAGTAG  646



>gb|ABK92630.1| unknown [Populus trichocarpa]
Length=102

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 76/100 (76%), Positives = 88/100 (88%), Gaps = 2/100 (2%)
 Frame = -2

Query  492  LRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLR  313
            +RLWEVLWT +L+EHLHLYVCVAILKRYR KI+GE MDFDTLL+FINEL GHIDL+  LR
Sbjct  1    MRLWEVLWTHYLSEHLHLYVCVAILKRYRKKIMGEHMDFDTLLKFINELSGHIDLDAILR  60

Query  312  DAEALCLCAGEYGAARIPPGTPPSLPI--QNLLLFSQEDD  199
            DAEALC+CAGE GAA IPPGTPPSLP   +N LL++Q+D+
Sbjct  61   DAEALCICAGENGAAHIPPGTPPSLPTENENALLYAQDDE  100



>emb|CEG81743.1| hypothetical protein RMATCC62417_15905 [Rhizopus microsporus]
Length=794

 Score =   174 bits (442),  Expect = 3e-46, Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +L
Sbjct  583  QGMSDLLAPLFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVL  642

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H  F++ D  N  FCFRW+L+ FKREF++E  +RLWE LWT HLT+ + L++ +A++  +
Sbjct  643  HKRFEEIDISNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLTKKMILFIALAVIDTH  702

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R KI+ E   FD +L +IN+L G+IDL  TL  AE L
Sbjct  703  REKILNELSQFDEVLRYINDLTGNIDLNRTLERAEVL  739



>ref|XP_002609518.1| hypothetical protein BRAFLDRAFT_95612 [Branchiostoma floridae]
 gb|EEN65528.1| hypothetical protein BRAFLDRAFT_95612 [Branchiostoma floridae]
Length=445

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/190 (45%), Positives = 118/190 (62%), Gaps = 8/190 (4%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL VM +E ++FWC V  M+R+  NF+ DQ GM TQL  L  LV  LD  +
Sbjct  229  QGMSDLLSPILMVMENEVDAFWCLVGFMDRVHHNFETDQQGMKTQLIQLQTLVHFLDPQM  288

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + Y + K+  N  FCFRW+LIQFKREF F   +RLWEV WT +L ++ HL +C+AIL   
Sbjct  289  YTYLESKESANMYFCFRWLLIQFKREFSFPDIMRLWEVHWTDYLCQNFHLLLCMAILDTE  348

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTPPSLPIQ  229
            +S ++   + F+ +L+ IN+L  HID+E  ++ AE + +   E     IP       PI+
Sbjct  349  KSAMMDNYLGFNEILKHINDLSLHIDVEDIMKKAEGIYIQIAE--CRDIPK------PIR  400

Query  228  NLLLFSQEDD  199
            ++L    E D
Sbjct  401  DILAIKSERD  410



>emb|CEG74578.1| hypothetical protein RMATCC62417_09764 [Rhizopus microsporus]
Length=776

 Score =   172 bits (435),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +L
Sbjct  565  QGMSDLLAPLFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVL  624

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H  F++ D  N  FCFRW+L+ FKREF++E  +RLWE LWT HL + + L++ +A++  +
Sbjct  625  HKRFEEIDISNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLAKKMILFIALAVIDTH  684

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R KI+ E   FD +L +IN+L G+IDL  TL  AE L
Sbjct  685  REKILNELNQFDEVLRYINDLTGNIDLNHTLERAEVL  721



>emb|CEG74577.1| hypothetical protein RMATCC62417_09764 [Rhizopus microsporus]
Length=794

 Score =   172 bits (435),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +L
Sbjct  583  QGMSDLLAPLFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVL  642

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H  F++ D  N  FCFRW+L+ FKREF++E  +RLWE LWT HL + + L++ +A++  +
Sbjct  643  HKRFEEIDISNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLAKKMILFIALAVIDTH  702

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R KI+ E   FD +L +IN+L G+IDL  TL  AE L
Sbjct  703  REKILNELNQFDEVLRYINDLTGNIDLNHTLERAEVL  739



>emb|CEI91235.1| hypothetical protein RMCBS344292_05533 [Rhizopus microsporus]
Length=838

 Score =   171 bits (434),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +L
Sbjct  627  QGMSDLLAPLFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVL  686

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H  F++ D  N  FCFRW+L+ FKREF++E  +RLWE LWT HL + + L++ +A++  +
Sbjct  687  HKRFEEIDISNLFFCFRWLLVWFKREFDWEDIIRLWENLWTDHLAKKMILFIALAVIDTH  746

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R KI+ E   FD +L +IN+L G+IDL  TL  AE L
Sbjct  747  REKILNELNQFDEVLRYINDLTGNIDLNHTLERAEVL  783



>gb|KIM49181.1| hypothetical protein M413DRAFT_438347 [Hebeloma cylindrosporum 
h7]
Length=843

 Score =   170 bits (431),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE+ +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  626  QGMSDLCAPIYLVMSGDENLTFWCFVEVMNRMKQNFLRDQSGMKKQLSTLQQLIEVMDPE  685

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L  + ++ D LN  FCFRW+LI FKREF FE  LRLWEVLWT + T    L+V +A+L+ 
Sbjct  686  LFRHLEKTDALNLFFCFRWVLIAFKREFPFEDVLRLWEVLWTDYYTSEFVLFVALAVLES  745

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  746  HRDMILRYLVEFDEILKYCNELSMTIELDTTLNQAEVLFL  785



>emb|CEI91236.1| hypothetical protein RMCBS344292_05534 [Rhizopus microsporus]
Length=414

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +L
Sbjct  203  QGMSDLLAPLFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVL  262

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H  F++ D  N  FCFRW+L+ FKREF++E  ++LWE LWT HLT+ + L++ +A++  +
Sbjct  263  HKRFEEIDISNLFFCFRWLLVWFKREFDWEDIIKLWENLWTDHLTKKMILFIALAVIDTH  322

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R KI+ E   FD +L +IN+L G+IDL  TL  AE L
Sbjct  323  REKILNELNQFDEVLRYINDLTGNIDLNHTLERAEVL  359



>emb|CEI91237.1| hypothetical protein RMCBS344292_05534 [Rhizopus microsporus]
Length=432

 Score =   166 bits (419),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  +M DE+ SFW F   M+R+  NF +DQ+GM+ QL  L+ LV+ +D +L
Sbjct  221  QGMSDLLAPLFVIMNDEAMSFWAFTRFMDRVQSNFYMDQSGMHAQLKTLNLLVQFMDPVL  280

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H  F++ D  N  FCFRW+L+ FKREF++E  ++LWE LWT HLT+ + L++ +A++  +
Sbjct  281  HKRFEEIDISNLFFCFRWLLVWFKREFDWEDIIKLWENLWTDHLTKKMILFIALAVIDTH  340

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R KI+ E   FD +L +IN+L G+IDL  TL  AE L
Sbjct  341  REKILNELNQFDEVLRYINDLTGNIDLNHTLERAEVL  377



>ref|XP_007764671.1| GTPase-activating protein gyp7 [Coniophora puteana RWD-64-598 
SS2]
 gb|EIW85062.1| GTPase-activating protein gyp7 [Coniophora puteana RWD-64-598 
SS2]
Length=817

 Score =   169 bits (428),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 110/160 (69%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE  +FWCFV +M+R+  NF  DQ+GM  QL AL +L+ ++D  
Sbjct  600  QGMSDLCAPIFVVMGSDEELTFWCFVEVMKRMKQNFLRDQSGMKRQLSALQELIGMMDPE  659

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ +F+Q D LN  FCFRW+LI FKREF F+  LRLWEV WT + + +  L+V +AIL+ 
Sbjct  660  LYRHFEQADGLNLFFCFRWVLIAFKREFSFDDVLRLWEVFWTDYYSNNFVLFVALAILES  719

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  720  HRDMILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  759



>ref|XP_009542802.1| hypothetical protein HETIRDRAFT_471290 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW86015.1| hypothetical protein HETIRDRAFT_471290 [Heterobasidion irregulare 
TC 32-1]
Length=833

 Score =   169 bits (428),  Expect = 4e-44, Method: Composition-based stats.
 Identities = 80/160 (50%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI   M  DE  +FWCFVA+M R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  617  QGMSDLCAPIYVAMGSDEPSTFWCFVAVMNRMKQNFLRDQSGMKKQLSTLQQLIEVMDPE  676

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L  + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + T+   L+V +A+L+ 
Sbjct  677  LFRHLEKTDGLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYTKSFVLFVALAVLES  736

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  II   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  737  HREVIIRYLVEFDEILKYCNELSMTIELDTTLAQAEVLFL  776



>gb|EPS74110.1| hypothetical protein M569_00644 [Genlisea aurea]
Length=202

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 99/139 (71%), Gaps = 20/139 (14%)
 Frame = -2

Query  618  KLVELLDGLLHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHL  439
            +LVELLD  LH Y +                   R F+++ T+RLW+VLWT + +EHLHL
Sbjct  71   QLVELLDRQLHKYLES------------------RNFDYDSTMRLWKVLWTHYPSEHLHL  112

Query  438  YVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  259
            YVCVAILK++RSKII E+M FDTLL+FINEL G + ++  LRDAEALC+CAGE GAA IP
Sbjct  113  YVCVAILKKHRSKIIREEMSFDTLLKFINELSGQMKVDEILRDAEALCICAGENGAASIP  172

Query  258  PGTPPSLPIQN--LLLFSQ  208
            PGTPPSLPI +   LL+SQ
Sbjct  173  PGTPPSLPIDDDSSLLYSQ  191



>gb|EPT06212.1| hypothetical protein FOMPIDRAFT_1110507 [Fomitopsis pinicola 
FP-58527 SS1]
Length=816

 Score =   168 bits (426),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 110/160 (69%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  DE  +FWCFV +M+R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  598  QGMSDLCAPVYIVMEGDEELTFWCFVEIMDRMKQNFLRDQSGMRKQLSTLQQLISVMDPE  657

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ +F++ D LN  FCFRWILI FKREF FE  LRLWEVLWT + + +  L+V +A+L+ 
Sbjct  658  LYRHFEKTDALNLFFCFRWILIAFKREFPFEDVLRLWEVLWTDYYSNNFVLFVALAVLES  717

