BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038L08

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009774097.1|  PREDICTED: upstream activation factor subuni...    238   1e-73   Nicotiana sylvestris
ref|XP_004230795.1|  PREDICTED: upstream activation factor subuni...    235   4e-72   
ref|XP_009629953.1|  PREDICTED: upstream activation factor subuni...    234   5e-72   Nicotiana tomentosiformis
ref|XP_006346438.1|  PREDICTED: upstream activation factor subuni...    234   5e-72   Solanum tuberosum [potatoes]
ref|XP_006346439.1|  PREDICTED: upstream activation factor subuni...    234   5e-72   Solanum tuberosum [potatoes]
gb|KHN42058.1|  Upstream activation factor subunit spp27                228   2e-71   Glycine soja [wild soybean]
ref|XP_010315240.1|  PREDICTED: upstream activation factor subuni...    231   1e-70   Solanum lycopersicum
ref|XP_009774096.1|  PREDICTED: upstream activation factor subuni...    231   1e-70   Nicotiana sylvestris
ref|XP_009774095.1|  PREDICTED: upstream activation factor subuni...    231   1e-70   Nicotiana sylvestris
ref|XP_010255131.1|  PREDICTED: upstream activation factor subuni...    229   8e-70   Nelumbo nucifera [Indian lotus]
ref|XP_003517282.1|  PREDICTED: upstream activation factor subuni...    229   9e-70   Glycine max [soybeans]
ref|XP_003537360.1|  PREDICTED: upstream activation factor subuni...    228   2e-69   Glycine max [soybeans]
ref|XP_007156836.1|  hypothetical protein PHAVU_002G021500g             228   3e-69   Phaseolus vulgaris [French bean]
ref|XP_007156837.1|  hypothetical protein PHAVU_002G021500g             228   3e-69   Phaseolus vulgaris [French bean]
ref|XP_009629952.1|  PREDICTED: upstream activation factor subuni...    227   4e-69   Nicotiana tomentosiformis
ref|XP_009629951.1|  PREDICTED: upstream activation factor subuni...    227   4e-69   Nicotiana tomentosiformis
ref|XP_007042350.1|  SWIB complex BAF60b domain-containing protei...    231   5e-69   Theobroma cacao [chocolate]
gb|KDO79317.1|  hypothetical protein CISIN_1g0196442mg                  222   8e-69   Citrus sinensis [apfelsine]
ref|XP_002522329.1|  Upstream activation factor subunit UAF30, pu...    226   1e-68   Ricinus communis
ref|XP_007047160.1|  SWIB complex BAF60b domain-containing protei...    224   5e-68   
ref|XP_010652654.1|  PREDICTED: upstream activation factor subuni...    219   3e-66   Vitis vinifera
ref|XP_006425831.1|  hypothetical protein CICLE_v10026010mg             219   5e-66   Citrus clementina [clementine]
ref|XP_004511971.1|  PREDICTED: upstream activation factor subuni...    219   7e-66   Cicer arietinum [garbanzo]
ref|XP_008792695.1|  PREDICTED: upstream activation factor subuni...    218   8e-66   
ref|XP_008792693.1|  PREDICTED: upstream activation factor subuni...    218   1e-65   
ref|XP_010263744.1|  PREDICTED: upstream activation factor subuni...    218   1e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010263746.1|  PREDICTED: upstream activation factor subuni...    218   1e-65   Nelumbo nucifera [Indian lotus]
emb|CAN83123.1|  hypothetical protein VITISV_044372                     217   2e-65   Vitis vinifera
ref|XP_011099215.1|  PREDICTED: upstream activation factor subuni...    216   7e-65   Sesamum indicum [beniseed]
ref|XP_008792591.1|  PREDICTED: upstream activation factor subuni...    216   1e-64   Phoenix dactylifera
ref|XP_008792590.1|  PREDICTED: upstream activation factor subuni...    215   1e-64   Phoenix dactylifera
gb|KDP31884.1|  hypothetical protein JCGZ_12345                         213   1e-63   Jatropha curcas
gb|KJB32415.1|  hypothetical protein B456_005G239900                    216   1e-63   Gossypium raimondii
ref|XP_011099216.1|  PREDICTED: upstream activation factor subuni...    213   1e-63   Sesamum indicum [beniseed]
gb|KJB32416.1|  hypothetical protein B456_005G239900                    217   3e-63   Gossypium raimondii
gb|KJB32414.1|  hypothetical protein B456_005G239900                    217   4e-63   Gossypium raimondii
ref|XP_002521839.1|  brg-1 associated factor, putative                  219   4e-63   
ref|XP_010905631.1|  PREDICTED: upstream activation factor subuni...    209   2e-62   Elaeis guineensis
ref|XP_010905630.1|  PREDICTED: upstream activation factor subuni...    209   3e-62   Elaeis guineensis
emb|CDP02467.1|  unnamed protein product                                209   3e-62   Coffea canephora [robusta coffee]
gb|KHG25549.1|  Upstream activation factor subunit spp27                214   5e-62   Gossypium arboreum [tree cotton]
gb|KJB43618.1|  hypothetical protein B456_007G210300                    202   2e-61   Gossypium raimondii
gb|KJB43616.1|  hypothetical protein B456_007G210300                    200   2e-60   Gossypium raimondii
gb|KJB43617.1|  hypothetical protein B456_007G210300                    199   4e-60   Gossypium raimondii
gb|KJB43613.1|  hypothetical protein B456_007G210300                    200   7e-60   Gossypium raimondii
ref|XP_002306454.2|  hypothetical protein POPTR_0005s14110g             202   9e-60   
gb|KJB43608.1|  hypothetical protein B456_007G210300                    202   2e-59   Gossypium raimondii
ref|XP_011009270.1|  PREDICTED: protein TRI1-like                       201   2e-59   Populus euphratica
ref|XP_004170902.1|  PREDICTED: uncharacterized protein LOC101226406    197   1e-58   
gb|KJB43609.1|  hypothetical protein B456_007G210300                    200   1e-58   Gossypium raimondii
ref|XP_010941845.1|  PREDICTED: upstream activation factor subuni...    200   1e-58   Elaeis guineensis
gb|KJB43610.1|  hypothetical protein B456_007G210300                    199   2e-58   Gossypium raimondii
gb|KHG26278.1|  Upstream activation factor subunit spp27                198   7e-58   Gossypium arboreum [tree cotton]
gb|KEH27539.1|  upstream activation factor subunit UAF30, putative      196   1e-57   Medicago truncatula
ref|XP_004148436.1|  PREDICTED: upstream activation factor subuni...    196   3e-57   Cucumis sativus [cucumbers]
gb|AES94759.2|  upstream activation factor subunit UAF30, putative      196   4e-57   Medicago truncatula
ref|XP_003611801.1|  Upstream activation factor subunit spp27           196   1e-56   
ref|XP_009397729.1|  PREDICTED: upstream activation factor subuni...    195   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009587440.1|  PREDICTED: upstream activation factor subuni...    194   3e-56   Nicotiana tomentosiformis
ref|XP_008457882.1|  PREDICTED: upstream activation factor subuni...    193   4e-56   Cucumis melo [Oriental melon]
ref|XP_003558997.1|  PREDICTED: upstream activation factor subuni...    193   6e-56   Brachypodium distachyon [annual false brome]
ref|XP_009803136.1|  PREDICTED: upstream activation factor subuni...    193   6e-56   Nicotiana sylvestris
ref|XP_010028508.1|  PREDICTED: DNA ligase 1                            196   1e-55   Eucalyptus grandis [rose gum]
ref|XP_010691015.1|  PREDICTED: upstream activation factor subuni...    191   4e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010096161.1|  Upstream activation factor subunit spp27           194   6e-55   Morus notabilis
ref|XP_010691016.1|  PREDICTED: upstream activation factor subuni...    189   1e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006650641.1|  PREDICTED: upstream activation factor subuni...    189   3e-54   Oryza brachyantha
dbj|BAB01706.1|  unnamed protein product                                192   3e-54   Arabidopsis thaliana [mouse-ear cress]
gb|ABF99032.1|  SWIB complex BAF60b domain-containing protein, pu...    187   1e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_188538.1|  SWIB complex BAF60b domain-containing protein         188   6e-53   Arabidopsis thaliana [mouse-ear cress]
emb|CDX99270.1|  BnaC05g33850D                                          184   3e-51   
ref|XP_009145829.1|  PREDICTED: uncharacterized protein LOC103869495    184   3e-51   Brassica rapa
emb|CDX92300.1|  BnaA05g21070D                                          184   3e-51   
ref|XP_004981658.1|  PREDICTED: upstream activation factor subuni...    180   5e-51   Setaria italica
gb|KFK39235.1|  hypothetical protein AALP_AA3G218000                    182   2e-50   Arabis alpina [alpine rockcress]
ref|NP_001147426.1|  LOC100281035                                       178   3e-50   Zea mays [maize]
ref|XP_002466401.1|  hypothetical protein SORBIDRAFT_01g007140          177   6e-50   Sorghum bicolor [broomcorn]
gb|AGT16365.1|  SWIB/MDM2 domain containing protein                     176   3e-49   Saccharum hybrid cultivar R570
gb|AGT16808.1|  SWIB/MDM2 domain containing protein                     175   4e-49   Saccharum hybrid cultivar R570
ref|NP_001148210.1|  SWIB/MDM2 domain containing protein                174   7e-49   
ref|XP_002977839.1|  hypothetical protein SELMODRAFT_176439             173   5e-48   Selaginella moellendorffii
ref|XP_010536330.1|  PREDICTED: synaptonemal complex protein 1 is...    181   5e-48   Tarenaya hassleriana [spider flower]
ref|XP_010536329.1|  PREDICTED: calponin homology domain-containi...    181   5e-48   Tarenaya hassleriana [spider flower]
ref|XP_010536328.1|  PREDICTED: golgin subfamily A member 6-like ...    181   5e-48   Tarenaya hassleriana [spider flower]
ref|XP_010536327.1|  PREDICTED: golgin subfamily A member 6-like ...    181   5e-48   Tarenaya hassleriana [spider flower]
ref|XP_010536324.1|  PREDICTED: golgin subfamily A member 6-like ...    181   5e-48   Tarenaya hassleriana [spider flower]
ref|XP_010680445.1|  PREDICTED: uncharacterized protein LOC104895589    172   5e-48   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU44365.1|  hypothetical protein MIMGU_mgv1a025674mg                168   8e-47   Erythranthe guttata [common monkey flower]
ref|XP_002883161.1|  SWIB complex BAF60b domain-containing protein      171   3e-46   
ref|XP_002979488.1|  hypothetical protein SELMODRAFT_419232             166   1e-45   Selaginella moellendorffii
gb|KDO79318.1|  hypothetical protein CISIN_1g0196442mg                  161   2e-45   Citrus sinensis [apfelsine]
gb|KDO79319.1|  hypothetical protein CISIN_1g0196442mg                  161   2e-45   Citrus sinensis [apfelsine]
gb|AFW67527.1|  hypothetical protein ZEAMMB73_352797                    163   1e-44   
gb|ACJ85465.1|  unknown                                                 163   2e-44   Medicago truncatula
ref|XP_001768652.1|  predicted protein                                  158   8e-43   
emb|CBI23284.3|  unnamed protein product                                155   9e-42   Vitis vinifera
ref|XP_010317157.1|  PREDICTED: LOW QUALITY PROTEIN: upstream act...    153   7e-41   
ref|XP_010263743.1|  PREDICTED: upstream activation factor subuni...    153   2e-40   
ref|XP_010263742.1|  PREDICTED: upstream activation factor subuni...    153   2e-40   
gb|KDP38240.1|  hypothetical protein JCGZ_04883                         149   4e-40   Jatropha curcas
gb|EMS67367.1|  Upstream activation factor subunit spp27                153   9e-40   Triticum urartu
ref|XP_008236631.1|  PREDICTED: upstream activation factor subuni...    149   5e-39   Prunus mume [ume]
ref|XP_008236632.1|  PREDICTED: upstream activation factor subuni...    149   6e-39   Prunus mume [ume]
ref|XP_007199917.1|  hypothetical protein PRUPE_ppa007326mg             149   8e-39   
ref|XP_001767040.1|  predicted protein                                  145   2e-37   
gb|EMT28995.1|  hypothetical protein F775_31871                         142   2e-37   
ref|XP_010941848.1|  PREDICTED: upstream activation factor subuni...    142   6e-37   
ref|XP_009345973.1|  PREDICTED: upstream activation factor subuni...    143   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_009345971.1|  PREDICTED: upstream activation factor subuni...    143   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_009345972.1|  PREDICTED: upstream activation factor subuni...    143   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_011458329.1|  PREDICTED: upstream activation factor subuni...    142   3e-36   Fragaria vesca subsp. vesca
ref|XP_011458333.1|  PREDICTED: upstream activation factor subuni...    142   3e-36   Fragaria vesca subsp. vesca
ref|XP_004290311.1|  PREDICTED: upstream activation factor subuni...    142   3e-36   Fragaria vesca subsp. vesca
gb|KHN36203.1|  Upstream activation factor subunit spp27                142   3e-36   Glycine soja [wild soybean]
ref|XP_011458331.1|  PREDICTED: upstream activation factor subuni...    142   3e-36   Fragaria vesca subsp. vesca
ref|XP_010941846.1|  PREDICTED: upstream activation factor subuni...    140   4e-36   Elaeis guineensis
ref|XP_011458335.1|  PREDICTED: upstream activation factor subuni...    142   4e-36   Fragaria vesca subsp. vesca
ref|XP_010999877.1|  PREDICTED: upstream activation factor subuni...    141   9e-36   Populus euphratica
ref|XP_010999905.1|  PREDICTED: upstream activation factor subuni...    141   9e-36   Populus euphratica
ref|XP_006393249.1|  hypothetical protein EUTSA_v10011568mg             141   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010999870.1|  PREDICTED: upstream activation factor subuni...    141   1e-35   Populus euphratica
ref|XP_010999862.1|  PREDICTED: upstream activation factor subuni...    141   1e-35   Populus euphratica
ref|XP_010999856.1|  PREDICTED: uncharacterized protein PFB0145c-...    141   1e-35   Populus euphratica
ref|XP_009345974.1|  PREDICTED: ABC transporter F family member 4       142   2e-35   
ref|XP_010999846.1|  PREDICTED: uncharacterized protein PFB0145c-...    141   2e-35   Populus euphratica
ref|XP_010229398.1|  PREDICTED: upstream activation factor subuni...    137   8e-35   
gb|KFK36005.1|  hypothetical protein AALP_AA4G065400                    137   3e-34   Arabis alpina [alpine rockcress]
gb|KFK36004.1|  hypothetical protein AALP_AA4G065400                    137   3e-34   Arabis alpina [alpine rockcress]
ref|XP_006384456.1|  SWIB complex BAF60b domain-containing family...    137   4e-34   
ref|XP_009375739.1|  PREDICTED: upstream activation factor subuni...    136   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_009375738.1|  PREDICTED: upstream activation factor subuni...    136   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_009375737.1|  PREDICTED: upstream activation factor subuni...    136   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_009375740.1|  PREDICTED: upstream activation factor subuni...    135   6e-34   Pyrus x bretschneideri [bai li]
ref|XP_009803137.1|  PREDICTED: protein TRI1-like isoform X2            134   2e-33   Nicotiana sylvestris
ref|XP_002891515.1|  SWIB complex BAF60b domain-containing protein      134   3e-33   
ref|XP_011001193.1|  PREDICTED: upstream activation factor subuni...    133   5e-33   Populus euphratica
ref|XP_011001192.1|  PREDICTED: protein TRI1-like isoform X2            133   8e-33   Populus euphratica
ref|XP_011001190.1|  PREDICTED: upstream activation factor subuni...    133   1e-32   Populus euphratica
ref|XP_010461790.1|  PREDICTED: upstream activation factor subuni...    130   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010461791.1|  PREDICTED: upstream activation factor subuni...    130   6e-32   Camelina sativa [gold-of-pleasure]
emb|CDO97141.1|  unnamed protein product                                130   2e-31   Coffea canephora [robusta coffee]
ref|XP_010500494.1|  PREDICTED: upstream activation factor subuni...    129   3e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010419877.1|  PREDICTED: uncharacterized protein LOC104705555    129   6e-31   
ref|XP_006852954.1|  hypothetical protein AMTR_s00033p00241730          125   9e-31   
ref|XP_010479385.1|  PREDICTED: upstream activation factor subuni...    127   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010479386.1|  PREDICTED: protein TRI1-like isoform X2            127   1e-30   Camelina sativa [gold-of-pleasure]
ref|NP_175375.2|  SWIB complex BAF60b domain-containing protein         126   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AAD43149.1|AC007504_4  Hypothetical Protein                          126   3e-30   Arabidopsis thaliana [mouse-ear cress]
gb|ABK26533.1|  unknown                                                 124   3e-30   Picea sitchensis
ref|XP_002985006.1|  hypothetical protein SELMODRAFT_121478             123   1e-29   
ref|XP_006303686.1|  hypothetical protein CARUB_v10011771mg             123   2e-29   Capsella rubella