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  ++   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  718  HRDVVLRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  757



>ref|XP_006633652.1| PREDICTED: TBC1 domain family member 15-like [Lepisosteus oculatus]
Length=641

 Score =   167 bits (422),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 107/159 (67%), Gaps = 0/159 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM +E ++FWCFV+ ME++  NF+    GM TQL  LS L+ LLD   
Sbjct  408  QGMSDLLSPILYVMENEVDAFWCFVSFMEQMHQNFEEQMQGMKTQLIQLSTLLRLLDITF  467

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             NY + +D     FCFRW+LI FKREF F+  LRLWEV+WT    ++ HL VC AIL   
Sbjct  468  WNYLESQDSGYLYFCFRWLLICFKREFSFQDVLRLWEVMWTGLPCQNFHLLVCCAILDSE  527

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            + KI+ E   F+ +L+ INEL   +D+E  L+ AEA+CL
Sbjct  528  KQKIMDEHYGFNEILKHINELSMKLDVEEVLQKAEAICL  566



>gb|KIO13611.1| hypothetical protein M404DRAFT_993164 [Pisolithus tinctorius 
Marx 270]
Length=844

 Score =   168 bits (425),  Expect = 9e-44, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 110/160 (69%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESE-SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  E E +FWCFV +M R+G NF  DQ+GM  QL  L +L+ ++D  
Sbjct  623  QGMSDLCAPLYVVMDTEEELTFWCFVKVMNRMGENFLRDQSGMKKQLLTLQELISVMDPE  682

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ +F++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + + +  L+V +A+L+ 
Sbjct  683  LYRHFEKTDGLNLFFCFRWVLIAFKREFVFDDVLRLWEVLWTDYYSNNFVLFVALAVLES  742

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  743  HRDMILRYLVEFDEVLKYCNELSMTIELDSTLAQAEVLFL  782



>gb|KIM21739.1| hypothetical protein M408DRAFT_29311 [Serendipita vermifera MAFF 
305830]
Length=830

 Score =   167 bits (424),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  +M+ DE  +FWCF ALMER+  NF  DQ+GM  QL  L +LV ++D  
Sbjct  606  QGMSDLCAPIYVIMKGDEVMTFWCFAALMERMKKNFLRDQSGMKRQLATLQQLVAVMDPE  665

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ +F+  D LN  FCFRW+LI FKREF F+  L LWEVLWT H +    L+V +A+L+ 
Sbjct  666  LYKHFENTDSLNLFFCFRWVLIAFKREFPFDDVLSLWEVLWTDHYSNEFLLFVALAVLES  725

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   + FD +L++ N+L   I+L++TL  AE L L
Sbjct  726  HREPILRYLVGFDEVLKYCNQLSMTIELDSTLAQAEVLFL  765



>ref|XP_003848770.1| hypothetical protein MYCGRDRAFT_76044, partial [Zymoseptoria 
tritici IPO323]
 gb|EGP83746.1| hypothetical protein MYCGRDRAFT_76044 [Zymoseptoria tritici IPO323]
Length=852

 Score =   168 bits (425),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  + +D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+LLD  L
Sbjct  576  QGMSDLLAPIYAIQQDDAVAFWGFTKFMERMERNFLRDQSGMRLQLTTLDQLVQLLDPKL  635

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + +  + D  N+ F FR +L+ FKREFEFE  LRLWE LWT +L+ + HL+   AIL+++
Sbjct  636  YEHLAKVDSTNFFFFFRMLLVWFKREFEFEDILRLWEGLWTDYLSANFHLFFAAAILEKH  695

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+G    FD +L+++NEL G IDL++T+  AEAL
Sbjct  696  RDVIMGHLKGFDEVLKYVNELSGRIDLQSTVVRAEAL  732



>gb|KIM62089.1| hypothetical protein SCLCIDRAFT_1178195 [Scleroderma citrinum 
Foug A]
Length=840

 Score =   167 bits (424),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESE-SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  E E +FWCFV +M R+G NF  DQ+GM  QL  L +L+ +LD  
Sbjct  621  QGMSDLCAPLYVVMGTEEELTFWCFVEVMHRMGQNFLRDQSGMKKQLLTLQELISVLDPE  680

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF F+  LRLWEV WT + + +  L+V +A+L+ 
Sbjct  681  LYRHLEKTDGLNLFFCFRWVLIAFKREFAFDDVLRLWEVFWTDYYSNNFVLFVALAVLES  740

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  II   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  741  HRDMIIRYLLEFDEILKYCNELSMTIELDSTLAQAEVLFL  780



>gb|EMD38374.1| hypothetical protein CERSUDRAFT_113536 [Ceriporiopsis subvermispora 
B]
Length=814

 Score =   167 bits (423),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 79/167 (47%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  594  QGMSDLCAPIYVVMDADEELTFWCFVEVMNRMKQNFSRDQSGMKKQLSTLQQLISVMDPE  653

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRWILI FKREF FE  LRLWE+LWT + T    L+V +A+L+ 
Sbjct  654  LYRHLEKSDGLNLFFCFRWILIAFKREFPFEDVLRLWEILWTNYYTNSFVLFVALAVLES  713

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGA  271
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L   ++ A
Sbjct  714  HRDVILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFLSFAQFVA  760



>gb|KDQ60762.1| hypothetical protein JAAARDRAFT_204574 [Jaapia argillacea MUCL 
33604]
Length=849

 Score =   167 bits (424),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESES-FWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  E ES FWCFV +M R+  NF  DQ+GM  QL  L +L+ L+D  
Sbjct  623  QGMSDLCAPVYVVMGAEEESTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLIGLMDPE  682

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ 
Sbjct  683  LYRHLEKTDGLNLFFCFRWVLIAFKREFAFDDVLRLWEVLWTDYYTNEFVLFVALAVLES  742

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  743  HRDVILRYLVEFDEILKYCNELSMTIELDTTLAQAEVLFL  782



>gb|KFH67583.1| hypothetical protein MVEG_06315 [Mortierella verticillata NRRL 
6337]
Length=856

 Score =   167 bits (424),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  VM DE   FW FV LME+   NF  DQ GM +QL  L KL++ LD  L
Sbjct  649  QGMSDLLAPVFAVMGDEVMGFWAFVGLMEKTKKNFYRDQVGMQSQLETLGKLIQTLDPKL  708

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + ++ + LN  FCFRW LI FKREFE+   +RLWEVL++ HL+   HL+V +AIL ++
Sbjct  709  YKHLEKCEALNLFFCFRWFLIWFKREFEWVDIMRLWEVLFSDHLSTQFHLFVAMAILDKH  768

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  ++     FD +L+++N+L   I+LE TL+DAE L
Sbjct  769  RDVMMDHLQGFDEILKYVNDLSMTINLEETLQDAEIL  805



>gb|KII88599.1| hypothetical protein PLICRDRAFT_41787 [Plicaturopsis crispa FD-325 
SS-3]
Length=831

 Score =   167 bits (423),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  610  QGMSDLCAPVYVVMGSDEELTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLIEVMDPE  669

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  670  LYRHLEKTDGLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSNDFVLFVALAVLES  729

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  730  HRDMILRYLVEFDEILKYCNELSMTIELDTTLAQAEVLFL  769



>ref|XP_007805043.1| hypothetical protein EPUS_03989 [Endocarpon pusillum Z07020]
 gb|ERF69285.1| hypothetical protein EPUS_03989 [Endocarpon pusillum Z07020]
Length=1267

 Score =   169 bits (427),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 78/157 (50%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768   QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
             QGMSDLL+PI  VM+D++ +FW FV  M R+  NF  DQ+GM TQL  L +LV+LLD  L
Sbjct  993   QGMSDLLAPIYAVMQDDAIAFWAFVGFMRRMSRNFVRDQSGMRTQLTTLDQLVQLLDPKL  1052

Query  588   HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             + + +  D  N+ F FR +L+ +KREFE+   LRLWE LWT +L+   HL++ VAIL+++
Sbjct  1053  YLHLQSADSTNFFFFFRMLLVWYKREFEWVDILRLWEGLWTDYLSSQFHLFIAVAILEKH  1112

Query  408   RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
             R  I+G    FD +L+++NEL G IDL +TL  AE L
Sbjct  1113  RDVIMGHLKHFDEVLKYVNELSGTIDLPSTLVRAEGL  1149



>ref|XP_010656460.1| PREDICTED: GTPase-activating protein GYP7-like [Vitis vinifera]
Length=100

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  492  LRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLR  313
            +RLWE+LWT +L++HLHLYVCVAILK YR  I+GE+M FDTLL+FINEL G IDL+  LR
Sbjct  1    MRLWEMLWTHYLSKHLHLYVCVAILKGYRDNIMGEQMSFDTLLKFINELRGQIDLDAILR  60

Query  312  DAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQEDD  199
            DA+ALC+CAGE GAA IPPGTPPSLPI + LL+ Q+DD
Sbjct  61   DAQALCICAGENGAASIPPGTPPSLPIDSGLLYPQQDD  98



>emb|CCA66945.1| probable GTPase activating protein [Piriformospora indica DSM 
11827]
Length=792

 Score =   166 bits (421),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM+ DE  +FWCF ALM+R+  NF  DQ+GM  QL  L +LV ++D  
Sbjct  573  QGMSDLCAPIYVVMKGDEVMTFWCFAALMDRMKQNFLRDQSGMKRQLATLQQLVAVMDPE  632

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ +F++ D LN  FCFRW+LI FKREF F+  L LWEVLWT H +    L+V +A+L+ 
Sbjct  633  LYKHFEKCDSLNLFFCFRWVLIAFKREFPFDDVLGLWEVLWTNHYSSQFLLFVALAVLES  692

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ N L   I+L++TL  AE L L
Sbjct  693  HRDSILRYLVEFDEILKYCNHLSMTIELDSTLAQAEVLFL  732



>gb|EWC44833.1| hypothetical protein DRE_06471 [Drechslerella stenobrocha 248]
Length=804

 Score =   166 bits (421),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V +D++ +FW FV  MER+  NF  DQ+GM  QL AL++LV L+D LL
Sbjct  553  QGMSDLLAPIYAVFQDDAMAFWAFVGFMERMERNFLRDQSGMRAQLVALNQLVMLMDPLL  612