ref|XP_006297542.1|  hypothetical protein CARUB_v10013568mg             123   4e-29   
ref|XP_006480142.1|  PREDICTED: upstream activation factor subuni...    122   7e-29   Citrus sinensis [apfelsine]
ref|XP_010489932.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    122   1e-28   
ref|XP_006423075.1|  hypothetical protein CICLE_v10028659mg             121   1e-28   
ref|XP_003635018.1|  PREDICTED: uncharacterized protein LOC100853436    120   2e-28   Vitis vinifera
ref|XP_006480141.1|  PREDICTED: upstream activation factor subuni...    121   2e-28   
ref|XP_008806342.1|  PREDICTED: uncharacterized protein LOC103719054    120   2e-28   Phoenix dactylifera
ref|XP_003574734.1|  PREDICTED: mediator of RNA polymerase II tra...    121   2e-28   Brachypodium distachyon [annual false brome]
gb|ABK24867.1|  unknown                                                 119   2e-28   Picea sitchensis
ref|XP_010439338.1|  PREDICTED: uncharacterized protein LOC104722801    120   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010434052.1|  PREDICTED: uncharacterized protein LOC104718075    120   3e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010448893.1|  PREDICTED: uncharacterized protein LOC104731266    120   4e-28   Camelina sativa [gold-of-pleasure]
ref|NP_001062171.1|  Os08g0502800                                       120   5e-28   
ref|XP_010928509.1|  PREDICTED: uncharacterized protein LOC105050254    119   7e-28   Elaeis guineensis
ref|XP_002278125.1|  PREDICTED: uncharacterized protein LOC100267408    119   7e-28   Vitis vinifera
ref|XP_006406538.1|  hypothetical protein EUTSA_v10020944mg             118   1e-27   
ref|XP_006660252.1|  PREDICTED: uncharacterized protein LOC102711373    118   2e-27   
ref|XP_010539556.1|  PREDICTED: uncharacterized protein LOC104813595    118   2e-27   Tarenaya hassleriana [spider flower]
ref|XP_010913182.1|  PREDICTED: uncharacterized protein LOC105038...    117   4e-27   Elaeis guineensis
ref|XP_010913181.1|  PREDICTED: uncharacterized protein LOC105038...    117   5e-27   Elaeis guineensis
ref|XP_006449863.1|  hypothetical protein CICLE_v10015752mg             116   5e-27   Citrus clementina [clementine]
ref|XP_010529474.1|  PREDICTED: uncharacterized protein LOC104806331    117   6e-27   Tarenaya hassleriana [spider flower]
ref|XP_008792594.1|  PREDICTED: upstream activation factor subuni...    114   1e-26   Phoenix dactylifera
ref|XP_008792593.1|  PREDICTED: upstream activation factor subuni...    114   1e-26   Phoenix dactylifera
ref|XP_002445921.1|  hypothetical protein SORBIDRAFT_07g028070          116   1e-26   
ref|XP_006467332.1|  PREDICTED: alpha/beta-gliadin A-III-like iso...    114   3e-26   Citrus sinensis [apfelsine]
ref|XP_010538758.1|  PREDICTED: uncharacterized protein LOC104812994    114   3e-26   Tarenaya hassleriana [spider flower]
ref|XP_004973841.1|  PREDICTED: centrosomal and chromosomal facto...    115   4e-26   Setaria italica
ref|XP_004973842.1|  PREDICTED: centrosomal and chromosomal facto...    114   4e-26   Setaria italica
gb|KDO35066.1|  hypothetical protein SPRG_01130                         114   5e-26   Saprolegnia parasitica CBS 223.65
ref|XP_010252656.1|  PREDICTED: formin-G                                114   5e-26   Nelumbo nucifera [Indian lotus]
gb|KDP26953.1|  hypothetical protein JCGZ_22250                         113   9e-26   Jatropha curcas
ref|XP_008604916.1|  hypothetical protein SDRG_01178                    113   1e-25   Saprolegnia diclina VS20
ref|XP_006352354.1|  PREDICTED: uncharacterized protein LOC102595561    113   1e-25   Solanum tuberosum [potatoes]
gb|EMT17610.1|  Upstream activation factor subunit UAF30                113   1e-25   
ref|XP_010270124.1|  PREDICTED: uncharacterized protein LOC104606552    112   2e-25   Nelumbo nucifera [Indian lotus]
ref|XP_006283894.1|  hypothetical protein CARUB_v10005012mg             112   2e-25   Capsella rubella
emb|CDX98747.1|  BnaA03g45320D                                          112   2e-25   
ref|XP_009137258.1|  PREDICTED: formin-like protein 4                   112   2e-25   Brassica rapa
gb|AFW65191.1|  hypothetical protein ZEAMMB73_350137                    115   2e-25   
ref|XP_002520558.1|  brg-1 associated factor, putative                  112   3e-25   Ricinus communis
ref|XP_011095959.1|  PREDICTED: uncharacterized protein LOC105175270    111   3e-25   Sesamum indicum [beniseed]
ref|XP_011095484.1|  PREDICTED: uncharacterized protein LOC105174926    111   3e-25   Sesamum indicum [beniseed]
ref|XP_002869827.1|  hypothetical protein ARALYDRAFT_492627             112   3e-25   
ref|XP_010042645.1|  PREDICTED: uncharacterized protein LOC104431786    109   4e-25   Eucalyptus grandis [rose gum]
emb|CDY27449.1|  BnaC03g64890D                                          110   5e-25   Brassica napus [oilseed rape]
ref|XP_010448899.1|  PREDICTED: SWI/SNF-related matrix-associated...    108   7e-25   
gb|ACN26234.1|  unknown                                                 104   7e-25   Zea mays [maize]
ref|NP_567661.1|  SWIB complex BAF60b domain-containing protein         110   8e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009770617.1|  PREDICTED: uncharacterized protein LOC104221287    110   8e-25   Nicotiana sylvestris
emb|CAN72895.1|  hypothetical protein VITISV_022315                     110   8e-25   Vitis vinifera
ref|XP_009411861.1|  PREDICTED: formin-like protein 18                  110   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAM61516.1|  unknown                                                 110   9e-25   Arabidopsis thaliana [mouse-ear cress]
emb|CDP13762.1|  unnamed protein product                                110   1e-24   Coffea canephora [robusta coffee]
gb|EYU27400.1|  hypothetical protein MIMGU_mgv1a008947mg                109   2e-24   Erythranthe guttata [common monkey flower]
gb|EEC83834.1|  hypothetical protein OsI_29784                          109   2e-24   Oryza sativa Indica Group [Indian rice]
gb|EEE68957.1|  hypothetical protein OsJ_27851                          109   2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006413663.1|  hypothetical protein EUTSA_v10025487mg             109   3e-24   Eutrema salsugineum [saltwater cress]
gb|EYU27702.1|  hypothetical protein MIMGU_mgv1a010230mg                108   3e-24   Erythranthe guttata [common monkey flower]
ref|XP_004150254.1|  PREDICTED: uncharacterized protein LOC101217066    108   4e-24   Cucumis sativus [cucumbers]
ref|XP_008447697.1|  PREDICTED: uncharacterized protein LOC103490111    108   4e-24   Cucumis melo [Oriental melon]
ref|XP_004163283.1|  PREDICTED: uncharacterized LOC101217066            107   8e-24   
ref|XP_009623786.1|  PREDICTED: protein TRI1                            107   1e-23   Nicotiana tomentosiformis
gb|KHG15356.1|  Upstream activation factor subunit spp27                107   1e-23   Gossypium arboreum [tree cotton]
ref|XP_011097816.1|  PREDICTED: uncharacterized protein LOC105176645    107   1e-23   Sesamum indicum [beniseed]
gb|KJB68547.1|  hypothetical protein B456_010G249800                    107   1e-23   Gossypium raimondii
ref|XP_004293361.1|  PREDICTED: uncharacterized protein LOC101314347    107   1e-23   Fragaria vesca subsp. vesca
ref|XP_004250267.1|  PREDICTED: uncharacterized protein LOC101256830    107   1e-23   Solanum lycopersicum
gb|KJB68546.1|  hypothetical protein B456_010G249800                    107   1e-23   Gossypium raimondii
ref|XP_002979058.1|  hypothetical protein SELMODRAFT_418723             106   1e-23   Selaginella moellendorffii
emb|CDX94096.1|  BnaC07g37300D                                          107   2e-23   
ref|XP_002176898.1|  predicted protein                                  105   3e-23   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_009391890.1|  PREDICTED: uncharacterized protein LOC103977949    105   3e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002288942.1|  predicted protein                                  105   5e-23   Thalassiosira pseudonana CCMP1335
ref|XP_007146548.1|  hypothetical protein PHAVU_006G049900g             104   1e-22   Phaseolus vulgaris [French bean]
ref|XP_007026264.1|  SWIB complex BAF60b domain-containing protei...    104   1e-22   
ref|XP_008366453.1|  PREDICTED: uncharacterized protein LOC103430100    102   1e-22   
ref|XP_008798760.1|  PREDICTED: formin-like protein 18                  103   2e-22   Phoenix dactylifera
ref|XP_003600192.1|  Upstream activation factor subunit UAF30           103   2e-22   
ref|XP_008384272.1|  PREDICTED: upstream activation factor subuni...    101   2e-22   
ref|XP_009339387.1|  PREDICTED: uncharacterized protein LOC103931595    103   3e-22   Pyrus x bretschneideri [bai li]
ref|XP_009335440.1|  PREDICTED: uncharacterized protein LOC103928154    103   3e-22   
ref|XP_009361076.1|  PREDICTED: upstream activation factor subuni...    102   4e-22   Pyrus x bretschneideri [bai li]
ref|XP_002991531.1|  hypothetical protein SELMODRAFT_429825             102   4e-22   Selaginella moellendorffii
ref|XP_007154015.1|  hypothetical protein PHAVU_003G083900g             102   5e-22   Phaseolus vulgaris [French bean]
ref|XP_009348467.1|  PREDICTED: upstream activation factor subuni...    102   6e-22   Pyrus x bretschneideri [bai li]
gb|EPS66203.1|  hypothetical protein M569_08575                         100   6e-22   Genlisea aurea
gb|AEV40987.1|  SWIB/MDM2 domain-containing protein                     102   6e-22   Oryza minuta
gb|AEV40937.1|  SWIB/MDM2 domain-containing protein                     102   6e-22   Oryza punctata
gb|ABK94708.1|  unknown                                                 102   7e-22   Populus trichocarpa [western balsam poplar]
ref|XP_008385810.1|  PREDICTED: formin-like protein 13                  102   7e-22   
gb|AES70443.2|  SWIB/MDM2 domain protein                                102   7e-22   Medicago truncatula
ref|XP_008355916.1|  PREDICTED: uncharacterized protein LOC103419593    102   9e-22   
ref|XP_002275854.1|  PREDICTED: uncharacterized protein LOC100264067    101   9e-22   Vitis vinifera
ref|XP_011008625.1|  PREDICTED: uncharacterized protein LOC105113...    102   9e-22   Populus euphratica
ref|XP_002308782.2|  hypothetical protein POPTR_0006s01230g             102   9e-22   
gb|KHN03519.1|  Upstream activation factor subunit UAF30                101   9e-22   Glycine soja [wild soybean]
ref|XP_003549577.1|  PREDICTED: uncharacterized protein LOC100804281    101   9e-22   Glycine max [soybeans]
ref|XP_011008623.1|  PREDICTED: uncharacterized protein LOC105113...    102   9e-22   Populus euphratica
ref|XP_008371009.1|  PREDICTED: uncharacterized protein LOC103434436    101   1e-21   
ref|XP_008358815.1|  PREDICTED: uncharacterized protein LOC103422526    101   1e-21   
ref|XP_006652975.1|  PREDICTED: uncharacterized protein LOC102702652    101   1e-21   
ref|XP_003532156.1|  PREDICTED: uncharacterized protein LOC100801960    100   2e-21   Glycine max [soybeans]
ref|XP_009793151.1|  PREDICTED: uncharacterized protein LOC104240060    100   2e-21   Nicotiana sylvestris
ref|XP_003529660.1|  PREDICTED: uncharacterized protein LOC100788173    100   2e-21   Glycine max [soybeans]
ref|XP_006373623.1|  hypothetical protein POPTR_0016s01500g             100   2e-21   
gb|EAZ32320.1|  hypothetical protein OsJ_16531                          100   3e-21   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054177.1|  Os04g0665500                                       100   3e-21   
ref|XP_010090987.1|  Upstream activation factor subunit spp27           101   3e-21   
ref|XP_009626078.1|  PREDICTED: uncharacterized protein LOC104116838    100   4e-21   Nicotiana tomentosiformis
ref|XP_009838176.1|  hypothetical protein H257_12602                  99.8    4e-21   Aphanomyces astaci
ref|XP_011400995.1|  Upstream activation factor subunit spp27         99.4    4e-21   Auxenochlorella protothecoides
ref|XP_008345803.1|  PREDICTED: uncharacterized protein LOC103408756  99.8    4e-21   
gb|EYU33684.1|  hypothetical protein MIMGU_mgv1a009014mg              99.8    5e-21   Erythranthe guttata [common monkey flower]
ref|XP_004960201.1|  PREDICTED: protein bassoon-like                    100   5e-21   Setaria italica
ref|XP_008782909.1|  PREDICTED: formin-like protein 18                99.8    5e-21   Phoenix dactylifera
ref|XP_010928869.1|  PREDICTED: formin-like protein 18                99.8    5e-21   Elaeis guineensis
ref|XP_009357601.1|  PREDICTED: uncharacterized protein LOC103948320  99.0    6e-21   
ref|XP_008897102.1|  hypothetical protein PPTG_05335                  99.4    6e-21   Phytophthora parasitica INRA-310
gb|EEC78199.1|  hypothetical protein OsI_17819                        99.8    7e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_008867795.1|  hypothetical protein H310_04980                  99.0    7e-21   Aphanomyces invadans
emb|CDX79150.1|  BnaA01g12170D                                        99.0    8e-21   
gb|ACG35017.1|  SWIB/MDM2 domain containing protein                   99.0    1e-20   Zea mays [maize]
gb|KCW66882.1|  hypothetical protein EUGRSUZ_F00636                   95.9    1e-20   Eucalyptus grandis [rose gum]
ref|XP_011000993.1|  PREDICTED: uncharacterized protein LOC105108...  99.0    1e-20   Populus euphratica
ref|XP_011000995.1|  PREDICTED: uncharacterized protein LOC105108...  99.0    1e-20   Populus euphratica
gb|KJB69188.1|  hypothetical protein B456_011G009800                  98.2    2e-20   Gossypium raimondii
ref|XP_004500124.1|  PREDICTED: uncharacterized protein LOC101504815  98.2    2e-20   Cicer arietinum [garbanzo]
ref|XP_007047161.1|  SWIB complex BAF60b domain-containing protei...  97.1    2e-20   
ref|XP_002447280.1|  hypothetical protein SORBIDRAFT_06g031960        98.2    2e-20   
ref|XP_002307875.2|  SWIB complex BAF60b domain-containing family...  98.2    2e-20   
ref|XP_010064304.1|  PREDICTED: uncharacterized protein LOC104451305  97.4    3e-20   
ref|XP_008668741.1|  PREDICTED: uncharacterized protein LOC103645800  97.8    3e-20   
gb|ACU23275.1|  unknown                                               97.1    4e-20   
emb|CCA21358.1|  conserved hypothetical protein                       96.7    5e-20   
ref|XP_007211527.1|  hypothetical protein PRUPE_ppa008138mg           96.7    5e-20   
ref|XP_009364688.1|  PREDICTED: uncharacterized protein LOC103954575  96.7    7e-20   
ref|XP_009364677.1|  PREDICTED: uncharacterized protein LOC103954562  96.7    7e-20   
ref|XP_006680223.1|  hypothetical protein BATDEDRAFT_89688            95.9    8e-20   
ref|XP_002986194.1|  hypothetical protein SELMODRAFT_123621           90.9    1e-19   
ref|XP_008227057.1|  PREDICTED: upstream activation factor subuni...  95.5    2e-19   
ref|XP_008227478.1|  PREDICTED: RNA-binding protein 33                95.5    2e-19   
ref|XP_009353301.1|  PREDICTED: alpha/beta-gliadin A-III-like         95.1    2e-19   
ref|XP_010240569.1|  PREDICTED: uncharacterized protein LOC100831700  95.1    2e-19   
gb|EWM25482.1|  swib mdm2 domain containing protein                   94.7    3e-19   
ref|XP_007211482.1|  hypothetical protein PRUPE_ppa007617mg           94.7    3e-19   
ref|XP_009518024.1|  hypothetical protein PHYSODRAFT_475850           94.7    3e-19   
ref|XP_007720699.1|  hypothetical protein A1O1_01596                  94.0    3e-19   
gb|EPS58295.1|  hypothetical protein M569_16523                       93.6    6e-19   
ref|XP_001702451.1|  SWIB domain-containing protein 1                 92.8    9e-19   
emb|CDX76378.1|  BnaA08g10220D                                        93.2    9e-19   
ref|XP_009135888.1|  PREDICTED: uncharacterized protein LOC103860027  92.4    2e-18   
ref|XP_002566120.1|  Pc22g22250                                       91.7    2e-18   
ref|XP_008661410.1|  PREDICTED: uncharacterized protein LOC100193...  92.0    2e-18   
ref|XP_009152283.1|  hypothetical protein HMPREF1120_00049            91.3    2e-18   
ref|NP_001131941.2|  uncharacterized protein LOC100193333             92.0    3e-18   
tpg|DAA51566.1|  TPA: hypothetical protein ZEAMMB73_058775            85.9    5e-18   
ref|XP_002955658.1|  hypothetical protein VOLCADRAFT_106876           89.4    1e-17   
emb|CCI50144.1|  unnamed protein product                              89.7    1e-17   
emb|CCI50145.1|  unnamed protein product                              89.7    1e-17   