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
              +  + +  N+ F FR IL+ +KREF++   LRLWE LWT +L+   HL++ +AIL+R+
Sbjct  613  WKHLDKAESTNFFFFFRMILVWYKREFDWSDVLRLWEALWTNYLSGQFHLFIALAILERH  672

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ I+     FD +L++INEL G I+L +TL  AEAL
Sbjct  673  RTVIMDHLEHFDEVLKYINELSGTIELNSTLVRAEAL  709



>ref|XP_007385727.1| RabGAP/TBC [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN07434.1| RabGAP/TBC [Punctularia strigosozonata HHB-11173 SS5]
Length=853

 Score =   167 bits (422),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  630  QGMSDLCAPIYIVMGTDEELTFWCFVEVMNRMKRNFLRDQSGMKQQLSTLQQLIAVMDPE  689

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRWILI FKREF FE  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  690  LYRHLEKTDALNLFFCFRWILITFKREFPFEDVLRLWEVLWTDYYSNEFVLFVALAVLES  749

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+LE+TL  AE L L
Sbjct  750  HRDVILRYLVEFDEILKYCNELSMTIELESTLAQAEVLFL  789



>emb|CAN75817.1| hypothetical protein VITISV_033040 [Vitis vinifera]
Length=100

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 70/98 (71%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  492  LRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFINELGGHIDLETTLR  313
            +RLWE LWT +L++HLHLYVCVAILK YR  I+GE+M FDTLL+FINEL G IDL+  LR
Sbjct  1    MRLWEXLWTHYLSKHLHLYVCVAILKGYRDNIMGEQMSFDTLLKFINELRGQIDLDAILR  60

Query  312  DAEALCLCAGEYGAARIPPGTPPSLPIQNLLLFSQEDD  199
            DA+ALC+CAGE GAA IPPGTPPSLPI + LL+ Q+DD
Sbjct  61   DAQALCICAGENGAASIPPGTPPSLPIDSGLLYPQQDD  98



>gb|KDR81554.1| hypothetical protein GALMADRAFT_221417 [Galerina marginata CBS 
339.88]
Length=825

 Score =   166 bits (420),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  +E  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  607  QGMSDLCAPLYVVMAGNEEMTFWCFVEVMNRMKQNFMRDQSGMKKQLSTLQQLIEVMDPE  666

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L  + ++ D LN  FCFRW+LI FKREF FE  L+LWEVLWT++ T    L+V +A+L+ 
Sbjct  667  LFRHLEKTDALNLFFCFRWVLISFKREFPFEDVLQLWEVLWTEYYTSGFVLFVALAVLES  726

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  727  HRDMILRYLVEFDEILKYCNELSMTIELDTTLSQAEVLFL  766



>gb|EPB92968.1| hypothetical protein HMPREF1544_00042 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=830

 Score =   166 bits (420),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+   M DE+ +FW F A M+R+  NF +DQ+GM+ QL  L  L+  +D  L
Sbjct  599  QGMSDLLAPLFVAMGDEAMAFWAFTAFMDRVQSNFFMDQSGMHGQLKTLDSLIHFMDPEL  658

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +   +  +  N  FCFRW+L+ FKREFE+E  +RLWEVLWT HL++ + L++ +A++  +
Sbjct  659  YKRLEDTETSNLFFCFRWLLVWFKREFEWEDVIRLWEVLWTDHLSDKMILFIALAVIDAH  718

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+ E   FD +L++IN+L G+I LE TL  AE L
Sbjct  719  RKTILEELNQFDEILKYINDLTGNIPLEPTLERAEVL  755



>gb|KIP09589.1| hypothetical protein PHLGIDRAFT_67361 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=815

 Score =   166 bits (419),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  V   DE  SFWCFVA+M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  600  QGMSDLCAPVYIVTDADEELSFWCFVAIMARMKQNFLRDQSGMKRQLSTLQQLIHVMDPD  659

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRWILI FKREF FE  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  660  LYRHLEKADALNLFFCFRWILIAFKREFPFEDVLRLWEVLWTDYYSNSFVLFVALAVLES  719

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  720  HRDVIMRYLVEFDEILKYCNELSMTIELDTTLAQAEVLFL  759



>ref|XP_002950778.1| hypothetical protein VOLCADRAFT_60703 [Volvox carteri f. nagariensis]
 gb|EFJ48093.1| hypothetical protein VOLCADRAFT_60703 [Volvox carteri f. nagariensis]
Length=321

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 114/174 (66%), Gaps = 1/174 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDL +P+L VMRDE+E+FW F ALMERLG NF  D  GM  QL AL +LV+L+D  L
Sbjct  149  QGMSDLAAPLLVVMRDEAEAFWAFAALMERLGCNFHTDLQGMTLQLGALRQLVQLVDPPL  208

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H Y +++DCL+Y F FRW+LI FKREF+F++ L LWE  W    T HLHLY+  A+L  +
Sbjct  209  HAYLERRDCLSYYFAFRWLLILFKREFKFDEVLSLWEACWACRRTRHLHLYLAAAVLVHH  268

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIPPGTP  247
            R  I+   +DFD LL     L G ++L+  L  AEAL   AGE G   +  G P
Sbjct  269  RRVILSSDLDFDGLLRLSIALAGRLELQPLLETAEALVGYAGEAG-REVTAGLP  321



>emb|CCX13007.1| Similar to GTPase-activating protein GYP7; acc. no. P09379 [Pyronema 
omphalodes CBS 100304]
Length=798

 Score =   166 bits (419),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSD+L+PI  VM+D++ +FW FV  MER   NF  DQ+GM  QL AL  LV+L+D  L
Sbjct  548  QGMSDMLAPIYAVMQDDAVAFWAFVGFMERTERNFLRDQSGMRAQLVALDHLVQLMDPKL  607

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ FKREF+++  LRLWEVLWT  L+   HL++ +AIL R+
Sbjct  608  YAHLESADSTNFFFFFRMLLVWFKREFKWDDVLRLWEVLWTNFLSSQYHLFIALAILDRH  667

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ I+     FD +L+++NEL   IDL+ TL  AEAL
Sbjct  668  RTVIMDHLRQFDEVLKYVNELSNTIDLKLTLIRAEAL  704



>ref|XP_009063579.1| hypothetical protein LOTGIDRAFT_221303 [Lottia gigantea]
 gb|ESO85851.1| hypothetical protein LOTGIDRAFT_221303 [Lottia gigantea]
Length=649

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 110/170 (65%), Gaps = 0/170 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL +M +E ++FWCF  LMERL  NF++DQNGM  QL  + KL+++ D  L
Sbjct  406  QGMSDLLSPILVIMENEVDAFWCFAGLMERLCGNFEMDQNGMKVQLSQIHKLMQVYDPEL  465

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             +Y +  D  N+ FCFRWILI FKREF F++T RLWEV+WT    ++ HL + +AIL   
Sbjct  466  CHYLESHDSGNFYFCFRWILIMFKREFHFQETQRLWEVMWTDKPCKNFHLIITLAILDNE  525

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP  259
            +S +I  +  F  +L+ IN++   I LE TL+ AE + L    Y     P
Sbjct  526  KSTLIENQFGFTEILKHINDISLAIPLEDTLKKAEGIFLQLKNYKKLPKP  575



>dbj|GAN09723.1| GTPase activating protein (Gyp7) [Mucor ambiguus]
Length=828

 Score =   166 bits (419),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+   M DE+ +FW F A M+R+  NF +DQ+GM+ QL  L  L+  +D  L
Sbjct  597  QGMSDLLAPLFVAMGDEAMAFWAFTAFMDRVQSNFFMDQSGMHGQLKTLDSLIHFMDPEL  656

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +   +  +  N  FCFRW+L+ FKREFE+E  +RLWEVLWT HL++ + L++ +A++  +
Sbjct  657  YKRLEDTETSNLFFCFRWLLVWFKREFEWEDVIRLWEVLWTDHLSDKMILFIALAVIDAH  716

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+ E   FD +L++IN+L G+I LE TL  AE L
Sbjct  717  RKTILEELNQFDEILKYINDLTGNIPLEPTLERAEVL  753



>gb|KIO32502.1| hypothetical protein M407DRAFT_241400 [Tulasnella calospora MUT 
4182]
Length=784

 Score =   165 bits (418),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 80/161 (50%), Positives = 108/161 (67%), Gaps = 3/161 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVM--RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDG  595
            QGMSDLLSP LYV+   DE ESFWCFVA M+R   NF  DQ+GM  QL  L  L+ ++D 
Sbjct  564  QGMSDLLSP-LYVVCGGDEVESFWCFVAFMQRTKSNFLRDQSGMRKQLSTLQNLLSVMDP  622

Query  594  LLHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILK  415
             L+ +F++   LN  FC+RWILI FKREF FE  + LWE +WT + +   HL+V +AIL+
Sbjct  623  ELYRHFEKSGALNLFFCYRWILILFKREFPFENVVNLWECIWTDYYSTKFHLFVALAILE  682

Query  414  RYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
             +R  I+   ++FD +L++ N+L   IDL++TL  AE L L
Sbjct  683  SHRDVILRYLVEFDEVLKYCNDLSMTIDLDSTLAQAEVLFL  723



>ref|XP_007776922.1| hypothetical protein W97_00820 [Coniosporium apollinis CBS 100218]
 gb|EON61605.1| hypothetical protein W97_00820 [Coniosporium apollinis CBS 100218]
Length=825

 Score =   166 bits (419),  Expect = 6e-43, Method: Composition-based stats.
 Identities = 78/157 (50%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  MER+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  567  QGMSDLLAPIYAVMQDDAVAFWAFVNFMERMERNFLRDQSGMRLQLLTLDHLVQLMDPKL  626

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ FKREFE+   LRLWE LWT  L+ + HL++ +AIL+++
Sbjct  627  YLHLQSADSTNFFFFFRMLLVWFKREFEWLDVLRLWEGLWTDWLSSNFHLFIALAILEKH  686

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G IDL+TTL  AEAL
Sbjct  687  RDVIMEHLQRFDEVLKYVNELSGTIDLQTTLVRAEAL  723



>ref|XP_011448760.1| PREDICTED: TBC1 domain family member 15-like isoform X1 [Crassostrea 
gigas]
Length=653

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSP+L VM +E ++FWCF  LMER+  NF++DQ GM TQL  + KL++ +D  L
Sbjct  413  QGMSDLLSPVLVVMENEVDAFWCFAGLMERVCDNFEMDQAGMKTQLSQIHKLMQFVDPEL  472

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             +Y +  D  N+ FCFRW+LI FKREF F   +R WEVLWT    ++ HL +C+A+L   
Sbjct  473  CSYLESHDSGNFYFCFRWLLILFKREFSFNDVMRFWEVLWTDRPCKNFHLLICLAVLDTE  532

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            +S ++  K  F  +L+ IN++ G I LE TL+ AE +
Sbjct  533  KSTLMENKFGFTEILKHINDMSGAIHLEDTLKKAEGI  569



>gb|EKG21073.1| hypothetical protein MPH_01617 [Macrophomina phaseolina MS6]
Length=857

 Score =   166 bits (419),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  MER+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  572  QGMSDLLAPIYAVMQDDAVAFWGFVGFMERMERNFLRDQSGMRKQLLTLDHLVQLIDPKL  631

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ +KREFE++  LRLWE LWT +L+ + HL++ +AIL+R+
Sbjct  632  YLHLQSADSTNFFFFFRMLLVWYKREFEWQDVLRLWEGLWTDYLSGNFHLFIALAILERH  691

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G IDL++TL  AE L
Sbjct  692  RDVIMEHLKAFDEVLKYVNELSGTIDLQSTLVRAEGL  728



>ref|XP_011111334.1| hypothetical protein H072_5454 [Dactylellina haptotyla CBS 200.50]
 gb|EPS40684.1| hypothetical protein H072_5454 [Dactylellina haptotyla CBS 200.50]
Length=805

 Score =   165 bits (418),  Expect = 7e-43, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V +D++ +FW FV  MER+  NF  DQ+GM  QL  L +LV+L+D +L
Sbjct  555  QGMSDLLAPIYAVFQDDAVAFWAFVGFMERMERNFLRDQSGMRAQLVTLDQLVQLMDPVL  614

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
              + ++ +  N+ F FR IL+ +KREFE++  LRLWE LWT +L+   HL+V +A+L+R+
Sbjct  615  WKHLEKAESTNFFFFFRMILVWYKREFEWDDVLRLWEGLWTNYLSGQFHLFVALAVLERH  674

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ I+     FD +L++INEL G I+L +TL  AEAL
Sbjct  675  RAVIMDHLQHFDEVLKYINELSGTIELNSTLIRAEAL  711



>ref|XP_011448761.1| PREDICTED: TBC1 domain family member 15-like isoform X2 [Crassostrea 
gigas]
 gb|EKC19529.1| TBC1 domain family member 15 [Crassostrea gigas]
Length=649

 Score =   164 bits (415),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSP+L VM +E ++FWCF  LMER+  NF++DQ GM TQL  + KL++ +D  L
Sbjct  409  QGMSDLLSPVLVVMENEVDAFWCFAGLMERVCDNFEMDQAGMKTQLSQIHKLMQFVDPEL  468

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             +Y +  D  N+ FCFRW+LI FKREF F   +R WEVLWT    ++ HL +C+A+L   
Sbjct  469  CSYLESHDSGNFYFCFRWLLILFKREFSFNDVMRFWEVLWTDRPCKNFHLLICLAVLDTE  528

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            +S ++  K  F  +L+ IN++ G I LE TL+ AE +
Sbjct  529  KSTLMENKFGFTEILKHINDMSGAIHLEDTLKKAEGI  565



>gb|EPS72188.1| hypothetical protein M569_02568, partial [Genlisea aurea]
Length=112

 Score =   153 bits (386),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = -2

Query  690  LMERLGPNFQLDQNGMNTQLFALSKLVELLDGLLHNYFKQKDCLNYLFCFRWILIQFKRE  511
            LMERLGPNF  DQ+GM++Q FALSKLVELLD  LH Y + +DCLNY FCFRWILIQFKRE
Sbjct  1    LMERLGPNFNRDQSGMHSQFFALSKLVELLDRQLHKYLEARDCLNYFFCFRWILIQFKRE  60

Query  510  FEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRYRSKIIGEKMDFDTLLEFI  355
            F+++  +RL   ++      HLH YVCVAILK++RSKII E+M FDTLL+FI
Sbjct  61   FDYDSMMRLSGDVYVCVQKCHLHFYVCVAILKKHRSKIIKEEMSFDTLLKFI  112



>ref|XP_007300987.1| RabGAP/TBC [Stereum hirsutum FP-91666 SS1]
 gb|EIM89902.1| RabGAP/TBC [Stereum hirsutum FP-91666 SS1]
Length=828

 Score =   165 bits (418),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 78/160 (49%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  603  QGMSDLCAPIYVVMGADEGLTFWCFVEVMNRMKKNFLRDQSGMKKQLSTLQQLIEMMDPE  662

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF FE  L LWEVLWT + T    L+V +A+L+ 
Sbjct  663  LYRHLEKTDGLNLFFCFRWVLISFKREFPFEDVLSLWEVLWTDYYTADFVLFVALAVLES  722

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  723  HRDVILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  762



>gb|KIK30947.1| hypothetical protein PISMIDRAFT_86279 [Pisolithus microcarpus 
441]
Length=824

 Score =   165 bits (418),  Expect = 8e-43, Method: Composition-based stats.
 Identities = 77/167 (46%), Positives = 110/167 (66%), Gaps = 1/167 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESE-SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  E E +FWCFV +M R+G NF  DQ+GM  QL  L  L+ ++D  
Sbjct  603  QGMSDLCAPLYVVMDMEEELTFWCFVQVMNRVGQNFLRDQSGMKKQLLTLQDLISVMDPE  662

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ +F++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + + +  L+V +A+L+ 
Sbjct  663  LYRHFEKADGLNLFFCFRWVLIAFKREFAFDDVLRLWEVLWTDYYSNNFVLFVALAVLES  722

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGA  271
            +R  I+    +FD +L++ N+L   I+L++TL  AE L L   +  A
Sbjct  723  HRDPILRYLPEFDEILKYCNDLSMTIELDSTLAQAEVLFLSYAQLAA  769



>ref|XP_007361169.1| RabGAP/TBC [Dichomitus squalens LYAD-421 SS1]
 gb|EJF65907.1| RabGAP/TBC [Dichomitus squalens LYAD-421 SS1]
Length=818

 Score =   165 bits (418),  Expect = 9e-43, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  DE  +FWCFV +M+R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  598  QGMSDLCAPVYVVMGGDEEMTFWCFVQIMDRMKQNFLRDQSGMKKQLSTLQQLISVMDPE  657

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRWILI FKREF FE  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  658  LYRHLEKTDGLNLFFCFRWILISFKREFPFEDVLRLWEVLWTDYYSTQFVLFVALAVLES  717

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  718  HRDVILRYLVEFDEILKYCNELSMSIELDSTLAQAEVLFL  757



>ref|XP_008045239.1| RabGAP/TBC [Trametes versicolor FP-101664 SS1]
 gb|EIW51710.1| RabGAP/TBC [Trametes versicolor FP-101664 SS1]
Length=812

 Score =   165 bits (417),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  DE  +FWCFV +MER+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  597  QGMSDLCAPVYVVMGGDEEMTFWCFVEIMERMKHNFLRDQSGMKKQLSTLQQLISVMDPE  656

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRWILI FKREF F+  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  657  LYRHLEKTDGLNLFFCFRWILITFKREFPFDDVLRLWEVLWTDYYSTQFVLFVALAVLES  716

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  717  HRDVILRYLVEFDEILKYCNELSMSIELDSTLAQAEVLFL  756



>ref|XP_006458178.1| hypothetical protein AGABI2DRAFT_183265 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV50132.1| hypothetical protein AGABI2DRAFT_183265 [Agaricus bisporus var. 
bisporus H97]
Length=1244

 Score =   167 bits (422),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 1/160 (1%)
 Frame = -2

Query  768   QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
             QGMSDL +PI  VM  DE  +FWCFV  MER+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  1027  QGMSDLCAPIYVVMDADEEMTFWCFVYFMERMKKNFLRDQSGMKQQLSTLQQLIEVMDPE  1086

Query  591   LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
             L  +  + D LN  FCFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  1087  LFRHLDKTDGLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSTQFVLFVALAVLES  1146

Query  411   YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
             +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  1147  HRDVILRYLVEFDEILKYCNELSMTIELDTTLAQAEVLFL  1186



>ref|XP_007862850.1| RabGAP/TBC, partial [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58177.1| RabGAP/TBC, partial [Gloeophyllum trabeum ATCC 11539]
Length=897

 Score =   166 bits (419),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  677  QGMSDLCAPIYVVMDGDEEMTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQELIAMMDPE  736

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + + +  L+V +AIL+ 
Sbjct  737  LYRHLEKTDGLNLFFCFRWVLITFKREFPFDDVLRLWEVLWTDYYSNNFVLFVALAILES  796

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  797  HRDVILRYLIEFDEILKYCNELSMTIELDSTLAQAEVLFL  836



>ref|XP_007326252.1| hypothetical protein AGABI1DRAFT_68626 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM82732.1| hypothetical protein AGABI1DRAFT_68626 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=1282

 Score =   167 bits (422),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 1/160 (1%)
 Frame = -2

Query  768   QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
             QGMSDL +PI  VM  DE  +FWCFV  MER+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  1065  QGMSDLCAPIYVVMDADEEMTFWCFVYFMERMKKNFLRDQSGMKQQLSTLQQLIEVMDPE  1124

Query  591   LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
             L  +  + D LN  FCFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  1125  LFRHLDKTDGLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSTQFVLFVALAVLES  1184

Query  411   YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
             +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  1185  HRDVILRYLVEFDEILKYCNELSMTIELDTTLAQAEVLFL  1224



>ref|XP_007345802.1| RabGAP/TBC [Auricularia delicata TFB-10046 SS5]
 gb|EJD46165.1| RabGAP/TBC [Auricularia delicata TFB-10046 SS5]
Length=807