ref|XP_008722847.1|  hypothetical protein G647_01224                  88.2    3e-17   
ref|XP_002907507.1|  conserved hypothetical protein                   88.6    4e-17   
gb|ENH78559.1|  swib mdm2 domain protein                              87.4    5e-17   
emb|CDM27437.1|  SWIB/MDM2 domain                                     87.4    5e-17   
gb|EPS57960.1|  hypothetical protein M569_16857                       86.3    6e-17   
gb|KIW84564.1|  hypothetical protein Z517_03814                       87.4    6e-17   
gb|KGO46833.1|  DEK, C-terminal                                       86.7    9e-17   
gb|KGO77741.1|  DEK, C-terminal                                       86.7    1e-16   
gb|EMS52106.1|  Upstream activation factor subunit UAF30              83.2    1e-16   
gb|EQL31132.1|  hypothetical protein BDFG_06445                       86.7    1e-16   
ref|XP_002626264.1|  SWIB/MDM2 domain-containing protein              86.7    1e-16   
ref|XP_009853554.1|  hypothetical protein NEUTE1DRAFT_131437          86.3    1e-16   
ref|XP_959523.1|  SWIB/MDM2 domain-containing protein                 86.3    1e-16   
gb|EKV09807.1|  hypothetical protein PDIP_63010                       86.3    1e-16   
gb|KIK22342.1|  hypothetical protein PISMIDRAFT_505499                85.9    2e-16   
ref|XP_007736761.1|  hypothetical protein A1O3_08473                  85.9    2e-16   
ref|XP_010675851.1|  PREDICTED: wiskott-Aldrich syndrome protein ...  86.7    2e-16   
gb|ESA19797.1|  hypothetical protein GLOINDRAFT_133123                86.7    2e-16   
gb|KFX51692.1|  Upstream activation factor subunit spp27              85.5    2e-16   
emb|CCC09614.1|  unnamed protein product                              85.5    3e-16   
ref|XP_007753393.1|  hypothetical protein A1O7_01164                  85.5    3e-16   
dbj|GAM43293.1|  SWIB/MDM2 domain protein                             85.5    3e-16   
gb|EME39146.1|  hypothetical protein DOTSEDRAFT_28327                 85.5    3e-16   
gb|KEF52069.1|  hypothetical protein A1O9_12059                       84.7    4e-16   
ref|XP_006856838.1|  hypothetical protein AMTR_s00055p00180320        84.7    4e-16   
gb|EMF09869.1|  SWIB-domain-containing protein                        84.7    5e-16   
ref|XP_005709165.1|  hypothetical protein Gasu_00170                  84.3    6e-16   
gb|KIW72639.1|  hypothetical protein PV04_00819                       84.3    6e-16   
gb|KIW30635.1|  hypothetical protein PV07_06363                       84.3    6e-16   
emb|CEF86758.1|  unnamed protein product                              84.0    6e-16   
ref|XP_007274591.1|  swib mdm2 domain protein                         84.0    7e-16   
ref|XP_007750620.1|  hypothetical protein A1O5_11860                  84.0    7e-16   
gb|KIW96573.1|  hypothetical protein Z519_01964                       84.0    7e-16   
ref|XP_011324362.1|  hypothetical protein FGSG_12808                  84.0    7e-16   
gb|KEQ83973.1|  SWIB-domain-containing protein                        84.0    8e-16   
ref|XP_009255897.1|  hypothetical protein FPSE_04504                  84.0    8e-16   
gb|EPS29571.1|  hypothetical protein PDE_04521                        83.6    9e-16   
gb|ACO12370.1|  YMR233W                                               83.2    1e-15   
ref|XP_002482714.1|  SWIB/MDM2 domain protein                         83.6    1e-15   
gb|EWG44839.1|  hypothetical protein FVEG_05817                       83.2    1e-15   
gb|KIV94557.1|  hypothetical protein PV10_02312                       83.2    2e-15   
ref|XP_007847070.1|  swib mdm2 domain protein                         82.8    2e-15   
ref|NP_588345.1|  RNA polymerase I upstream activation factor com...  82.4    2e-15   
gb|AAL34119.1|AC090713_6  putative parathymosin                       82.8    2e-15   
gb|EGU86688.1|  hypothetical protein FOXB_02794                       82.4    2e-15   
ref|XP_002585358.1|  conserved hypothetical protein                   82.4    3e-15   
ref|XP_007003955.1|  hypothetical protein TREMEDRAFT_38764            82.8    3e-15   
gb|EPY51368.1|  RNA polymerase I upstream activation factor compl...  82.0    3e-15   
gb|EYU27179.1|  hypothetical protein MIMGU_mgv1a016089mg              79.7    3e-15   
ref|XP_010275139.1|  PREDICTED: upstream activation factor subuni...  79.3    4e-15   
gb|KIW50752.1|  hypothetical protein PV05_09540                       81.6    4e-15   
ref|XP_008719338.1|  hypothetical protein HMPREF1541_06787            82.0    4e-15   
gb|KIL93041.1|  hypothetical protein FAVG1_04222                      81.6    4e-15   
gb|EKC98869.1|  hypothetical protein A1Q2_06840                       80.9    6e-15   
gb|EGC49170.1|  SWIB/MDM2 domain-containing protein                   81.3    6e-15   
ref|XP_001265449.1|  SWIB/MDM2 domain protein                         81.3    6e-15   
ref|XP_007787582.1|  hypothetical protein EPUS_04835                  81.3    6e-15   
ref|XP_003064172.1|  high mobility group family B protein             81.3    6e-15   
gb|KEQ91034.1|  hypothetical protein AUEXF2481DRAFT_8835              81.3    7e-15   
ref|XP_001904978.1|  hypothetical protein                             80.9    7e-15   
gb|EJT49862.1|  hypothetical protein A1Q1_01014                       80.9    7e-15   
gb|EIE91885.1|  hypothetical protein RO3G_16596                       79.3    8e-15   
gb|KIX00154.1|  hypothetical protein Z518_10291                       81.3    8e-15   
ref|XP_002173939.2|  RNA polymerase I upstream activation factor ...  80.9    8e-15   
ref|XP_776513.1|  hypothetical protein CNBC4390                       80.5    9e-15   
ref|XP_002148429.1|  C2H2 finger domain protein, putative             84.0    9e-15   
ref|XP_569575.1|  hypothetical protein                                80.5    1e-14   
gb|EDP55545.1|  SWIB/MDM2 domain protein                              80.9    1e-14   
ref|XP_749952.2|  SWIB/MDM2 domain protein                            80.9    1e-14   
emb|CCT65051.1|  probable UAF30-subunit of RNA polymerase I trans...  80.5    1e-14   
emb|CAA16786.1|  putative protein                                     81.6    1e-14   
ref|XP_001389048.2|  SWIB/MDM2 domain protein                         80.5    1e-14   
emb|CDY53042.1|  BnaC03g73910D                                        79.0    1e-14   
ref|XP_001214067.1|  conserved hypothetical protein                   83.6    1e-14   
emb|CAK37099.1|  unnamed protein product                              80.5    1e-14   
ref|XP_003654228.1|  hypothetical protein THITE_2117056               80.5    1e-14   
ref|XP_003850719.1|  hypothetical protein MYCGRDRAFT_100770           80.9    1e-14   
ref|XP_007928856.1|  hypothetical protein MYCFIDRAFT_56639            80.5    1e-14   
gb|ENH66657.1|  Upstream activation factor subunit spp27              80.1    1e-14   
ref|XP_002313088.2|  hypothetical protein POPTR_0009s10990g           79.7    2e-14   
ref|XP_001269940.1|  SWIB/MDM2 domain protein                         80.1    2e-14   
gb|KDQ19962.1|  hypothetical protein BOTBODRAFT_51325                 80.1    2e-14   
ref|WP_028357728.1|  hypothetical protein                             76.6    2e-14   
ref|XP_009130373.1|  PREDICTED: protein TRI1                          78.2    2e-14   
gb|EPX73721.1|  RNA polymerase I upstream activation factor compl...  79.7    2e-14   
gb|KIV78456.1|  hypothetical protein PV11_10175                       79.7    2e-14   
ref|XP_003665329.1|  hypothetical protein MYCTH_2308924               79.7    2e-14   
ref|XP_010549735.1|  PREDICTED: protein TRI1                          77.8    2e-14   
ref|XP_005716867.1|  unnamed protein product                          80.1    2e-14   
gb|KIX93318.1|  hypothetical protein Z520_10961                       82.8    2e-14   
dbj|GAD93942.1|  SWIB/MDM2 domain protein                             79.7    2e-14   
gb|KDN71176.1|  putative DEK C terminal domain-containing protein     79.3    2e-14   
gb|EFW13318.1|  hypothetical protein CPSG_10065                       79.3    3e-14   
ref|XP_007591595.1|  DEK C terminal domain-containing protein         80.9    3e-14   
emb|CCF34198.1|  DEK C terminal domain-containing protein             79.3    3e-14   
ref|XP_002508564.1|  animal specific-mbd4, 5 and 6                    79.3    3e-14   
ref|XP_006408288.1|  hypothetical protein EUTSA_v10021710mg           77.4    3e-14   
emb|CDY50651.1|  BnaC05g48150D                                        77.4    3e-14   
ref|XP_010099977.1|  Upstream activation factor subunit spp27         80.9    3e-14   
gb|EGE01453.1|  SWIB/MDM2 domain-containing protein                   79.3    3e-14   
ref|XP_003071966.1|  SWIB/MDM2 domain containing protein              78.6    3e-14   
ref|XP_002373059.1|  SWIB/MDM2 domain protein                         79.3    3e-14   
dbj|BAE55899.1|  unnamed protein product                              79.0    4e-14   
gb|EGE00567.1|  hypothetical protein TESG_07838                       79.0    4e-14   
gb|KDO49154.1|  hypothetical protein CISIN_1g0161772mg                75.9    4e-14   
ref|XP_003708728.1|  hypothetical protein MGG_01988                   79.0    4e-14   
gb|KEH33952.1|  SWIB/MDM2 domain protein                              79.3    4e-14   
gb|KDO49158.1|  hypothetical protein CISIN_1g0161771mg                79.0    4e-14   
emb|CDS07643.1|  hypothetical protein LRAMOSA01592                    80.9    4e-14   
gb|KJB69189.1|  hypothetical protein B456_011G009800                  79.3    4e-14   
gb|EZG09214.1|  hypothetical protein H106_01751                       78.6    5e-14   
ref|XP_003232670.1|  SWIB/MDM2 domain-containing protein              78.6    5e-14   
emb|CDH59650.1|  hypothetical protein RO3G_16596                      80.5    5e-14   
gb|KDO49153.1|  hypothetical protein CISIN_1g0161772mg                75.1    5e-14   
ref|XP_006437339.1|  hypothetical protein CICLE_v10033040mg           76.3    6e-14   
ref|XP_003351341.1|  hypothetical protein SMAC_03646                  78.2    6e-14   
emb|CEP17977.1|  hypothetical protein                                 80.5    6e-14   
emb|CCX32309.1|  Similar to Upstream activation factor subunit sp...  79.7    6e-14   
gb|EPZ36176.1|  SWIB/MDM2 domain-containing protein                   77.8    7e-14   
gb|EYU37715.1|  hypothetical protein MIMGU_mgv1a011940mg              78.2    7e-14   
ref|XP_001947263.3|  PREDICTED: LOW QUALITY PROTEIN: nucleolin-like   78.2    7e-14   
ref|XP_657964.1|  hypothetical protein AN0360.2                       78.2    7e-14   
ref|XP_007026266.1|  SWIB complex BAF60b domain-containing protei...  78.2    8e-14   
gb|KDO72266.1|  hypothetical protein CISIN_1g048564mg                 75.5    8e-14   
emb|CDS07389.1|  hypothetical protein LRAMOSA01338                    79.0    9e-14   
ref|XP_006430903.1|  hypothetical protein CICLE_v10013159mg           75.1    1e-13   
ref|XP_009782755.1|  PREDICTED: upstream activation factor subuni...  75.5    1e-13   
ref|XP_007793512.1|  putative swib mdm2 domain protein                77.8    1e-13   
gb|KFH41954.1|  Upstream activation factor subunit-like protein       77.8    1e-13   
ref|XP_001226234.1|  hypothetical protein CHGG_10967                  77.8    1e-13   
gb|KIR67840.1|  upstream activation factor subunit UAF30              77.4    1e-13   
gb|KIR43577.1|  upstream activation factor subunit UAF30              77.4    1e-13   
ref|XP_001238943.1|  hypothetical protein CIMG_09965                  77.4    1e-13   
emb|CDH60546.1|  hypothetical protein RO3G_16596                      79.0    1e-13   
emb|CDH60547.1|  hypothetical protein RO3G_16596                      79.0    1e-13   
gb|KGB77480.1|  upstream activation factor subunit UAF30              77.0    1e-13   
ref|XP_002270166.1|  PREDICTED: upstream activation factor subuni...  75.1    1e-13   
ref|XP_004173941.1|  PREDICTED: uncharacterized protein LOC101232239  76.6    1e-13   
emb|CDY51761.1|  BnaA05g32850D                                        75.1    1e-13   
gb|KIR87135.1|  upstream activation factor subunit UAF30              77.0    1e-13   
gb|KIR56397.1|  upstream activation factor subunit UAF30              77.0    1e-13   
ref|XP_003192826.1|  hypothetical protein CGB_C4270C                  77.0    1e-13   
gb|KIR49015.1|  upstream activation factor subunit UAF30              77.0    1e-13   
gb|KIK09293.1|  hypothetical protein K443DRAFT_671787                 77.0    2e-13   
ref|XP_009631043.1|  PREDICTED: uncharacterized protein LOC104120876  75.9    2e-13   
ref|XP_002083394.1|  GD13706                                          76.6    2e-13   
gb|EEH35038.2|  SWIB/MDM2 domain-containing protein                   77.4    2e-13   
ref|XP_003171996.1|  hypothetical protein MGYG_06538                  77.0    2e-13   
ref|WP_009873828.1|  hypothetical protein                             73.9    2e-13   
ref|XP_008085472.1|  SWIB/MDM2                                        77.0    2e-13   
tpg|DAA51565.1|  TPA: hypothetical protein ZEAMMB73_913346            77.0    2e-13   
ref|XP_002845613.1|  SWIB/MDM2 domain-containing protein              77.0    2e-13   
ref|WP_010231420.1|  hypothetical protein                             73.6    2e-13   
ref|NP_565810.1|  SWIB/MDM2 domain-containing protein                 74.3    2e-13   
ref|XP_006361226.1|  PREDICTED: upstream activation factor subuni...  74.3    2e-13   
gb|EEH16484.2|  hypothetical protein PABG_06571                       76.3    2e-13   
gb|EPB87672.1|  hypothetical protein HMPREF1544_05555                 77.4    2e-13   
ref|XP_007828881.1|  hypothetical protein PFICI_02109                 76.6    2e-13   
ref|XP_009625777.1|  PREDICTED: protein TRI1-like                     74.3    2e-13   
ref|XP_009114968.1|  PREDICTED: upstream activation factor subuni...  74.3    2e-13   
dbj|GAA83554.1|  C2H2 finger domain protein                           79.7    2e-13   
gb|KDO49157.1|  hypothetical protein CISIN_1g0161772mg                74.3    2e-13   
gb|KIP02283.1|  hypothetical protein PHLGIDRAFT_96142                 76.3    3e-13   
ref|XP_006690586.1|  hypothetical protein CTHT_0000310                76.3    3e-13   
ref|XP_009376300.1|  PREDICTED: upstream activation factor subuni...  74.7    3e-13   
ref|XP_002879559.1|  SWIB complex BAF60b domain-containing protein    73.9    3e-13   
gb|EPB89261.1|  hypothetical protein HMPREF1544_03885                 78.2    3e-13   
ref|XP_008354803.1|  PREDICTED: protein TRI1-like                     74.7    3e-13   
ref|XP_004246013.1|  PREDICTED: upstream activation factor subuni...  73.9    3e-13   
ref|XP_010097671.1|  Upstream activation factor subunit spp27         73.9    3e-13   
ref|XP_006482358.1|  PREDICTED: protein TRI1-like                     73.6    3e-13   
ref|NP_001045781.1|  Os02g0130000                                     73.9    4e-13   
ref|XP_010763289.1|  hypothetical protein PADG_08032                  76.3    4e-13   
ref|XP_001766284.1|  predicted protein                                73.6    4e-13   
ref|WP_015505706.1|  DNA topoisomerase I/SWI domain fusion protein    72.8    4e-13   
gb|KEQ70660.1|  SWIB-domain-containing protein                        75.9    4e-13   
gb|EMS66228.1|  Upstream activation factor subunit spp27              74.7    4e-13   
gb|KIW03310.1|  hypothetical protein PV09_05521                       76.3    4e-13   
gb|EMT28399.1|  hypothetical protein F775_30150                       74.7    4e-13   
gb|ADE77352.1|  unknown                                               73.6    4e-13   
gb|EIE83871.1|  hypothetical protein RO3G_08576                       75.9    4e-13   
emb|CCO35471.1|  Upstream activation factor subunit spp27 AltName...  75.9    5e-13   
ref|WP_035406695.1|  hypothetical protein                             72.4    5e-13   
gb|KEQ63236.1|  SWIB-domain-containing protein                        75.9    5e-13   
ref|WP_009459783.1|  MULTISPECIES: hypothetical protein               72.4    5e-13   
ref|XP_009037641.1|  hypothetical protein AURANDRAFT_64768            76.6    5e-13   
gb|KJB43614.1|  hypothetical protein B456_007G210300                  75.5    5e-13   
dbj|GAN02946.1|  hypothetical protein MAM1_0031d02396                 76.3    6e-13   
ref|WP_009872676.1|  hypothetical protein                             72.0    7e-13   