 Score =   165 bits (417),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 76/161 (47%), Positives = 110/161 (68%), Gaps = 3/161 (2%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR--DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDG  595
            QGMSDL +PI YV    DE+ +FWCFV +M R+ PNF  DQ+GM  QL  L +L+ ++D 
Sbjct  577  QGMSDLCAPI-YVATGADEALTFWCFVEVMNRMKPNFARDQSGMKKQLLTLQQLIAVMDP  635

Query  594  LLHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILK  415
             ++ + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + +    L+V +A+++
Sbjct  636  EIYRHLEKIDGLNLFFCFRWVLIAFKREFGFDDVLRLWEVLWTDYYSNQFVLFVALAVIE  695

Query  414  RYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
             +R  I+   ++FD +L++ NEL G I+L++TL  AE L L
Sbjct  696  SHRDVILRYLVEFDEILKYCNELSGTIELDSTLAQAEVLFL  736



>dbj|GAM83758.1| hypothetical protein ANO11243_017480 [fungal sp. No.11243]
Length=815

 Score =   164 bits (416),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  +M D++ +FW FV  MER+  NF  DQ+GM  QL  L  LV+LLD  L
Sbjct  565  QGMSDLLAPLYAIMLDDAIAFWAFVGFMERMERNFLRDQSGMRLQLMTLDHLVQLLDPKL  624

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ +KREFE+   LRLWE LWT +L+ + HL++ +AIL+++
Sbjct  625  YLHLQSVDSTNFFFFFRMLLVWYKREFEWNDVLRLWEGLWTDYLSSNFHLFIAMAILEKH  684

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ II     FD +L++INEL   IDLE+TL  AEAL
Sbjct  685  RNVIIDHLKGFDEVLKYINELSNTIDLESTLIRAEAL  721



>gb|KIK08687.1| hypothetical protein K443DRAFT_84333 [Laccaria amethystina LaAM-08-1]
Length=818

 Score =   164 bits (415),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 106/160 (66%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL SP+  VM  DE  +FWCFV  M+R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  601  QGMSDLCSPLYVVMGSDEELTFWCFVQFMDRMKQNFLRDQSGMKQQLSTLQQLIEIMDPE  660

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L  + ++ D LN  FCFRW+LI FKREF F   LRLWEVLWT + +    L+V +A+L+ 
Sbjct  661  LFRHLEKTDGLNLFFCFRWVLIAFKREFAFGDVLRLWEVLWTDYYSREFVLFVALAVLES  720

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  721  HRDMILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  760



>emb|CEG04196.1| unnamed protein product [Fusarium sp. FIESC_5 CS3069]
Length=826

 Score =   164 bits (415),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 74/157 (47%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+ +D +L
Sbjct  577  QGMSDLLAPIYAVIQDDAVAFWGFQKFMERMERNFLRDQSGMRNQLLTLDQLVQFMDPVL  636

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             N+ ++ D  N+ F FR +L+ +KREFE+   LRLWE LWT +++ + HL++ +AIL+R+
Sbjct  637  WNHLQKADSTNFFFFFRMLLVWYKREFEWLDVLRLWEGLWTDYMSANFHLFIALAILERH  696

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G IDLE TL  AE+L
Sbjct  697  RDVIMEHLQHFDEVLKYVNELSGTIDLEATLIRAESL  733



>gb|KJA20210.1| hypothetical protein HYPSUDRAFT_167151 [Hypholoma sublateritium 
FD-334 SS-4]
Length=846

 Score =   164 bits (416),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  +E  +FWCFV +M R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  627  QGMSDLCAPLYIVMAGNEEMTFWCFVEVMNRMKQNFLRDQSGMKRQLSTLQQLIEIMDPE  686

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L  + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ 
Sbjct  687  LFRHLEKTDALNLFFCFRWVLITFKREFPFDDVLRLWEVLWTDNYTSGFVLFVALAVLES  746

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L+TTL  AE L L
Sbjct  747  HRDMILRYLVEFDEILKYCNELSMTIELDTTLSQAEVLYL  786



>gb|EIE81059.1| hypothetical protein RO3G_05764 [Rhizopus delemar RA 99-880]
Length=724

 Score =   163 bits (412),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 110/157 (70%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+L VM DE  +FW F   M R+  NF +DQ+GM+ QL  L+ L+E +D +L
Sbjct  509  QGMSDLLAPLLVVMDDEPMAFWAFAHFMNRVQTNFYMDQSGMHAQLKTLNCLIEFMDPVL  568

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +  F++ +  +  FCFRW+L+ FKREFE++  L+LWEVLWT  LT+ + L++ +A++  +
Sbjct  569  YKRFQEIEITDLFFCFRWLLVWFKREFEWDDVLQLWEVLWTDWLTDKMVLFIVLAVIDTH  628

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R KI+ E   FD  L +IN+L GHIDL++TL  AE L
Sbjct  629  RDKIMNELNQFDETLRYINDLSGHIDLKSTLERAEVL  665



>ref|XP_011121238.1| hypothetical protein AOL_s00076g384 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX50033.1| hypothetical protein AOL_s00076g384 [Arthrobotrys oligospora 
ATCC 24927]
Length=808

 Score =   164 bits (414),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 75/157 (48%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V +D++ +FW FV  MER+  NF  DQ+GM  QL  L +LV L+D +L
Sbjct  555  QGMSDLLAPIYAVFQDDAVAFWAFVGFMERMERNFLRDQSGMRAQLVTLDQLVMLMDPVL  614

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
              + ++ +  N+ F FR IL+ +KREFE+   LRLWE +WT +L+   HL+V +A+L+R+
Sbjct  615  WKHLEKAESTNFFFFFRMILVWYKREFEWNDVLRLWESMWTNYLSGQFHLFVTLAVLERH  674

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ I+     FD +L++INEL G I+L +TL  AEAL
Sbjct  675  RAVIMDHLQHFDEVLKYINELSGTIELNSTLIRAEAL  711



>ref|XP_007684557.1| hypothetical protein COCMIDRAFT_85923 [Bipolaris oryzae ATCC 
44560]
 gb|EUC48959.1| hypothetical protein COCMIDRAFT_85923 [Bipolaris oryzae ATCC 
44560]
Length=808

 Score =   164 bits (414),  Expect = 3e-42, Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  557  QGMSDLLAPIYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKL  616

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++
Sbjct  617  YLHLQSADSTNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKH  676

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G +DLE+TL  AE+L
Sbjct  677  REIIMAHLKHFDEVLKYVNELSGTMDLESTLVRAESL  713



>gb|KIY69995.1| RabGAP/TBC [Cylindrobasidium torrendii FP15055 ss-10]
Length=864

 Score =   164 bits (414),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 76/160 (48%), Positives = 109/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE  +FWCFV  M+R+  NF  DQ+GM  QL +L +L+ ++D  
Sbjct  645  QGMSDLCAPIYVVMEADEEMTFWCFVEQMKRMKQNFLRDQSGMKKQLLSLQELIGVMDPE  704

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + ++   L+V +A+L+ 
Sbjct  705  LYRHLEKTDGLNLFFCFRWVLIAFKREFPFDDVLRLWEVLWTDYYSKDFVLFVSLAVLES  764

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  765  HRDMILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  804



>gb|KIL69693.1| hypothetical protein M378DRAFT_1048890 [Amanita muscaria Koide 
BX008]
Length=813

 Score =   163 bits (413),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 84/196 (43%), Positives = 117/196 (60%), Gaps = 19/196 (10%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERL-GPNFQLDQNGMNTQLFALSKLVELLDG  595
            QGMSDL +PI  VM  DE  +FWCFV  MER+   NF  DQ+GM  QL  L +L+ ++D 
Sbjct  600  QGMSDLCAPIYVVMDGDEELTFWCFVQFMERMVKQNFLRDQSGMKKQLSTLQQLINVMDP  659

Query  594  LLHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILK  415
             L+ + ++ D LN  FCFRW+LI FKREF FE  LRLWEVLWT + + +  L+V +A+L+
Sbjct  660  ELYRHLEKSDALNLFFCFRWVLIAFKREFSFEDVLRLWEVLWTNYYSHNFTLFVALAVLE  719

Query  414  RYRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGA------------  271
             +R  I+   ++FD +L++ NEL   I+L++TL  AE L L   +  A            
Sbjct  720  SHRDVILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFLSFAQLMADIDRKAAEAQVE  779

Query  270  -----ARIPPGTPPSL  238
                  R  PG PP++
Sbjct  780  NLRNLRRRVPGNPPTV  795



>gb|KDO80161.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score =   161 bits (408),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  466  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKR  514
            HNYFKQ DCLNY FCFRW+LIQFKR
Sbjct  526  HNYFKQNDCLNYFFCFRWVLIQFKR  550



>ref|XP_001642096.1| predicted protein [Nematostella vectensis]
 gb|EDO50033.1| predicted protein, partial [Nematostella vectensis]
Length=491

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 108/158 (68%), Gaps = 0/158 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSP+L+++ +E ++FWCFV LME++  NF  +Q GM  QL  L  L++ +D   
Sbjct  306  QGMSDLLSPVLFLVENEVDAFWCFVGLMEKMAHNFDENQEGMKMQLHQLGVLLKFVDPGF  365

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + Y ++ D  N  FCFRW+LI FKREF F+  + LWE  WTQ+L+ + HL VC+AIL R+
Sbjct  366  YTYLEKHDSGNLYFCFRWLLICFKREFSFDDIMTLWEAFWTQNLSPNFHLIVCLAILDRH  425

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALC  295
            R  I+  +  F+ +L+++NEL   ID++ TL  +E LC
Sbjct  426  RQVIMECQFGFNEILKYVNELAYQIDVQETLIKSETLC  463



>gb|EJU05764.1| RabGAP/TBC [Dacryopinax sp. DJM-731 SS1]
Length=795

 Score =   163 bits (412),  Expect = 4e-42, Method: Composition-based stats.
 Identities = 77/168 (46%), Positives = 111/168 (66%), Gaps = 1/168 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL SP+  V   DES +FWCF   MER+ PNF  DQ+GM  QL  L +L+ ++D  
Sbjct  576  QGMSDLCSPLYVVFEGDESMTFWCFTRFMERMKPNFLRDQSGMKKQLLTLQQLIAVMDPE  635