>ref|XP_009774097.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nicotiana sylvestris]
Length=320

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 144/176 (82%), Gaps = 11/176 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ LSKHIWPI++ED + VKS+ K+R
Sbjct  153  REKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHIWPIDEEDASQVKSSVKKR  212

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K+GR+E           EPKQ+EKR    KGGG+GFLAP++LSD+LVKFFG GENAL+
Sbjct  213  LPKQGREEALD--------EPKQKEKRH---KGGGSGFLAPVRLSDALVKFFGIGENALT  261

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  262  RADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTAHFIK  317


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGT---GFLAPIQLSDSLVKFFGTGENALSRGD  350
            D    + ++++D   K++ +R   + G      GF  P  LS  L K    GE+ L R +
Sbjct  86   DSCSQEEENETDTGAKEKARRSEKMNGEAKKKGGFNKPCALSPQLQKL--VGESELGRPE  143

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            VVK++W YI+E  LQ+P NKR+++CD+ L E+    + + F M K+L+ H 
Sbjct  144  VVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHI  194



>ref|XP_004230795.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Solanum lycopersicum]
Length=333

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 145/176 (82%), Gaps = 11/176 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ LSKHIWP+ +E+ T VK++ K R
Sbjct  166  REKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVLSKHIWPLNEENGTQVKTSVKRR  225

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KKGR+E       DSD EPKQ+EKRQ   KGGG+GFLAP+QLSD+LVKF G  ENAL 
Sbjct  226  LPKKGREE-------DSD-EPKQKEKRQ---KGGGSGFLAPVQLSDALVKFLGIDENALP  274

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  275  RADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTAHFIK  330


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 7/113 (6%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGT-----GFLAPIQLSDSLVKFFGTGENALSR  356
            D    + +   D   K+ +K+ R  K  G      GF  P  LS  L K    GE  L R
Sbjct  97   DSCSQEEEEGEDDSAKRAKKKPRSEKMNGEAKKKGGFNKPCALSPQLQKL--VGEPELGR  154

Query  355  GDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             +VVK++W YI+E  LQ+P NKR+++CD+ L  + +V S + F M K+L+ H 
Sbjct  155  PEVVKKIWAYIREKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVLSKHI  207



>ref|XP_009629953.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nicotiana tomentosiformis]
Length=321

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 143/176 (81%), Gaps = 11/176 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ LSKHIWPI++ED + VKS+ K+R
Sbjct  154  REKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHIWPIDEEDASQVKSSVKKR  213

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K+GR+E           EPKQ+EKRQ   K GG+GFLAP++LSD+LVKFFG GE AL+
Sbjct  214  LPKQGREEALD--------EPKQKEKRQ---KRGGSGFLAPVRLSDALVKFFGNGEKALT  262

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  263  RADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTAHFIK  318


 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGT---GFLAPIQLSDSLVKFFGTGENALSRGD  350
            D    + +++SD   K++  R   + G      GF  P  LS  L K    GE+ L R +
Sbjct  87   DSCSQEEENESDTGTKEKSHRSEKMNGEAKKKGGFNKPCALSPQLQKL--VGESELGRPE  144

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            VVK++W YI+E  LQ+P NKR+++CD+ L E+    + + F M K+L+ H 
Sbjct  145  VVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHI  195



>ref|XP_006346438.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Solanum tuberosum]
Length=336

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 142/176 (81%), Gaps = 11/176 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ LSKHIWP+ +E+ T VK++ K R
Sbjct  169  REKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVLSKHIWPLNEENGTQVKTSVKRR  228

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KKGR+E           EPKQ+EKRQ   KGGG GFLAP+QLSD+LVKF G GENAL 
Sbjct  229  LPKKGREEALD--------EPKQKEKRQ---KGGGFGFLAPVQLSDALVKFLGIGENALP  277

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  278  RADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTAHFIK  333


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 48/78 (62%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF  P  LS  L K    GE  L R +VVK++W YI+E  LQ+P NKR+++CD+ L  + 
Sbjct  135  GFNKPCALSPQLQKL--VGEPELGRPEVVKKIWAYIREKNLQNPENKRKILCDEVLSGIF  192

Query  250  EVDSFEGFTMTKLLTAHF  197
            +V S + F M K+L+ H 
Sbjct  193  QVKSIDMFQMNKVLSKHI  210



>ref|XP_006346439.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Solanum tuberosum]
Length=335

 Score =   234 bits (598),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 142/176 (81%), Gaps = 11/176 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ LSKHIWP+ +E+ T VK++ K R
Sbjct  168  REKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVLSKHIWPLNEENGTQVKTSVKRR  227

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KKGR+E           EPKQ+EKRQ   KGGG GFLAP+QLSD+LVKF G GENAL 
Sbjct  228  LPKKGREEALD--------EPKQKEKRQ---KGGGFGFLAPVQLSDALVKFLGIGENALP  276

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  277  RADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTAHFIK  332


 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 8/110 (7%)
 Frame = -2

Query  526  GRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDV  347
            G D+  T S   +  E    E +++G      GF  P  LS  L K    GE  L R +V
Sbjct  108  GEDKSATRSKKKARSEKMNGEAKKKG------GFNKPCALSPQLQKL--VGEPELGRPEV  159

Query  346  VKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            VK++W YI+E  LQ+P NKR+++CD+ L  + +V S + F M K+L+ H 
Sbjct  160  VKKIWAYIREKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVLSKHI  209



>gb|KHN42058.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=188

 Score =   228 bits (581),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 141/177 (80%), Gaps = 10/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  ++ IICDE L  +F V +I+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  20   REKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKALSKHIWPLDSDDVVQVKSTPKEK  79

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q+K+ RD+       DSD EPK++EKRQ+G  GG +GFLAP+QLSD+LV F GTGE+ L+
Sbjct  80   QKKQERDD-------DSD-EPKKKEKRQKG--GGKSGFLAPLQLSDALVNFLGTGESELA  129

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIK N LQDPS+KR++ICD+KL+EL +VD+F GFT+TKLL  HFIKT
Sbjct  130  RTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDVDTFTGFTVTKLLAPHFIKT  186


 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -2

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            G   ++R +VVK++W YI+E  LQDP+N+R +ICD++LR L  V+S   F M K L+ H 
Sbjct  2    GAPEMARTEVVKQLWAYIREKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKALSKHI  61



>ref|XP_010315240.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Solanum lycopersicum]
Length=331

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/176 (64%), Positives = 142/176 (81%), Gaps = 13/176 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQ+P+ K++I+CDE L GIF+VK+IDMF+MN+ LSKHIWP+ +E+ T VK++ K R
Sbjct  166  REKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVLSKHIWPLNEENGTQVKTSVKRR  225

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KKGR+E           EPKQ+EKRQ   KGGG+GFLAP+QLSD+LVKF G  ENAL 
Sbjct  226  LPKKGREED----------EPKQKEKRQ---KGGGSGFLAPVQLSDALVKFLGIDENALP  272

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTAHFIK
Sbjct  273  RADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTAHFIK  328


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 7/113 (6%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGT-----GFLAPIQLSDSLVKFFGTGENALSR  356
            D    + +   D   K+ +K+ R  K  G      GF  P  LS  L K    GE  L R
Sbjct  97   DSCSQEEEEGEDDSAKRAKKKPRSEKMNGEAKKKGGFNKPCALSPQLQKL--VGEPELGR  154

Query  355  GDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             +VVK++W YI+E  LQ+P NKR+++CD+ L  + +V S + F M K+L+ H 
Sbjct  155  PEVVKKIWAYIREKNLQNPENKRKILCDEVLSGIFQVKSIDMFQMNKVLSKHI  207



>ref|XP_009774096.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nicotiana sylvestris]
Length=327

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 144/184 (78%), Gaps = 19/184 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--------VTL  563
            RE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ LSKHIWPI++ED         + 
Sbjct  152  REKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHIWPIDEEDGSFPLTHAASQ  211

Query  562  VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFF  383
            VKS+ K+R  K+GR+E           EPKQ+EKR    KGGG+GFLAP++LSD+LVKFF
Sbjct  212  VKSSVKKRLPKQGREEALD--------EPKQKEKRH---KGGGSGFLAPVRLSDALVKFF  260

Query  382  GTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTA  203
            G GENAL+R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTA
Sbjct  261  GIGENALTRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTA  320

Query  202  HFIK  191
            HFIK
Sbjct  321  HFIK  324


 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = -2

Query  505  DSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKY  326
            ++++D+  + K   ++  G      GF  P  LS  L K    GE+ L R +VVK++W Y
Sbjct  93   ENETDTGAKEKARSEKMNGEAKKKGGFNKPCALSPQLQKL--VGESELGRPEVVKKIWAY  150

Query  325  IKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            I+E  LQ+P NKR+++CD+ L E+    + + F M K+L+ H 
Sbjct  151  IREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHI  193



>ref|XP_009774095.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nicotiana sylvestris]
Length=328

 Score =   231 bits (588),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 144/184 (78%), Gaps = 19/184 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--------VTL  563
            RE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ LSKHIWPI++ED         + 
Sbjct  153  REKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHIWPIDEEDGSFPLTHAASQ  212

Query  562  VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFF  383
            VKS+ K+R  K+GR+E           EPKQ+EKR    KGGG+GFLAP++LSD+LVKFF
Sbjct  213  VKSSVKKRLPKQGREEALD--------EPKQKEKRH---KGGGSGFLAPVRLSDALVKFF  261

Query  382  GTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTA  203
            G GENAL+R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTA
Sbjct  262  GIGENALTRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTA  321

Query  202  HFIK  191
            HFIK
Sbjct  322  HFIK  325


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGT---GFLAPIQLSDSLVKFFGTGENALSRGD  350
            D    + ++++D   K++ +R   + G      GF  P  LS  L K    GE+ L R +
Sbjct  86   DSCSQEEENETDTGAKEKARRSEKMNGEAKKKGGFNKPCALSPQLQKL--VGESELGRPE  143

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            VVK++W YI+E  LQ+P NKR+++CD+ L E+    + + F M K+L+ H 
Sbjct  144  VVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHI  194



>ref|XP_010255131.1| PREDICTED: upstream activation factor subunit spp27-like [Nelumbo 
nucifera]
Length=323

 Score =   229 bits (583),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 115/177 (65%), Positives = 140/177 (79%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  K+ IICDETL  +FRV +I+MF+MN+ LSKHIWP++ ED   VKST KE+
Sbjct  157  RENNLQDPNNKRNIICDETLRSLFRVDSINMFQMNKALSKHIWPLDTEDAP-VKSTQKEK  215

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q+K+ R E       D + EPKQ+EKRQ   KGG +GFLAP+ LSD+LVKF GTGE++LS
Sbjct  216  QQKQERKE-------DPN-EPKQKEKRQ---KGGNSGFLAPLPLSDALVKFLGTGESSLS  264

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R  VVKRMW+YIK+N LQDPS+KRR+ICD+KL+EL EVDSF GFT+ KLL  HFIKT
Sbjct  265  RAGVVKRMWEYIKQNNLQDPSDKRRIICDEKLKELFEVDSFHGFTVPKLLATHFIKT  321


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 54/88 (61%), Gaps = 8/88 (9%)
 Frame = -2

Query  460  RQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  281
            R+RG      GF    +LS  L KF G  E  ++R +VVK++W YI+EN LQDP+NKR +
Sbjct  119  RKRG------GFTKLCKLSPLLQKFVGVPE--MARTEVVKQLWAYIRENNLQDPNNKRNI  170

Query  280  ICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            ICD+ LR L  VDS   F M K L+ H 
Sbjct  171  ICDETLRSLFRVDSINMFQMNKALSKHI  198



>ref|XP_003517282.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
1 [Glycine max]
Length=337

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 140/177 (79%), Gaps = 10/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  ++ IICDE L  +F V +I+MF+MN+ LSKHIWP+E +DV  VKSTPKE+
Sbjct  169  REKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKALSKHIWPLESDDVVQVKSTPKEK  228

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q+K+ RD+       DSD E K++EKRQ+G  GG +GFLAP+QLSD+LV F GTGE+ L+
Sbjct  229  QKKQERDD-------DSD-EAKKKEKRQKG--GGKSGFLAPLQLSDALVNFLGTGESELA  278

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIK N LQDPS+KR++ICD+KL+EL +VDSF GFT+TKLL  HFIKT
Sbjct  279  RTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDVDSFTGFTVTKLLAPHFIKT  335


 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F    E  ++R +VVK++W YI+E  LQDP+N+R +ICD+
Sbjct  129  VKKRGGGFCKLCSLSPQLQEFMEAPE--MARTEVVKQLWVYIREKNLQDPNNRRNIICDE  186

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  V+S   F M K L+ H 
Sbjct  187  RLRSLFNVNSINMFQMNKALSKHI  210



>ref|XP_003537360.1| PREDICTED: upstream activation factor subunit spp27-like [Glycine 
max]
Length=346

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 141/177 (80%), Gaps = 10/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  ++ IICDE L  +F V +I+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  178  REKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKALSKHIWPLDSDDVVQVKSTPKEK  237

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q+K+ RD+       DSD EPK++EKRQ+G  GG +GFLAP+QLSD+LV F GTGE+ L+
Sbjct  238  QKKQERDD-------DSD-EPKKKEKRQKG--GGKSGFLAPLQLSDALVNFLGTGESELA  287

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIK N LQDPS+KR++ICD+KL+EL +VD+F GFT+TKLL  HFIKT
Sbjct  288  RTDVIKRMWDYIKGNNLQDPSDKRKIICDEKLKELFDVDTFTGFTVTKLLAPHFIKT  344


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  ++R +VVK++W YI+E  LQDP+N+R +ICD+
Sbjct  138  VKKRGGGFCKLCSLSPQLQEFMGAPE--MARTEVVKQLWAYIREKNLQDPNNRRNIICDE  195

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  V+S   F M K L+ H 
Sbjct  196  RLRSLFNVNSINMFQMNKALSKHI  219



>ref|XP_007156836.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
 gb|ESW28830.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
Length=341

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 138/177 (78%), Gaps = 10/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +E NLQDP   + IICDE L  +F V +I+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  172  KEKNLQDPSNGRNIICDERLRALFNVNSINMFQMNKVLSKHIWPLDSDDVVQVKSTPKEK  231

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q+K  RD+       DSD EPK +EKRQ+G  GG +GFLAP+QLSD+LV F GTGE+ LS
Sbjct  232  QKKHERDD-------DSD-EPKGKEKRQKG--GGKSGFLAPLQLSDALVNFLGTGESELS  281

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIK N LQDPSNKR+++CD+KL+EL +VDSF GFT+TKLL  HFIKT
Sbjct  282  RTDVIKRMWDYIKGNNLQDPSNKRQILCDEKLKELFDVDSFNGFTVTKLLAPHFIKT  338


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  ++R +VVK++W YIKE  LQDPSN R +ICD+
Sbjct  132  VKKRGGGFCKLCSLSPQLQEFMGAPE--MARTEVVKQLWVYIKEKNLQDPSNGRNIICDE  189

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  V+S   F M K+L+ H 
Sbjct  190  RLRALFNVNSINMFQMNKVLSKHI  213



>ref|XP_007156837.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
 gb|ESW28831.1| hypothetical protein PHAVU_002G021500g [Phaseolus vulgaris]
Length=340

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 138/177 (78%), Gaps = 10/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +E NLQDP   + IICDE L  +F V +I+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  172  KEKNLQDPSNGRNIICDERLRALFNVNSINMFQMNKVLSKHIWPLDSDDVVQVKSTPKEK  231

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q+K  RD+       DSD EPK +EKRQ+G  GG +GFLAP+QLSD+LV F GTGE+ LS
Sbjct  232  QKKHERDD-------DSD-EPKGKEKRQKG--GGKSGFLAPLQLSDALVNFLGTGESELS  281

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIK N LQDPSNKR+++CD+KL+EL +VDSF GFT+TKLL  HFIKT
Sbjct  282  RTDVIKRMWDYIKGNNLQDPSNKRQILCDEKLKELFDVDSFNGFTVTKLLAPHFIKT  338


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  ++R +VVK++W YIKE  LQDPSN R +ICD+
Sbjct  132  VKKRGGGFCKLCSLSPQLQEFMGAPE--MARTEVVKQLWVYIKEKNLQDPSNGRNIICDE  189

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  V+S   F M K+L+ H 
Sbjct  190  RLRALFNVNSINMFQMNKVLSKHI  213



>ref|XP_009629952.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nicotiana tomentosiformis]
Length=328

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 143/184 (78%), Gaps = 19/184 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--------VTL  563
            RE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ LSKHIWPI++ED         + 
Sbjct  153  REKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHIWPIDEEDGSFSLTHPASQ  212

Query  562  VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFF  383
            VKS+ K+R  K+GR+E           EPKQ+EKRQ   K GG+GFLAP++LSD+LVKFF
Sbjct  213  VKSSVKKRLPKQGREEALD--------EPKQKEKRQ---KRGGSGFLAPVRLSDALVKFF  261

Query  382  GTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTA  203
            G GE AL+R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTA
Sbjct  262  GNGEKALTRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTA  321

Query  202  HFIK  191
            HFIK
Sbjct  322  HFIK  325


 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 60/103 (58%), Gaps = 2/103 (2%)
 Frame = -2

Query  505  DSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKY  326
            +++SD+  + K + ++  G      GF  P  LS  L K    GE+ L R +VVK++W Y
Sbjct  94   ENESDTGTKEKSQSEKMNGEAKKKGGFNKPCALSPQLQKL--VGESELGRPEVVKKIWAY  151

Query  325  IKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            I+E  LQ+P NKR+++CD+ L E+    + + F M K+L+ H 
Sbjct  152  IREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHI  194



>ref|XP_009629951.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nicotiana tomentosiformis]
Length=329

 Score =   227 bits (578),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 143/184 (78%), Gaps = 19/184 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--------VTL  563
            RE NLQ+P+ K++I+CDE L  IFR KTIDMF+MN+ LSKHIWPI++ED         + 
Sbjct  154  REKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHIWPIDEEDGSFSLTHPASQ  213

Query  562  VKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFF  383
            VKS+ K+R  K+GR+E           EPKQ+EKRQ   K GG+GFLAP++LSD+LVKFF
Sbjct  214  VKSSVKKRLPKQGREEALD--------EPKQKEKRQ---KRGGSGFLAPVRLSDALVKFF  262

Query  382  GTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTA  203
            G GE AL+R DV+KR+W+YIKENELQDPS+K+ +ICD++L+EL +VDSF GFT+TKLLTA
Sbjct  263  GNGEKALTRADVIKRIWQYIKENELQDPSDKKTIICDERLKELFQVDSFHGFTVTKLLTA  322

Query  202  HFIK  191
            HFIK
Sbjct  323  HFIK  326


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 61/111 (55%), Gaps = 5/111 (5%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGT---GFLAPIQLSDSLVKFFGTGENALSRGD  350
            D    + +++SD   K++  R   + G      GF  P  LS  L K    GE+ L R +
Sbjct  87   DSCSQEEENESDTGTKEKSHRSEKMNGEAKKKGGFNKPCALSPQLQKL--VGESELGRPE  144

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            VVK++W YI+E  LQ+P NKR+++CD+ L E+    + + F M K+L+ H 
Sbjct  145  VVKKIWAYIREKNLQNPQNKRKILCDEVLSEIFRAKTIDMFQMNKVLSKHI  195



>ref|XP_007042350.1| SWIB complex BAF60b domain-containing protein, putative [Theobroma 
cacao]
 gb|EOX98181.1| SWIB complex BAF60b domain-containing protein, putative [Theobroma 
cacao]
Length=472

 Score =   231 bits (589),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 138/176 (78%), Gaps = 12/176 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK ++ I+CD++L  IFRV TI+MF+MN+ LSKHIWP+ +ED     ST  ER
Sbjct  306  REKNLQDPKNRRNILCDQSLHAIFRVNTINMFQMNKALSKHIWPLNEEDAQ-ADSTKIER  364

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + K+GR+           FEPKQ+EKRQ   K G +GFLAP+ LSD+LV FFGTGENALS
Sbjct  365  KSKQGRER--------GPFEPKQKEKRQ---KKGASGFLAPLPLSDALVNFFGTGENALS  413

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DVVKRMW+YIK+N+LQDPS+KRR++CDDKL+ELLEVDSF GFT+ KLLT HFIK
Sbjct  414  RADVVKRMWEYIKQNDLQDPSDKRRILCDDKLKELLEVDSFNGFTIPKLLTTHFIK  469


 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/210 (35%), Positives = 104/210 (50%), Gaps = 42/210 (20%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK K+ IICDE+L  IFRV +I+MF+MN+ L+KHIWP+  ED    ++   E 
Sbjct  144  RENNLQDPKNKRNIICDESLRAIFRVNSINMFQMNKALTKHIWPLSAED----ENVKHEM  199

Query  538  QRKKGRDEVYTDSDSDSDF------------------------------------EPKQE  467
            + +   D V  D+ +  +                                     + K+ 
Sbjct  200  KCEDSHDSVSVDAKNAEEEEEEEEEEREEEEEEEEVEEEEEEEQEPEQEGNARGSKNKRS  259