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ +F++ + LN  FCFRWILI FKREF F++ + LWE+LWT   +    L+V +A+L+ 
Sbjct  636  LYRHFEKTESLNLFFCFRWILIIFKREFSFDEVMSLWEILWTDCYSTQFVLFVALAVLES  695

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAA  268
            +R+ I+   ++FD +L++ N+L   IDL++TL  AE L L   +  AA
Sbjct  696  HRNVILRYLVEFDEILKYCNDLSMTIDLDSTLAQAEVLFLSFQQRVAA  743



>ref|XP_001875369.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR14810.1| predicted protein [Laccaria bicolor S238N-H82]
Length=821

 Score =   163 bits (412),  Expect = 5e-42, Method: Composition-based stats.
 Identities = 76/160 (48%), Positives = 105/160 (66%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  DE  +FWCFV  M R+  NF  DQ+GM  QL  L +L+E++D  
Sbjct  604  QGMSDLCAPLYVVMASDEELTFWCFVEFMNRMKQNFLRDQSGMKQQLSTLQQLIEIMDPE  663

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L  + ++ D LN  FCFRW+LI FKREF F   LRLWEVLWT + +    L+V +A+L+ 
Sbjct  664  LFRHLEKTDALNLFFCFRWVLIAFKREFAFGDVLRLWEVLWTDYYSREFVLFVALAVLES  723

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  724  HRDMILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  763



>gb|KDO80160.1| hypothetical protein CISIN_1g005652mg [Citrus sinensis]
Length=553

 Score =   161 bits (407),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/85 (86%), Positives = 78/85 (92%), Gaps = 0/85 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM DES+SFWCFVALMERLGPNF  DQNGM++QLFALSKLVELLD  L
Sbjct  466  QGMSDLLSPILFVMEDESQSFWCFVALMERLGPNFNRDQNGMHSQLFALSKLVELLDNPL  525

Query  588  HNYFKQKDCLNYLFCFRWILIQFKR  514
            HNYFKQ DCLNY FCFRW+LIQFKR
Sbjct  526  HNYFKQNDCLNYFFCFRWVLIQFKR  550



>gb|KEP45951.1| GTPase-activating protein Gyp7 [Rhizoctonia solani 123E]
Length=845

 Score =   163 bits (412),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  V   DE ++FWCFV +ME +  NF  DQ+GM  QL AL +L+ ++D  
Sbjct  617  QGMSDLCAPIYVVSGADEVKTFWCFVEVMEHMKQNFLRDQSGMKKQLSALQQLLSVMDPE  676

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF F+  LRLWEVLWT + T    L+V +A+L+ 
Sbjct  677  LYRHLEKADALNLFFCFRWVLISFKREFPFDDVLRLWEVLWTNYYTNQFVLFVALAVLES  736

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  II   ++FD +L++ N+L   I+L++TL  AE L L
Sbjct  737  HRDVIIRYLIEFDEILKYCNDLSMTIELDSTLAQAEVLFL  776



>gb|EME47991.1| hypothetical protein DOTSEDRAFT_69807 [Dothistroma septosporum 
NZE10]
Length=849

 Score =   163 bits (412),  Expect = 6e-42, Method: Composition-based stats.
 Identities = 75/157 (48%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  + +D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+LLD  L
Sbjct  572  QGMSDLLAPIYAIEQDDAVAFWGFTKFMERMERNFLRDQSGMRLQLLTLDQLVQLLDPKL  631

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + +  + D  N+ F FR +L+ FKREFEFE  LR+WE LWT + + + HL++  AIL+++
Sbjct  632  YEHLAKVDSTNFFFFFRMLLVWFKREFEFEDILRMWEGLWTDYYSSNFHLFLAAAILEKH  691

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ I+     FD +L+++NEL G IDL +TL  AEAL
Sbjct  692  RNVIMEHLKGFDEVLKYVNELSGTIDLNSTLIRAEAL  728



>ref|XP_007705031.1| hypothetical protein COCSADRAFT_127796 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD59269.1| hypothetical protein COCSADRAFT_127796 [Bipolaris sorokiniana 
ND90Pr]
Length=808

 Score =   162 bits (411),  Expect = 7e-42, Method: Composition-based stats.
 Identities = 72/157 (46%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  557  QGMSDLLAPIYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKL  616

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  +  N+ F FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++
Sbjct  617  YLHLQSAESTNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKH  676

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G +DLE+TL  AE+L
Sbjct  677  REIIMAHLKHFDEVLKYVNELSGTMDLESTLVRAESL  713



>gb|KFA46459.1| hypothetical protein S40293_04279 [Stachybotrys chartarum IBT 
40293]
Length=824

 Score =   162 bits (411),  Expect = 7e-42, Method: Composition-based stats.
 Identities = 74/157 (47%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FW F   M+R+  NF  DQ+GM +QL AL +LV  +D  L
Sbjct  580  QGMSDLLAPIYAVIQDDAMAFWAFQKFMDRMERNFLRDQSGMRSQLLALDQLVNFMDPKL  639

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +N+ +  D  N+ F FR IL+ +KREF++   LRLWE LWT +L+ + HL+V +AIL+++
Sbjct  640  YNHLQSADSTNFFFFFRMILVWYKREFQWMDVLRLWEGLWTDYLSANFHLFVALAILEKH  699

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL   +DLE+TL  AEAL
Sbjct  700  RDVIMTHLKHFDEVLKYVNELSNTMDLESTLIRAEAL  736



>gb|KEY73259.1| hypothetical protein S7711_01380 [Stachybotrys chartarum IBT 
7711]
 gb|KFA77831.1| hypothetical protein S40288_00496 [Stachybotrys chartarum IBT 
40288]
Length=826

 Score =   162 bits (411),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 74/157 (47%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FW F   M+R+  NF  DQ+GM +QL AL +LV  +D  L
Sbjct  580  QGMSDLLAPIYAVIQDDAMAFWAFQKFMDRMERNFLRDQSGMRSQLLALDQLVNFMDPKL  639

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +N+ +  D  N+ F FR IL+ +KREF++   LRLWE LWT +L+ + HL+V +AIL+++
Sbjct  640  YNHLQSADSTNFFFFFRMILVWYKREFQWMDVLRLWEGLWTDYLSANFHLFVALAILEKH  699

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL   +DLE+TL  AEAL
Sbjct  700  RDVIMTHLKHFDEVLKYVNELSNTMDLESTLIRAEAL  736



>gb|EUN32280.1| hypothetical protein COCVIDRAFT_22116 [Bipolaris victoriae FI3]
Length=808

 Score =   162 bits (411),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 72/157 (46%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  557  QGMSDLLAPIYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKL  616

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  +  N+ F FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++
Sbjct  617  YLHLQSAESTNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKH  676

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G +DLE+TL  AE+L
Sbjct  677  REIIMAHLKHFDEVLKYVNELSGTMDLESTLVRAESL  713



>gb|KFA60970.1| hypothetical protein S40285_02773 [Stachybotrys chlorohalonata 
IBT 40285]
Length=824

 Score =   162 bits (411),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 74/157 (47%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FW F   M+R+  NF  DQ+GM +QL AL +LV  +D  L
Sbjct  582  QGMSDLLAPIYAVIQDDAMAFWAFQKFMDRMERNFLRDQSGMRSQLLALDQLVNFMDPKL  641

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +N+ +  D  N+ F FR IL+ +KREF++   LRLWE LWT +L+ + HL+V +AIL+++
Sbjct  642  YNHLQSADSTNFFFFFRMILVWYKREFQWMDVLRLWEGLWTDYLSANFHLFVALAILEKH  701

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL   +DLE+TL  AEAL
Sbjct  702  RDVIMTHLKHFDEVLKYVNELSNTMDLESTLIRAEAL  738



>ref|XP_009258695.1| hypothetical protein FPSE_07302 [Fusarium pseudograminearum CS3096]
 gb|EKJ72665.1| hypothetical protein FPSE_07302 [Fusarium pseudograminearum CS3096]
Length=835

 Score =   162 bits (411),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 75/157 (48%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+ +D +L
Sbjct  577  QGMSDLLAPIYAVIQDDAVAFWGFQKFMERMERNFLRDQSGMRNQLLTLDQLVQFMDPVL  636

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             N+ ++ D  N+ F FR IL+ +KREFE+   LRLWE LWT +++ + HL++ +AIL+R+
Sbjct  637  WNHLQKADSTNFFFFFRMILVWYKREFEWLDVLRLWEGLWTDYMSANFHLFIALAILERH  696

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L++INEL   IDLE TL  AE+L
Sbjct  697  RDVIMEHLQHFDEVLKYINELSTTIDLEATLIRAESL  733



>ref|XP_007707138.1| hypothetical protein COCCADRAFT_772 [Bipolaris zeicola 26-R-13]
 gb|EUC38491.1| hypothetical protein COCCADRAFT_772 [Bipolaris zeicola 26-R-13]
Length=808

 Score =   162 bits (411),  Expect = 8e-42, Method: Composition-based stats.
 Identities = 72/157 (46%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  557  QGMSDLLAPIYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKL  616

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  +  N+ F FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++
Sbjct  617  YLHLQSAESTNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKH  676

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G +DLE+TL  AE+L
Sbjct  677  REIIMAHLKHFDEVLKYVNELSGTMDLESTLVRAESL  713



>gb|KIJ69240.1| hypothetical protein HYDPIDRAFT_105840 [Hydnomerulius pinastri 
MD-312]
Length=852

 Score =   162 bits (411),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 74/160 (46%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESE-SFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  +M  E E +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  630  QGMSDLCAPLYVIMEAEEELTFWCFVEVMNRMSQNFLRDQSGMKKQLSTLQELISVMDPE  689

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF FE  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  690  LYRHLEKTDGLNLFFCFRWVLIAFKREFPFEDVLRLWEVLWTDYYSNSFVLFVALAVLES  749

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  +E L L
Sbjct  750  HRDMILRYLVEFDEILKYCNELSMTIELDSTLAQSEVLFL  789



>ref|XP_011323699.1| GTPase-activating protein GYP7 [Fusarium graminearum PH-1]
 gb|ESU11123.1| GTPase-activating protein GYP7 [Fusarium graminearum PH-1]
 gb|EYB29944.1| hypothetical protein FG05_05191 [Fusarium graminearum]
 emb|CEF86170.1| unnamed protein product [Fusarium graminearum]
Length=830