Query  466  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  287
             K  + +K  G GF     LS  L  F G  E  L+R +VVKR+W YI+E  LQDP N+R
Sbjct  260  AKVDKDVKRRGGGFTKLCSLSPQLQAFIGEPE--LARTEVVKRLWTYIREKNLQDPKNRR  317

Query  286  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             ++CD  L  +  V++   F M K L+ H 
Sbjct  318  NILCDQSLHAIFRVNTINMFQMNKALSKHI  347


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            P++  K  + +K  G GF     LS  L K  G  E  L R +VVK++W YI+EN LQDP
Sbjct  94   PRRGSKVDKPVKKRGGGFQKVCSLSPQLQKVVGQSE--LPRTEVVKKLWLYIRENNLQDP  151

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             NKR +ICD+ LR +  V+S   F M K LT H 
Sbjct  152  KNKRNIICDESLRAIFRVNSINMFQMNKALTKHI  185



>gb|KDO79317.1| hypothetical protein CISIN_1g0196442mg, partial [Citrus sinensis]
Length=213

 Score =   222 bits (566),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 138/177 (78%), Gaps = 11/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  48   REKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKALSKHIWPLDSDDVISVKSTPKEK  107

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E       D D EP ++EKRQ   KGG +GFLAP+QLSD+L+KF GTGE+AL 
Sbjct  108  QRKQERTE-------DLD-EPTRKEKRQ---KGGKSGFLAPLQLSDALIKFLGTGESALP  156

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIKE  LQDPS+KRR+ICD+KL+EL +VD+F GFT+TKLL  HF+KT
Sbjct  157  RSDVIKRMWDYIKEKNLQDPSDKRRIICDEKLKELFDVDTFNGFTVTKLLVVHFLKT  213


 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  L+R +VVK++W YI+E +LQDP+N+R ++CD+
Sbjct  8    VKKRGGGFSKLCALSPQLQEFIGVTE--LARTEVVKQLWAYIREKDLQDPNNRRNIVCDE  65

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  VD+   F M K L+ H 
Sbjct  66   RLRALFGVDTINMFQMNKALSKHI  89



>ref|XP_002522329.1| Upstream activation factor subunit UAF30, putative [Ricinus communis]
 gb|EEF40013.1| Upstream activation factor subunit UAF30, putative [Ricinus communis]
Length=322

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 141/177 (80%), Gaps = 11/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE  LQDP  ++ IICDE    +F V +IDMF+MN+ LSKHIWP++ + V   KS PKE+
Sbjct  157  REKKLQDPNNRRNIICDEPFRALFGVDSIDMFQMNKVLSKHIWPLDSDGVVPAKSEPKEK  216

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R+E       + D EPK++EKR++G K   +GFLAP+QLSD+L+KFFGTGENALS
Sbjct  217  QRKQEREE-------EPD-EPKRKEKRRKGEK---SGFLAPLQLSDALIKFFGTGENALS  265

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW+YIK+N LQDPS+KRR+ICD+KL+EL +VD+F GFT+TKLL+AHF+KT
Sbjct  266  RADVIKRMWEYIKQNNLQDPSDKRRIICDEKLKELFDVDTFNGFTVTKLLSAHFVKT  322


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/104 (40%), Positives = 63/104 (61%), Gaps = 3/104 (3%)
 Frame = -2

Query  508  TDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWK  329
            T S+  S+ + +  E++  G K GG GF     LS  L +   TG   L+R +VVK++W 
Sbjct  98   TASNGTSNAKRRSNEQKNEGKKRGG-GFSKLCSLSPQLQEL--TGVPQLARTEVVKQLWS  154

Query  328  YIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +I+E +LQDP+N+R +ICD+  R L  VDS + F M K+L+ H 
Sbjct  155  HIREKKLQDPNNRRNIICDEPFRALFGVDSIDMFQMNKVLSKHI  198



>ref|XP_007047160.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOX91317.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=322

 Score =   224 bits (571),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 139/177 (79%), Gaps = 15/177 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE LL +F V++IDMF+MN+ LSKHIWP++ ++V  VKST +E+
Sbjct  161  REKNLQDPLNKKNIICDEPLLALFGVRSIDMFQMNKALSKHIWPLDSDEVVSVKSTEREK  220

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK  R+E       D D EPK++EKRQ+G       FLAP+QLSD+LVKF GTGE+ L+
Sbjct  221  QRKHVREE-------DPD-EPKRKEKRQKG-------FLAPLQLSDALVKFLGTGESVLT  265

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIKEN LQDPS+KR+VICD+KL+EL EV++F GFT++KLL AHF+KT
Sbjct  266  RADVIKRMWDYIKENNLQDPSDKRKVICDEKLKELFEVETFTGFTVSKLLAAHFLKT  322


 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 48/84 (57%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +  G    AL+R +VVK++W YI+E  LQDP NK+ +ICD+
Sbjct  121  VKRRGGGFNKVCSLSPQLQELVGVP--ALARTEVVKQIWAYIREKNLQDPLNKKNIICDE  178

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
             L  L  V S + F M K L+ H 
Sbjct  179  PLLALFGVRSIDMFQMNKALSKHI  202



>ref|XP_010652654.1| PREDICTED: upstream activation factor subunit spp27-like [Vitis 
vinifera]
Length=332

 Score =   219 bits (559),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 139/177 (79%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ IICDETL  +F V +I+MF+MN+ LSKHIWP++ +D   VK TPKE+
Sbjct  166  REKDLQDPNNRRNIICDETLRALFGVDSINMFQMNKALSKHIWPLDSDDAAPVKPTPKEK  225

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ RD        DSD EPK+++KRQ   KGG +GFLAP+ LSD+LVKF    E+ALS
Sbjct  226  QRKQERD--------DSD-EPKRKQKRQ---KGGNSGFLAPLPLSDALVKFLNIEESALS  273

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R +VVK++W+YIK+N LQDPS+KRR+ICD+KL+EL +VDSF GFT+ KLL+AHFIKT
Sbjct  274  RAEVVKKIWEYIKQNNLQDPSDKRRIICDEKLKELFDVDSFNGFTVPKLLSAHFIKT  330


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  + +K  G GF     LS  L KF G  E  L+R +VVK++W +I+E +LQDP+N+R 
Sbjct  121  KSNKEVKKRGGGFCKLCSLSPELQKFIGVPE--LARTEVVKQLWVHIREKDLQDPNNRRN  178

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD+ LR L  VDS   F M K L+ H 
Sbjct  179  IICDETLRALFGVDSINMFQMNKALSKHI  207



>ref|XP_006425831.1| hypothetical protein CICLE_v10026010mg [Citrus clementina]
 ref|XP_006466650.1| PREDICTED: upstream activation factor subunit spp27-like [Citrus 
sinensis]
 gb|ESR39071.1| hypothetical protein CICLE_v10026010mg [Citrus clementina]
Length=338

 Score =   219 bits (558),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 137/177 (77%), Gaps = 11/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  173  REKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKALSKHIWPLDSDDVISVKSTPKEK  232

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E       D D EP ++EKRQ   KGG +GFLAP+QLS +L+KF GTGE+AL 
Sbjct  233  QRKQERTE-------DLD-EPTRKEKRQ---KGGKSGFLAPLQLSGALIKFLGTGESALP  281

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DV+KRMW YIKE  LQDPS+KRR+ICD+KL+EL +V++F GFT+TKLL  HF+KT
Sbjct  282  RSDVIKRMWDYIKEKNLQDPSDKRRIICDEKLKELFDVETFNGFTVTKLLAVHFLKT  338


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  L+R +VVK++W YI+E +LQDP+N+R ++CD+
Sbjct  133  VKKRGGGFSKLCALSPQLQEFIGVTE--LARTEVVKQLWAYIREKDLQDPNNRRNIVCDE  190

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  VD+   F M K L+ H 
Sbjct  191  RLRALFGVDTINMFQMNKALSKHI  214



>ref|XP_004511971.1| PREDICTED: upstream activation factor subunit spp27-like [Cicer 
arietinum]
Length=352

 Score =   219 bits (559),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 139/178 (78%), Gaps = 12/178 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVK-STPKE  542
            RE NLQDP  ++ I+CDE L  +F V TI+MF+MN+ L+KHIWP++ +DV  VK S PKE
Sbjct  184  REKNLQDPTNRRNIVCDEPLRALFGVNTINMFQMNKVLTKHIWPLDSDDVVPVKKSAPKE  243

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            +Q+K+ R++       DSD EP+++EKRQ   KGGG GFLAP+QLSD+LVKF GTGE+ L
Sbjct  244  KQKKQERED-------DSD-EPQRKEKRQ---KGGGKGFLAPLQLSDALVKFLGTGESEL  292

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DV+KRMW YIK N LQDPS+KR V+CD+KL+EL ++DSF GFT++KLL  HFIKT
Sbjct  293  SRSDVIKRMWDYIKGNNLQDPSDKRNVLCDEKLKELFDIDSFTGFTVSKLLAPHFIKT  350


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 60/117 (51%), Gaps = 26/117 (22%)
 Frame = -2

Query  475  KQEEKRQRG------------------------LKGGGTGFLAPIQLSDSLVKFFGTGEN  368
            ++EEK++R                          K GG GF     LS  L +F G  E 
Sbjct  111  EEEEKKERPKRSNSVKKKKKNKERSNKLGNEVVKKKGGGGFCKLCSLSPQLQEFVGAPE-  169

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             ++R +VVK++W YI+E  LQDP+N+R ++CD+ LR L  V++   F M K+LT H 
Sbjct  170  -MARTEVVKQLWAYIREKNLQDPTNRRNIVCDEPLRALFGVNTINMFQMNKVLTKHI  225



>ref|XP_008792695.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008792696.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Phoenix dactylifera]
Length=319

 Score =   218 bits (556),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 130/179 (73%), Gaps = 22/179 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKSTPK  545
            R+NNLQDP  KK+IICDE L  IF V TIDMF+MN+ LSKHIWP+  E    T+VKS PK
Sbjct  160  RQNNLQDPNNKKKIICDERLQSIFNVSTIDMFQMNKALSKHIWPLNSEGGPSTVVKSEPK  219

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            E+Q KK R                 E KRQ   KGG +G LAP+ LSD LVKF GTGENA
Sbjct  220  EKQHKKER-----------------EGKRQ---KGGSSGLLAPLPLSDDLVKFIGTGENA  259

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            LSR DVVKRMW+YIK+N LQDP++KR +ICD KL+ELL+VDSF GFT++KLL AHFIKT
Sbjct  260  LSRSDVVKRMWEYIKQNNLQDPADKRNIICDKKLKELLKVDSFRGFTVSKLLVAHFIKT  318


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  + +K  G GF     LS +L +F   GE+ L+R +VVK++W YI++N LQDP+NK++
Sbjct  115  KLNKEVKKRGGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRQNNLQDPNNKKK  172

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD++L+ +  V + + F M K L+ H 
Sbjct  173  IICDERLQSIFNVSTIDMFQMNKALSKHI  201



>ref|XP_008792693.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Phoenix dactylifera]
Length=337

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 130/179 (73%), Gaps = 22/179 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKSTPK  545
            R+NNLQDP  KK+IICDE L  IF V TIDMF+MN+ LSKHIWP+  E    T+VKS PK
Sbjct  160  RQNNLQDPNNKKKIICDERLQSIFNVSTIDMFQMNKALSKHIWPLNSEGGPSTVVKSEPK  219

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            E+Q KK R                 E KRQ   KGG +G LAP+ LSD LVKF GTGENA
Sbjct  220  EKQHKKER-----------------EGKRQ---KGGSSGLLAPLPLSDDLVKFIGTGENA  259

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            LSR DVVKRMW+YIK+N LQDP++KR +ICD KL+ELL+VDSF GFT++KLL AHFIKT
Sbjct  260  LSRSDVVKRMWEYIKQNNLQDPADKRNIICDKKLKELLKVDSFRGFTVSKLLVAHFIKT  318


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 58/89 (65%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  + +K  G GF     LS +L +F   GE+ L+R +VVK++W YI++N LQDP+NK++
Sbjct  115  KLNKEVKKRGGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRQNNLQDPNNKKK  172

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD++L+ +  V + + F M K L+ H 
Sbjct  173  IICDERLQSIFNVSTIDMFQMNKALSKHI  201



>ref|XP_010263744.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nelumbo nucifera]
 ref|XP_010263745.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Nelumbo nucifera]
Length=329

 Score =   218 bits (555),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSKHI P++ ED   VKST KE+
Sbjct  165  REKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSKHIGPLDTEDAP-VKSTQKEK  223

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E       D++ EPKQ+EKRQ   KGG +GFLAP+ LS +LVKF GTGEN+LS
Sbjct  224  QRKQERKE-------DTN-EPKQKEKRQ---KGGNSGFLAPLPLSGALVKFLGTGENSLS  272

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R  VVKRMW+YIK+N LQDPS+KRR+ICD+KL+EL EVDSF GFT+ KLL AHF+KT
Sbjct  273  RASVVKRMWEYIKQNNLQDPSDKRRIICDEKLKELFEVDSFNGFTVLKLLAAHFVKT  329


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+NKR ++CD+
Sbjct  125  VKKRGGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPNNKRNIMCDE  182

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            KLR L  VDS   F M K L+ H 
Sbjct  183  KLRSLFGVDSINMFQMNKALSKHI  206



>ref|XP_010263746.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X4 [Nelumbo nucifera]
Length=328

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 137/177 (77%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSKHI P++ ED   VKST KE+
Sbjct  164  REKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSKHIGPLDTEDAP-VKSTQKEK  222

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E       D++ EPKQ+EKRQ   KGG +GFLAP+ LS +LVKF GTGEN+LS
Sbjct  223  QRKQERKE-------DTN-EPKQKEKRQ---KGGNSGFLAPLPLSGALVKFLGTGENSLS  271

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R  VVKRMW+YIK+N LQDPS+KRR+ICD+KL+EL EVDSF GFT+ KLL AHF+KT
Sbjct  272  RASVVKRMWEYIKQNNLQDPSDKRRIICDEKLKELFEVDSFNGFTVLKLLAAHFVKT  328


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K   K  + +K  G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+
Sbjct  115  KSSNKLSKEVKKRGGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPN  172

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            NKR ++CD+KLR L  VDS   F M K L+ H 
Sbjct  173  NKRNIMCDEKLRSLFGVDSINMFQMNKALSKHI  205



>emb|CAN83123.1| hypothetical protein VITISV_044372 [Vitis vinifera]
Length=332

 Score =   217 bits (553),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 138/177 (78%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ IICDETL  +F V +I+MF+MN+ LSKHIWP++ +D   VK TPKE+
Sbjct  166  REKDLQDPNNRRNIICDETLRALFGVDSINMFQMNKALSKHIWPLDSDDAAPVKPTPKEK  225

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R     DSD     EPK+++KRQ   KGG +GFLAP+ LSD+LVKF    E+ALS
Sbjct  226  QRKQER----XDSD-----EPKRKQKRQ---KGGNSGFLAPLPLSDALVKFLNIEESALS  273

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R +VVK++W+YIK+N LQDPS+KRR+ICD+KL+EL +VDSF GFT+ KLL+AHFIKT
Sbjct  274  RAEVVKKIWEYIKQNNLQDPSDKRRIICDEKLKELFDVDSFNGFTVPKLLSAHFIKT  330


 Score = 78.6 bits (192),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  + +K  G GF     LS  L KF G  E  L+R +VVK++W +I+E +LQDP+N+R 
Sbjct  121  KSNKEVKKRGGGFCKLCSLSPELQKFIGVPE--LARTEVVKQLWVHIREKDLQDPNNRRN  178

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD+ LR L  VDS   F M K L+ H 
Sbjct  179  IICDETLRALFGVDSINMFQMNKALSKHI  207



>ref|XP_011099215.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Sesamum indicum]
Length=325

 Score =   216 bits (550),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 134/177 (76%), Gaps = 11/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ I+CD+TL  +F V TIDMF+MN+ L+KHIWP++ +      S PKE+
Sbjct  158  RENNLQDPSNRRNIVCDDTLRNLFGVDTIDMFQMNKALAKHIWPLDSDGAASTNSAPKEK  217

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ RDE       D D EPK++EKRQR    G + FLAP++LSD+L KF GTGE+AL 
Sbjct  218  QRKQERDE-------DQD-EPKRKEKRQRA---GNSAFLAPVKLSDALAKFLGTGESALP  266

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R +VVKR+W+YIK N LQDPS+KR++ICD+KL+EL  VD+F GFT+ KLLTAH +KT
Sbjct  267  RSNVVKRIWEYIKLNNLQDPSDKRQIICDEKLKELFNVDTFCGFTVAKLLTAHLVKT  323


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDPSN+R ++CDD LR 
Sbjct  122  GGGFTKLCSLSPELQKFTGVPE--LARTEVVKQLWSYIRENNLQDPSNRRNIVCDDTLRN  179

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  VD+ + F M K L  H 
Sbjct  180  LFGVDTIDMFQMNKALAKHI  199



>ref|XP_008792591.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Phoenix dactylifera]
Length=327

 Score =   216 bits (549),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 131/179 (73%), Gaps = 22/179 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKSTPK  545
            REN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ LSKHIWP+  ED  VT VKS PK
Sbjct  168  RENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKALSKHIWPLTSEDGPVTTVKSKPK  227

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            ++Q KK R                 E KRQ   KGG +G L P+ LSD LVKF GTGEN 
Sbjct  228  DKQHKKER-----------------EGKRQ---KGGSSGLLVPLPLSDDLVKFIGTGENT  267

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            LSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL +VDSF GFT++KLLTAHFIKT
Sbjct  268  LSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKELFKVDSFRGFTVSKLLTAHFIKT  326


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N++++ICD++L+ 
Sbjct  132  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQN  189

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L +V++ + F M K L+ H 
Sbjct  190  LFKVNTIDMFQMNKALSKHI  209



>ref|XP_008792590.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Phoenix dactylifera]
Length=328

 Score =   215 bits (548),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 131/180 (73%), Gaps = 23/180 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            REN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ LSKHIWP+  ED   VT VKS P
Sbjct  168  RENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKALSKHIWPLTSEDAGPVTTVKSKP  227

Query  547  KERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
            K++Q KK R                 E KRQ   KGG +G L P+ LSD LVKF GTGEN
Sbjct  228  KDKQHKKER-----------------EGKRQ---KGGSSGLLVPLPLSDDLVKFIGTGEN  267

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
             LSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL +VDSF GFT++KLLTAHFIKT
Sbjct  268  TLSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKELFKVDSFRGFTVSKLLTAHFIKT  327


 Score = 80.1 bits (196),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N++++ICD++L+ 
Sbjct  132  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQN  189

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L +V++ + F M K L+ H 
Sbjct  190  LFKVNTIDMFQMNKALSKHI  209



>gb|KDP31884.1| hypothetical protein JCGZ_12345 [Jatropha curcas]
Length=334

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ I CD+ L  +F V +I+MF+MN+ LSKHIWP++ +DV   +  PKE+
Sbjct  167  REKDLQDPNNRRNINCDKPLRALFGVDSINMFQMNKALSKHIWPLDSQDV---EPAPKEK  223

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG--TGFLAPIQLSDSLVKFFGTGENA  365
            QRK+ R+E           EPK++EKRQ+G K  G  +GFLAP+QLSD+L+KF GTGENA
Sbjct  224  QRKQEREEGLD--------EPKRKEKRQKGEKSKGEKSGFLAPLQLSDALIKFLGTGENA  275

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            LSR +VVKRMW+YIK+N LQDPS+KRR+ICD+KL++L +VD F GFT++KLL+AHF+K 
Sbjct  276  LSRAEVVKRMWEYIKQNNLQDPSDKRRIICDEKLKQLFDVDFFNGFTVSKLLSAHFVKA  334


 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = -2

Query  451  GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            G K GG GF     LS  L +F G  +  L+R +VVK++W YI+E +LQDP+N+R + CD
Sbjct  127  GKKRGG-GFSKLCNLSPQLQEFIGVPQ--LARTEVVKQLWAYIREKDLQDPNNRRNINCD  183

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
              LR L  VDS   F M K L+ H 
Sbjct  184  KPLRALFGVDSINMFQMNKALSKHI  208



>gb|KJB32415.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=453

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPK-E  542
            RE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ LSKHIWP+ +E+VT+   + K E
Sbjct  285  REKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKALSKHIWPLNEEEVTVQADSAKTE  344

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            R+ K+ R+ V          EPKQ+EK+Q   K G +GFLAP+ LSD+LVKFF TGENAL
Sbjct  345  RKSKQARERVAD--------EPKQKEKKQ---KKGASGFLAPLPLSDALVKFFATGENAL  393

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            SR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL EVDSF GF MTKLLT HFIK
Sbjct  394  SRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFIK  450


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  42   KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWVYIKEKDLQDPKNKRN  99

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  100  IICDELLRDIFRVNSINMFQMNKALTKHI  128


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L  F G  E  L+R +VVKR+W YI+E  LQDP +KR V+CDD L  L 
Sbjct  251  GFTKLCSLSPQLQAFIGESE--LARTEVVKRLWTYIREKNLQDPKDKRNVLCDDSLYALF  308

Query  250  EVDSFEGFTMTKLLTAHF  197
             V S   F M K L+ H 
Sbjct  309  RVKSINMFQMNKALSKHI  326


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED  572
            +E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L+KHIWP+  ED
Sbjct  87   KEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKALTKHIWPLSVED  135



>ref|XP_011099216.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Sesamum indicum]
Length=324

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 135/177 (76%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ I+CD+TL  +F V TIDMF+MN+ L+KHIWP++ +  +   S PKE+
Sbjct  158  RENNLQDPSNRRNIVCDDTLRNLFGVDTIDMFQMNKALAKHIWPLDSDGAS-TNSAPKEK  216

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ RDE       D D EPK++EKRQR    G + FLAP++LSD+L KF GTGE+AL 
Sbjct  217  QRKQERDE-------DQD-EPKRKEKRQRA---GNSAFLAPVKLSDALAKFLGTGESALP  265

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R +VVKR+W+YIK N LQDPS+KR++ICD+KL+EL  VD+F GFT+ KLLTAH +KT
Sbjct  266  RSNVVKRIWEYIKLNNLQDPSDKRQIICDEKLKELFNVDTFCGFTVAKLLTAHLVKT  322


 Score = 82.8 bits (203),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDPSN+R ++CDD LR 
Sbjct  122  GGGFTKLCSLSPELQKFTGVPE--LARTEVVKQLWSYIRENNLQDPSNRRNIVCDDTLRN  179

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  VD+ + F M K L  H 
Sbjct  180  LFGVDTIDMFQMNKALAKHI  199



>gb|KJB32416.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=513

 Score =   217 bits (552),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPK-E  542
            RE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ LSKHIWP+ +E+VT+   + K E
Sbjct  345  REKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKALSKHIWPLNEEEVTVQADSAKTE  404

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            R+ K+ R+ V          EPKQ+EK+Q   K G +GFLAP+ LSD+LVKFF TGENAL
Sbjct  405  RKSKQARERVAD--------EPKQKEKKQ---KKGASGFLAPLPLSDALVKFFATGENAL  453

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            SR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL EVDSF GF MTKLLT HFIK
Sbjct  454  SRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFIK  510


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWVYIKEKDLQDPKNKRN  160

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  161  IICDELLRDIFRVNSINMFQMNKALTKHI  189


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L  F G  E  L+R +VVKR+W YI+E  LQDP +KR V+CDD L  L 
Sbjct  311  GFTKLCSLSPQLQAFIGESE--LARTEVVKRLWTYIREKNLQDPKDKRNVLCDDSLYALF  368

Query  250  EVDSFEGFTMTKLLTAHF  197
             V S   F M K L+ H 
Sbjct  369  RVKSINMFQMNKALSKHI  386


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED  572
            +E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L+KHIWP+  ED
Sbjct  148  KEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKALTKHIWPLSVED  196



>gb|KJB32414.1| hypothetical protein B456_005G239900 [Gossypium raimondii]
Length=514

 Score =   217 bits (552),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/177 (62%), Positives = 140/177 (79%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPK-E  542
            RE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ LSKHIWP+ +E+VT+   + K E
Sbjct  346  REKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKALSKHIWPLNEEEVTVQADSAKTE  405

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            R+ K+ R+ V          EPKQ+EK+Q   K G +GFLAP+ LSD+LVKFF TGENAL
Sbjct  406  RKSKQARERVAD--------EPKQKEKKQ---KKGASGFLAPLPLSDALVKFFATGENAL  454

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            SR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL EVDSF GF MTKLLT HFIK
Sbjct  455  SRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFIK  511


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWVYIKEKDLQDPKNKRN  160

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  161  IICDELLRDIFRVNSINMFQMNKALTKHI  189


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 44/78 (56%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L  F G  E  L+R +VVKR+W YI+E  LQDP +KR V+CDD L  L 
Sbjct  312  GFTKLCSLSPQLQAFIGESE--LARTEVVKRLWTYIREKNLQDPKDKRNVLCDDSLYALF  369

Query  250  EVDSFEGFTMTKLLTAHF  197
             V S   F M K L+ H 
Sbjct  370  RVKSINMFQMNKALSKHI  387


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED  572
            +E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L+KHIWP+  ED
Sbjct  148  KEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKALTKHIWPLSVED  196



>ref|XP_002521839.1| brg-1 associated factor, putative [Ricinus communis]
 gb|EEF40475.1| brg-1 associated factor, putative [Ricinus communis]
Length=614

 Score =   219 bits (557),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 137/176 (78%), Gaps = 13/176 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK K+ I+CDE+L  +FRV  I+MF+MN+ LSKHIWP+++ED     S  KER
Sbjct  449  RENNLQDPKNKRNILCDESLRTLFRVDCINMFQMNKVLSKHIWPLDEEDAE--NSLQKER  506

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + K+ R+E       DSD EPKQ+EKRQ   K G +G L P+ LSD LVKF GTGEN LS
Sbjct  507  RSKQQREE-------DSD-EPKQKEKRQ---KKGVSGLLVPLPLSDPLVKFIGTGENELS  555

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DVVKR+W YIK+N+LQDPS+KRR++CDDKL+EL EVDSF GF+++KLLTAHFIK
Sbjct  556  RADVVKRIWGYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFSVSKLLTAHFIK  611


 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/207 (39%), Positives = 108/207 (52%), Gaps = 49/207 (24%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK ++ I+CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +E+           
Sbjct  300  RENNLQDPKNRRIILCDESLRALFRVDSINMFQMNKVLSKHIWPLNEEE-----------  348

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKR----------------------QRGLKGGGT--  431
               +G D V   S+        +EEK                       +R  KGG T  
Sbjct  349  ---EGNDSVSEASNGSGKEGEDEEEKSEEDEEEEEGDKEEEEAVEKEDSERSKKGGATKV  405

Query  430  ---------GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVI  278
                     GF     LS  L +F  TGE+ L+R +VVK++W YI+EN LQDP NKR ++
Sbjct  406  DKDVKKRGGGFTKLCSLSPQLQEF--TGESELARTEVVKKLWIYIRENNLQDPKNKRNIL  463

Query  277  CDDKLRELLEVDSFEGFTMTKLLTAHF  197
            CD+ LR L  VD    F M K+L+ H 
Sbjct  464  CDESLRTLFRVDCINMFQMNKVLSKHI  490


 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 108/192 (56%), Gaps = 20/192 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI------------EKE  575
            REN+LQDPK ++ I CDE L  +FRV +I+MF+MN+ LSKHIWP+            E+E
Sbjct  152  RENDLQDPKNRRIIKCDEALRDLFRVNSINMFQMNKALSKHIWPLTAQAEASNDPGKEEE  211

Query  574  D----VTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQ--EEKRQRGLKGGGTGFLAPI  413
            D    V+   + P + +  +       + + + +   K+    K  + +K  G GF    
Sbjct  212  DEEGSVSEGSNDPSKEEEDEEEKMEEDEEEEEDNKRSKKGRATKVNKDVKKRGGGFTKLC  271

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L +F G  ++A  R +VVK++W YI+EN LQDP N+R ++CD+ LR L  VDS  
Sbjct  272  SLSPQLQEFIGESKSA--RTEVVKKLWVYIRENNLQDPKNRRIILCDESLRALFRVDSIN  329

Query  232  GFTMTKLLTAHF  197
             F M K+L+ H 
Sbjct  330  MFQMNKVLSKHI  341


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  481  EPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  302
            E  +E +R +  K  G GF     LS  L KF G  E  L+R +VVK++W YI+EN+LQD
Sbjct  101  EQSEESERSKKAKKRGGGFTMLCSLSPQLHKFVGVSE--LARTEVVKKLWAYIRENDLQD  158

Query  301  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            P N+R + CD+ LR+L  V+S   F M K L+ H 
Sbjct  159  PKNRRIIKCDEALRDLFRVNSINMFQMNKALSKHI  193



>ref|XP_010905631.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
Length=325

 Score =   209 bits (533),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 128/179 (72%), Gaps = 22/179 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKSTPK  545
            REN+LQDP  +++IICDE L  +F V TIDMF+MN+ LSKHIWP+  ED     VKS PK
Sbjct  166  RENSLQDPNNRRKIICDERLQKLFNVNTIDMFQMNKALSKHIWPLTSEDGPANTVKSKPK  225

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            ++Q KK                 + E KRQ   KGG +G L P+ LSD LVKF GTGENA
Sbjct  226  DKQHKK-----------------EGEGKRQ---KGGSSGLLVPLPLSDDLVKFIGTGENA  265