 Score =   162 bits (411),  Expect = 9e-42, Method: Composition-based stats.
 Identities = 75/157 (48%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FW F   MER+  NF  DQ+GM  QL  L +LV+ +D +L
Sbjct  577  QGMSDLLAPIYAVIQDDAVAFWGFQKFMERMERNFLRDQSGMRNQLLTLDQLVQFMDPVL  636

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             N+ ++ D  N+ F FR IL+ +KREFE+   LRLWE LWT +++ + HL++ +AIL+R+
Sbjct  637  WNHLQKADSTNFFFFFRMILVWYKREFEWLDVLRLWEGLWTDYMSANFHLFIALAILERH  696

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L++INEL   IDLE TL  AE+L
Sbjct  697  RDVIMEHLQHFDEVLKYINELSTTIDLEATLIRAESL  733



>ref|XP_005833659.1| hypothetical protein GUITHDRAFT_70335, partial [Guillardia theta 
CCMP2712]
 gb|EKX46679.1| hypothetical protein GUITHDRAFT_70335, partial [Guillardia theta 
CCMP2712]
Length=357

 Score =   157 bits (397),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDL +P+L VM DE E+FWCF  LM+ + PNF  DQNGM+TQL  ++ L + L+  L
Sbjct  124  QGMSDLAAPLLVVMEDEVEAFWCFQKLMDLMEPNFHKDQNGMHTQLQTINTLCKDLEPEL  183

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +++ ++KDC N+ FCFRW+LI +KREF  +   RLWE  W++   + LHL+V +AIL+++
Sbjct  184  YDHLERKDCSNFYFCFRWLLIIYKREFGLQDVFRLWEAFWSRVRGQDLHLFVALAILRKH  243

Query  408  RSKIIGEKMDFDTLLEFINELG  343
            ++ II E M+FD++L+F+N+L 
Sbjct  244  KANIIEEDMEFDSVLKFVNDLS  265



>ref|XP_007054875.1| PREDICTED: TBC1 domain family member 15 [Chelonia mydas]
Length=707

 Score =   161 bits (408),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 108/159 (68%), Gaps = 0/159 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSP+LYVM +E ++FWCFV+ M+++  NF+    GM TQL  LS L+ LLD   
Sbjct  471  QGMSDLLSPVLYVMENEVDAFWCFVSYMDQMHENFEEQMQGMKTQLIQLSTLLRLLDSGF  530

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             NY + +D     FCFRW+LIQFKREF F+  LRLWEV+WT+   ++ HL +C AIL+  
Sbjct  531  CNYLESQDSGYLYFCFRWLLIQFKREFSFQDILRLWEVMWTELPCQNFHLLICCAILESE  590

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            + +I+ +   F+ +L+ INEL   ID+E  L  AEA+ +
Sbjct  591  KQQIMDKHYGFNEILKHINELSMKIDVEDILCKAEAISI  629



>emb|CEP17529.1| hypothetical protein [Parasitella parasitica]
Length=813

 Score =   162 bits (410),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+   M DE+ +FW F A M+R+  NF +DQ+GM+ QL  L  L+  +D  L
Sbjct  589  QGMSDLLAPLFVAMGDEALAFWAFTAFMDRVQSNFYMDQSGMHGQLKTLDSLIHFMDPEL  648

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            H   ++ +  N  FCFRW+L+ FKREFE+E  +RLWEVLWT HL++ + L++ +A++  +
Sbjct  649  HKRLEETETSNLFFCFRWLLVWFKREFEWEDVIRLWEVLWTDHLSDKMILFIALAVIDAH  708

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+ E   FD +L++IN+L G+I LE TL  AE L
Sbjct  709  RKTILEELNQFDEILKYINDLTGNIPLEPTLERAEVL  745



>ref|XP_007267802.1| RabGAP/TBC [Fomitiporia mediterranea MF3/22]
 gb|EJD02386.1| RabGAP/TBC [Fomitiporia mediterranea MF3/22]
Length=888

 Score =   162 bits (411),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 76/158 (48%), Positives = 106/158 (67%), Gaps = 1/158 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVMR-DESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +PI  VM  DE   FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  645  QGMSDLCAPIYVVMGGDEEMIFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLISVMDPE  704

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRW+LI FKREF F+  L+LWEVLWT + + +  L+V +AIL+ 
Sbjct  705  LYRHLEKTDGLNLFFCFRWVLIAFKREFPFDDVLKLWEVLWTDYYSANFVLFVALAILES  764

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            +R  I+   ++FD +L++ NEL   I+L+TTL  AE L
Sbjct  765  HRDVILRYLIEFDEILKYCNELSMTIELDTTLAQAEVL  802



>ref|XP_007676059.1| hypothetical protein BAUCODRAFT_33679 [Baudoinia compniacensis 
UAMH 10762]
 gb|EMC96351.1| hypothetical protein BAUCODRAFT_33679 [Baudoinia compniacensis 
UAMH 10762]
Length=850

 Score =   162 bits (410),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  + +D++ +FW FV  MER+  NF  DQ+GM  QL  L +L +LLD  L
Sbjct  574  QGMSDLLAPIYAIEQDDAVAFWGFVKFMERMERNFLRDQSGMRLQLLTLDQLCQLLDPKL  633

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + ++ D  N+ F FR +L+ FKREF FE  LRL+E LWT  L+ + HL+V +AIL+++
Sbjct  634  YEHLQKLDSTNFFFFFRMLLVWFKREFSFEDILRLYETLWTDFLSANFHLFVAMAILEKH  693

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ I+     FD +L+++NEL G IDL +TL  AEAL
Sbjct  694  RNVIMEHLKGFDEVLKYVNELSGSIDLPSTLVRAEAL  730



>ref|XP_002117757.1| hypothetical protein TRIADDRAFT_38489 [Trichoplax adhaerens]
 gb|EDV19733.1| hypothetical protein TRIADDRAFT_38489 [Trichoplax adhaerens]
Length=491

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDL+SPIL+VM +E+++FWCFV LMER+G NF +DQ  +  QL  L  L+  +D   
Sbjct  309  QGMSDLVSPILFVMENEADTFWCFVGLMERIGSNFDIDQKEIQKQLSLLYGLIRFVDPEF  368

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             NY    D  N  FCFRW+L+ FKREF F++T+ LWEVLW+Q L++H  L++C+AI+   
Sbjct  369  CNYLDTHDSNNLYFCFRWLLVLFKREFTFQETMLLWEVLWSQRLSQHFLLFICLAIIMNQ  428

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            +  I+     F+ +++ +NEL   ++LE  L+ AE +
Sbjct  429  KQVIVSNNYGFNEIIKHVNELALKLNLEDILKKAETM  465



>gb|ENI06740.1| hypothetical protein COCC4DRAFT_192817 [Bipolaris maydis ATCC 
48331]
Length=808

 Score =   162 bits (409),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 72/157 (46%), Positives = 109/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M+R+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  557  QGMSDLLAPIYAVMQDDAVAFWSFVGFMDRMERNFLRDQSGMRKQLMTLDHLVQLMDPKL  616

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  +  N+ F FR +L+ +KREFE+   LRLWE LWT +L+ + H+++ +AIL+++
Sbjct  617  YLHLQSAESTNFFFFFRMLLVWYKREFEWADVLRLWESLWTDYLSSNFHIFIALAILEKH  676

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G +DLE+TL  AE+L
Sbjct  677  REIIMAHLKHFDEVLKYVNELSGTMDLESTLVRAESL  713



>gb|KIV99936.1| hypothetical protein PV09_08456 [Verruconis gallopava]
Length=833

 Score =   162 bits (410),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M R+  NF  DQ+GM TQL  L  LV+LLD +L
Sbjct  566  QGMSDLLAPIYAVMQDDAVAFWGFVEFMNRMERNFLRDQSGMRTQLLTLDHLVQLLDPVL  625

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + ++ D  N+ F FR +L+ +KREFE+   LRLWE +WT  L+ + HL+V +AIL+++
Sbjct  626  YAHLQKCDSTNFFFFFRMLLVWYKREFEWMDVLRLWECMWTDFLSSNFHLFVALAILEKH  685

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R+ I+     FD +L++INEL   IDL +TL  AE L
Sbjct  686  RNVIMEHLRGFDEVLKYINELSNSIDLTSTLVRAEQL  722



>ref|XP_010312019.1| PREDICTED: TBC1 domain family member 15, partial [Balearica regulorum 
gibbericeps]
 gb|KFO04055.1| TBC1 domain family member 15, partial [Balearica regulorum gibbericeps]
Length=341

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/159 (48%), Positives = 108/159 (68%), Gaps = 0/159 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSP+LYVM +E ++FWCFV+ M+++  NF+    GM TQL  LS L+ LLD   
Sbjct  109  QGMSDLLSPVLYVMENEVDAFWCFVSYMDQMHQNFEEQMQGMKTQLIQLSTLLRLLDSGF  168

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             +Y + +D     FCFRW+LI+FKREF F+  LRLWEV+WT+   ++ HL +C AIL+  
Sbjct  169  CSYLESQDSGYLYFCFRWLLIRFKREFSFQDILRLWEVMWTELPCQNFHLLLCCAILESE  228

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            + +I+ +   F+ +L+ INEL   ID+E  L  AEA+ +
Sbjct  229  KQQIMDKHYGFNEILKHINELSMKIDVEYILCKAEAISM  267



>ref|XP_007395913.1| hypothetical protein PHACADRAFT_173743 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55590.1| hypothetical protein PHACADRAFT_173743 [Phanerochaete carnosa 
HHB-10118-sp]
Length=812

 Score =   162 bits (409),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 77/160 (48%), Positives = 108/160 (68%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  DE  +FWCFV++M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  598  QGMSDLCAPVYVVMDADEELTFWCFVSVMTRMKHNFLRDQSGMKKQLSTLQQLIGVMDPE  657

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ D LN  FCFRWILI FKREF FE  LRLWEVLWT   + +  L+V +A+L+ 
Sbjct  658  LYRHLEKTDALNLFFCFRWILIAFKREFSFEDVLRLWEVLWTDCYSRNFVLFVSLAMLES  717

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  718  HRDVIMRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  757



>ref|XP_003302157.1| hypothetical protein PTT_13880 [Pyrenophora teres f. teres 0-1]
 gb|EFQ89743.1| hypothetical protein PTT_13880 [Pyrenophora teres f. teres 0-1]
Length=812

 Score =   162 bits (409),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 72/157 (46%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  MER+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  554  QGMSDLLAPIYAVMQDDAVAFWGFVGFMERMERNFLRDQSGMRKQLMTLDHLVQLMDPKL  613

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  +  N+ F FR +L+ +KREFE+   LRLWE LWT + + + H+++ +AIL+++
Sbjct  614  YLHLQSAESTNFFFFFRMLLVWYKREFEWADVLRLWEALWTDYQSSNFHIFIALAILEKH  673

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G +DLE+TL  AE+L
Sbjct  674  RDIIMAHLKHFDEVLKYVNELSGTMDLESTLVRAESL  710



>gb|KIM87015.1| hypothetical protein PILCRDRAFT_95906 [Piloderma croceum F 1598]
Length=824

 Score =   162 bits (409),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 75/160 (47%), Positives = 107/160 (67%), Gaps = 1/160 (1%)
 Frame = -2

Query  768  QGMSDLLSPILYVM-RDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGL  592
            QGMSDL +P+  VM  DE  +FWCFV +M R+  NF  DQ+GM  QL  L +L+ ++D  
Sbjct  604  QGMSDLCAPVYVVMGSDEELTFWCFVEVMNRMKQNFLRDQSGMKKQLLTLQQLISVMDPE  663

Query  591  LHNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKR  412
            L+ + ++ + LN  FCFRW+LI FKREF FE  LRLWEVLWT + +    L+V +A+L+ 
Sbjct  664  LYRHLEKTEGLNLFFCFRWVLIAFKREFPFEDILRLWEVLWTDYYSNEFVLFVALAVLES  723

Query  411  YRSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            +R  I+   ++FD +L++ NEL   I+L++TL  AE L L
Sbjct  724  HRDVILRYLVEFDEILKYCNELSMTIELDSTLAQAEVLFL  763



>ref|XP_010752960.1| PREDICTED: TBC1 domain family member 15 isoform X1 [Larimichthys 
crocea]
Length=658

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 0/159 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM +E E+FWCFV+ M+++  NF+    GM TQL  LS L+ LLD   
Sbjct  435  QGMSDLLSPILYVMENEVEAFWCFVSFMDQMHHNFEEQMQGMKTQLIQLSTLLRLLDSAF  494

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             NY + +D     FCFRW+LI+FKRE  F+  LRLWEV+WT    E+ HL VC AIL   
Sbjct  495  WNYLESQDSGYLYFCFRWLLIRFKRELSFQDVLRLWEVMWTGLPCENFHLLVCCAILDSE  554

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            + KI+ E   F+ +L+ INEL   +++E  L+ AE + +
Sbjct  555  KQKIMEENYGFNEILKHINELSMKLNIEEILQKAEGISV  593



>ref|XP_010752961.1| PREDICTED: TBC1 domain family member 15 isoform X2 [Larimichthys 
crocea]
Length=657

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 105/159 (66%), Gaps = 0/159 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPILYVM +E E+FWCFV+ M+++  NF+    GM TQL  LS L+ LLD   
Sbjct  434  QGMSDLLSPILYVMENEVEAFWCFVSFMDQMHHNFEEQMQGMKTQLIQLSTLLRLLDSAF  493

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             NY + +D     FCFRW+LI+FKRE  F+  LRLWEV+WT    E+ HL VC AIL   
Sbjct  494  WNYLESQDSGYLYFCFRWLLIRFKRELSFQDVLRLWEVMWTGLPCENFHLLVCCAILDSE  553

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCL  292
            + KI+ E   F+ +L+ INEL   +++E  L+ AE + +
Sbjct  554  KQKIMEENYGFNEILKHINELSMKLNIEEILQKAEGISV  592



>gb|KEQ79017.1| RabGAP/TBC [Aureobasidium pullulans EXF-150]
Length=805

 Score =   161 bits (408),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 77/157 (49%), Positives = 107/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M R+  NF  DQ+GM  QL  L  LV+LLD  L
Sbjct  554  QGMSDLLAPIYAVMQDDAVAFWGFVNFMNRMERNFLRDQSGMRLQLTTLDHLVQLLDPKL  613

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ +KREFEF + LRLWE LWT +L+ + HL++ VAIL+++
Sbjct  614  YLHLQSVDSTNFFFFFRMLLVWYKREFEFPQVLRLWEGLWTDYLSANFHLFIAVAILEKH  673

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL   IDL +TL  AEAL
Sbjct  674  RDVIMEHLKGFDEVLKYVNELSNTIDLPSTLLRAEAL  710



>gb|EFX01643.1| GTPase activating protein [Grosmannia clavigera kw1407]
Length=847

 Score =   162 bits (409),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 75/157 (48%), Positives = 105/157 (67%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FW F   M+R+  NF  DQ+GM  QL AL  LV+ +D  L
Sbjct  563  QGMSDLLAPIYAVVQDDAIAFWAFQHFMDRMERNFLRDQSGMRAQLLALDHLVQFMDPKL  622

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + K  D  N+ F FR +L+ +KREFE+   LRLWE LWT +L+   HL+V +AIL+R+
Sbjct  623  YEHLKAADSTNFFFFFRMLLVWYKREFEWPNVLRLWETLWTDYLSSSFHLFVALAILERH  682

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G I+LE TL  AE L
Sbjct  683  RDVIMTHLQHFDEVLKYVNELSGTIELEPTLIRAEML  719



>ref|XP_009223960.1| GTPase-activating protein GYP7 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
 gb|EJT74016.1| GTPase-activating protein GYP7 [Gaeumannomyces graminis var. 
tritici R3-111a-1]
Length=849

 Score =   162 bits (409),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 106/157 (68%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  V++D++ +FWCF   M+R+  NF  DQ+GM  QL AL  LV+ +D  L
Sbjct  575  QGMSDLLAPIYAVVQDDAVAFWCFQHFMDRMERNFLRDQSGMRAQLLALDHLVQFMDPKL  634

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ +KREF ++  LRLWEVLWT  LT   HL+  +AIL+++
Sbjct  635  YAHLRSADSTNFFFFFRMLLVWYKREFAWDDVLRLWEVLWTDRLTSSFHLFFALAILEKH  694

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  ++     FD +L+++NEL   +DLE+TL  AEAL
Sbjct  695  RDVMMNHLKHFDEVLKYVNELSCTMDLESTLIRAEAL  731



>gb|EPE09161.1| gtpase-activating protein gyp7 [Ophiostoma piceae UAMH 11346]
Length=938

 Score =   162 bits (410),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 73/157 (46%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+P+  V++D++ +FW F   M+R+  NF  DQ+GM  QL AL  L++ +D  L
Sbjct  614  QGMSDLLAPLYAVIQDDAMAFWAFQHFMDRMERNFLRDQSGMRAQLLALDHLLQFMDPKL  673

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            +++ K+ D  N+ F FR +L+ +KREF++   LRLWE LWT  L+   HL+V +AIL+++
Sbjct  674  YDHLKKADSTNFFFFFRMLLVWYKREFDWPDVLRLWETLWTDLLSSSFHLFVALAILEKH  733

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G IDLE+TL  AEAL
Sbjct  734  REIIMTHLQHFDEVLKYVNELSGTIDLESTLIRAEAL  770



>ref|XP_010890362.1| PREDICTED: TBC1 domain family member 15-like [Esox lucius]
Length=660

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/190 (44%), Positives = 115/190 (61%), Gaps = 9/190 (5%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLLSPIL+VM +E ++FWCFV+ M+++  NF+    GM TQL  LS L++LLD   
Sbjct  404  QGMSDLLSPILFVMENEVDAFWCFVSFMDQMHQNFEEQMQGMKTQLAQLSTLLQLLDITF  463

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
             NY   +D  +  FCFRW+LI+FKRE  F   LRLWEV+WT    ++ HL VC A+L   
Sbjct  464  WNYLGNQDSGHLYFCFRWLLIRFKRELIFHDVLRLWEVIWTGLPCQNFHLLVCCAVLDSE  523

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEALCLCAGEYGAARIP---------P  256
            + KI+ E+  F+ +L+ +NEL   +D+   L+ AEA+CL          P         P
Sbjct  524  KQKIMEEQYSFNEILKHVNELSMKLDIRVILQKAEAMCLQLKSCKDLPSPVMEILGFSNP  583

Query  255  GTPPSLPIQN  226
            GTP S   Q+
Sbjct  584  GTPSSSRSQD  593



>ref|XP_008023866.1| hypothetical protein SETTUDRAFT_168350 [Setosphaeria turcica 
Et28A]
 gb|EOA88449.1| hypothetical protein SETTUDRAFT_168350 [Setosphaeria turcica 
Et28A]
Length=805

 Score =   161 bits (407),  Expect = 2e-41, Method: Composition-based stats.
 Identities = 72/157 (46%), Positives = 108/157 (69%), Gaps = 0/157 (0%)
 Frame = -2

Query  768  QGMSDLLSPILYVMRDESESFWCFVALMERLGPNFQLDQNGMNTQLFALSKLVELLDGLL  589
            QGMSDLL+PI  VM+D++ +FW FV  M R+  NF  DQ+GM  QL  L  LV+L+D  L
Sbjct  556  QGMSDLLAPIYAVMQDDAIAFWGFVGFMARMERNFLRDQSGMRKQLMTLDHLVQLMDPKL  615

Query  588  HNYFKQKDCLNYLFCFRWILIQFKREFEFEKTLRLWEVLWTQHLTEHLHLYVCVAILKRY  409
            + + +  D  N+ F FR +L+ +KREF++   LRLWE LWT +L+ + H+++ +AIL+++
Sbjct  616  YLHLQSADSTNFFFFFRMLLVWYKREFDWPDVLRLWESLWTDYLSSNFHIFIALAILEKH  675

Query  408  RSKIIGEKMDFDTLLEFINELGGHIDLETTLRDAEAL  298
            R  I+     FD +L+++NEL G +DLE+TL  AE+L
Sbjct  676  REIIMAHLQHFDEVLKYVNELSGTMDLESTLVRAESL  712



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1481068694310