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            LSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL +VDSF GFT++KLL AHFIKT
Sbjct  266  LSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKELFKVDSFRGFTVSKLLAAHFIKT  324


 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  + +K  G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N+R+
Sbjct  121  KLNKEVKRRGGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRRK  178

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD++L++L  V++ + F M K L+ H 
Sbjct  179  IICDERLQKLFNVNTIDMFQMNKALSKHI  207



>ref|XP_010905630.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Elaeis guineensis]
Length=326

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 128/180 (71%), Gaps = 23/180 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDV---TLVKSTP  548
            REN+LQDP  +++IICDE L  +F V TIDMF+MN+ LSKHIWP+  ED      VKS P
Sbjct  166  RENSLQDPNNRRKIICDERLQKLFNVNTIDMFQMNKALSKHIWPLTSEDAGPANTVKSKP  225

Query  547  KERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
            K++Q KK                 + E KRQ   KGG +G L P+ LSD LVKF GTGEN
Sbjct  226  KDKQHKK-----------------EGEGKRQ---KGGSSGLLVPLPLSDDLVKFIGTGEN  265

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            ALSR DVVKRMW+YIK+N LQDP++KR VICD+KL+EL +VDSF GFT++KLL AHFIKT
Sbjct  266  ALSRSDVVKRMWEYIKQNNLQDPADKRNVICDEKLKELFKVDSFRGFTVSKLLAAHFIKT  325


 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 60/89 (67%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  + +K  G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N+R+
Sbjct  121  KLNKEVKRRGGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRRK  178

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD++L++L  V++ + F M K L+ H 
Sbjct  179  IICDERLQKLFNVNTIDMFQMNKALSKHI  207



>emb|CDP02467.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   209 bits (532),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 133/176 (76%), Gaps = 13/176 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ I+CD TL  +F V +I+MF+MN+ L++HIWP+E      V STPKE+
Sbjct  158  RENNLQDPSNRRNILCDGTLRDLFGVDSINMFQMNKALAQHIWPLETN--ASVSSTPKEK  215

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E           EPK++EKR    KGG +GFLAP+ LSD+LVKF GTGE+AL 
Sbjct  216  QRKQERAEEMD--------EPKRKEKRH---KGGTSGFLAPLPLSDALVKFLGTGESALP  264

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DVVKR+W YIK+N LQDPS++RR++CD+KL+EL +VD+F+GFT+ KLLT HFIK
Sbjct  265  RSDVVKRIWDYIKQNNLQDPSDRRRILCDEKLKELFDVDNFQGFTVPKLLTGHFIK  320


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDPSN+R ++CD  LR+
Sbjct  122  GGGFTKLCSLSPQLQKFTGVPE--LARTEVVKQLWSYIRENNLQDPSNRRNILCDGTLRD  179

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  VDS   F M K L  H 
Sbjct  180  LFGVDSINMFQMNKALAQHI  199



>gb|KHG25549.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=515

 Score =   214 bits (544),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 137/177 (77%), Gaps = 12/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPK-E  542
            RE NLQDPK K+ ++CD++L  +FRVK+I+MF+MN+ LSKHIWP+ +E+V +   + K E
Sbjct  347  REKNLQDPKDKRNVLCDDSLYALFRVKSINMFQMNKALSKHIWPLNEEEVAVQADSAKTE  406

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            R+ K+ R+ V            ++ +++++  K G +GFLAP+ LSD+LVKFF TGENAL
Sbjct  407  RKSKQARERV-----------AEEPKQKEKKQKKGASGFLAPLPLSDALVKFFATGENAL  455

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            SR DVVK+MW+YIK+N+LQDPS+KRR++CDDKL+EL EVDSF GF MTKLLT HFIK
Sbjct  456  SRADVVKKMWEYIKQNDLQDPSDKRRILCDDKLKELFEVDSFNGFAMTKLLTTHFIK  512


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K  +  K  G GF     LS  L K    GE+ L+R +VVK++W YIKE +LQDP NKR 
Sbjct  103  KSDKKAKKRGGGFQTVCSLSPQLQKV--VGESKLARTEVVKKLWAYIKEKDLQDPKNKRN  160

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +ICD+ LR++  V+S   F M K LT H 
Sbjct  161  IICDELLRDIFRVNSINMFQMNKALTKHI  189


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = -2

Query  454  RGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVIC  275
            + +K  G GF     LS  L  F G  E  L+R +VVKR+W YI+E  LQDP +KR V+C
Sbjct  305  KDVKRRGGGFTKLCSLSPQLQAFIGESE--LARTEVVKRLWTYIREKNLQDPKDKRNVLC  362

Query  274  DDKLRELLEVDSFEGFTMTKLLTAHF  197
            DD L  L  V S   F M K L+ H 
Sbjct  363  DDSLYALFRVKSINMFQMNKALSKHI  388


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED  572
            +E +LQDPK K+ IICDE L  IFRV +I+MF+MN+ L+KHIWP+  ED
Sbjct  148  KEKDLQDPKNKRNIICDELLRDIFRVNSINMFQMNKALTKHIWPLSVED  196



>gb|KJB43618.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=173

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 18/177 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KST KE+
Sbjct  15   REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSTEKEK  71

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             RK  R+E       D D E K +EKRQ+G       FLAP+QLSD+LVKF GTGEN L+
Sbjct  72   PRKHEREE-------DPD-EAKGKEKRQKG-------FLAPLQLSDALVKFLGTGENELT  116

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+TKLL AHF+K+
Sbjct  117  RAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHFLKS  173


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            ++R +VVK+MW YI+E  LQDP NK+ +ICD+ L  L  V+S + F M K L+ H +
Sbjct  1    MARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHIL  57



>gb|KJB43616.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43619.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43620.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=189

 Score =   200 bits (508),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KS  +E+
Sbjct  15   REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSMEREK  71

Query  538  QRKKGRDEV-YTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
             RK  R+EV  T+ +     E +++    +G +    GFLAP+QLSD+LVKF GTGEN L
Sbjct  72   PRKHEREEVKSTEKEKPRKHEREEDPDEAKGKEKRQKGFLAPLQLSDALVKFLGTGENEL  131

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            +R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+TKLL AHF+K+
Sbjct  132  TRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHFLKS  189


 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            ++R +VVK+MW YI+E  LQDP NK+ +ICD+ L  L  V+S + F M K L+ H +
Sbjct  1    MARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHIL  57



>gb|KJB43617.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=173

 Score =   199 bits (505),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 131/177 (74%), Gaps = 18/177 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KS  +E+
Sbjct  15   REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSMEREK  71

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             RK  R+E       D D E K +EKRQ+G       FLAP+QLSD+LVKF GTGEN L+
Sbjct  72   PRKHEREE-------DPD-EAKGKEKRQKG-------FLAPLQLSDALVKFLGTGENELT  116

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+TKLL AHF+K+
Sbjct  117  RAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHFLKS  173


 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -2

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            ++R +VVK+MW YI+E  LQDP NK+ +ICD+ L  L  V+S + F M K L+ H +
Sbjct  1    MARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHIL  57



>gb|KJB43613.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43615.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=223

 Score =   200 bits (508),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 135/186 (73%), Gaps = 20/186 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KS  +E+
Sbjct  49   REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSMEREK  105

Query  538  QRKKGRDEVYT---------DSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKF  386
             RK  R+EV +         + + D D E K +EKRQ+G       FLAP+QLSD+LVKF
Sbjct  106  PRKHEREEVKSTEKEKPRKHEREEDPD-EAKGKEKRQKG-------FLAPLQLSDALVKF  157

Query  385  FGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT  206
             GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+TKLL 
Sbjct  158  LGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLA  217

Query  205  AHFIKT  188
            AHF+K+
Sbjct  218  AHFLKS  223


 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 2/81 (2%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF    +LS  L +  G  E  ++R +VVK+MW YI+E  LQDP NK+ +ICD+ L  
Sbjct  13   GGGFNKVSRLSPQLRELLGVPE--MARTEVVKQMWVYIREKNLQDPVNKKNIICDEPLHA  70

Query  256  LLEVDSFEGFTMTKLLTAHFI  194
            L  V+S + F M K L+ H +
Sbjct  71   LFGVESIDMFQMNKALSKHIL  91



>ref|XP_002306454.2| hypothetical protein POPTR_0005s14110g [Populus trichocarpa]
 gb|EEE93450.2| hypothetical protein POPTR_0005s14110g [Populus trichocarpa]
Length=316

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 135/189 (71%), Gaps = 16/189 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  ++ I CDE L  +F V +I+MF+MN+ LS+HIWP++ EDV  + S   E+
Sbjct  132  REKNLQDPSDRRNINCDEPLQALFGVDSINMFQMNKALSRHIWPLDSEDVVSINSKQHEK  191

Query  538  QRKKGRDEVYTDSDSDSDF------------EPKQEEKRQRGLKGGGTGFLAPIQLSDSL  395
            Q K+ R+E   +S+ D+              E  ++EK+Q   KGG +GFLAP+QLSD+L
Sbjct  192  QHKREREEG-NESNYDAILPRMLYLYVKYGNESNKKEKKQ---KGGNSGFLAPLQLSDAL  247

Query  394  VKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTK  215
             KF GTGE+ LSR DVVKRMW+YIK+N LQDPS+KRR++CD KL+EL ++DSF GFT+ K
Sbjct  248  KKFLGTGESTLSRSDVVKRMWEYIKQNNLQDPSDKRRILCDVKLKELFDIDSFTGFTVPK  307

Query  214  LLTAHFIKT  188
            LL+AHF+K 
Sbjct  308  LLSAHFVKA  316


 Score = 70.1 bits (170),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 62/116 (53%), Gaps = 9/116 (8%)
 Frame = -2

Query  532  KKGRDEVYTDSDSDSDFEPK----QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            +K  D  YT  D   + E      QEE +  G K GG GF     LS  L +F G     
Sbjct  63   QKNGDNEYTHEDQKVNVENDGCDLQEEVQ--GKKRGG-GFSKLCSLSPQLQEFIGVPH--  117

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            L+R +VV+++W YI+E  LQDPS++R + CD+ L+ L  VDS   F M K L+ H 
Sbjct  118  LARTEVVRQLWTYIREKNLQDPSDRRNINCDEPLQALFGVDSINMFQMNKALSRHI  173



>gb|KJB43608.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43612.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=315

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 132/177 (75%), Gaps = 18/177 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KST KE+
Sbjct  157  REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSTEKEK  213

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             RK  R+E       D D E K +EKRQ+G       FLAP+QLSD+LVKF GTGEN L+
Sbjct  214  PRKHEREE-------DPD-EAKGKEKRQKG-------FLAPLQLSDALVKFLGTGENELT  258

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+TKLL AHF+K+
Sbjct  259  RAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHFLKS  315


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = -2

Query  463  KRQRGL----KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            KR +G+    K  G GF    +LS  L +  G  E  ++R +VVK+MW YI+E  LQDP 
Sbjct  108  KRSKGVNSEGKRRGGGFNKVSRLSPQLRELLGVPE--MARTEVVKQMWVYIREKNLQDPV  165

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            NK+ +ICD+ L  L  V+S + F M K L+ H +
Sbjct  166  NKKNIICDEPLHALFGVESIDMFQMNKALSKHIL  199



>ref|XP_011009270.1| PREDICTED: protein TRI1-like [Populus euphratica]
Length=316

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 130/177 (73%), Gaps = 11/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  ++ I CDE L  +F V +I+MF+MN+ LS+HIWP++ EDV  + S   E+
Sbjct  151  REKNLQDPSDRRNINCDEPLQALFGVDSINMFQMNKALSRHIWPLDSEDVVSINSKQHEK  210

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ R+E   +S+           K+++  KGG +GFLAP+QLSD+L KF GTGE+ LS
Sbjct  211  QHKREREEEEDESN-----------KKEKKQKGGNSGFLAPLQLSDALKKFLGTGESTLS  259

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DVVKRMW+YIK+N LQDPS+KRR++CD KL+EL E+DSF GFT+ KLL+AHF+K 
Sbjct  260  RSDVVKRMWEYIKQNNLQDPSDKRRILCDVKLKELFEIDSFTGFTVPKLLSAHFVKA  316


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 62/109 (57%), Gaps = 3/109 (3%)
 Frame = -2

Query  523  RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVV  344
            ++EV +D +   + +    E +  G K  G+GF     LS  L +FFG     L+R +VV
Sbjct  87   QEEVQSDDEEKGNVKRGYNENKNEG-KKRGSGFSKLCSLSPQLQEFFGVPH--LARTEVV  143

Query  343  KRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +++W YI+E  LQDPS++R + CD+ L+ L  VDS   F M K L+ H 
Sbjct  144  RQLWNYIREKNLQDPSDRRNINCDEPLQALFGVDSINMFQMNKALSRHI  192



>ref|XP_004170902.1| PREDICTED: uncharacterized protein LOC101226406, partial [Cucumis 
sativus]
Length=225

 Score =   197 bits (500),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 135/190 (71%), Gaps = 25/190 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ I+CDE L  +F V +I+MF+MN+ LSKHIWP+E  DV   KS+ KE+
Sbjct  44   RENNLQDPSNRRNILCDEPLKALFGVNSINMFQMNKALSKHIWPLESNDVIPAKSSQKEK  103

Query  538  --------------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSD  401
                          ++K+G++E   DSD  +     +E+KRQ   K G +GFLAP+ LS+
Sbjct  104  PQKEKQPKEKPQKKRQKQGKEE---DSDDSA-----REDKRQ---KKGKSGFLAPLPLSN  152

Query  400  SLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTM  221
            +LV F GTGE+AL R DVVKRMW YIK+N LQDPS+KRR+ICD++L+EL +VDSF GFT+
Sbjct  153  ALVAFLGTGEDALPRSDVVKRMWDYIKQNNLQDPSDKRRIICDERLKELFDVDSFNGFTV  212

Query  220  TKLLTAHFIK  191
            +KLL  HFIK
Sbjct  213  SKLLATHFIK  222


 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  ++R +VVK++W +I+EN LQDPSN+R ++CD+
Sbjct  4    VKKRGGGFTKLCSLSPQLQEFIGAPE--MARTEVVKQLWNHIRENNLQDPSNRRNILCDE  61

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
             L+ L  V+S   F M K L+ H 
Sbjct  62   PLKALFGVNSINMFQMNKALSKHI  85



>gb|KJB43609.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
 gb|KJB43611.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=331

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 135/186 (73%), Gaps = 20/186 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KS  +E+
Sbjct  157  REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSMEREK  213

Query  538  QRKKGRDEVYT---------DSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKF  386
             RK  R+EV +         + + D D E K +EKRQ+G       FLAP+QLSD+LVKF
Sbjct  214  PRKHEREEVKSTEKEKPRKHEREEDPD-EAKGKEKRQKG-------FLAPLQLSDALVKF  265

Query  385  FGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT  206
             GTGEN L+R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+TKLL 
Sbjct  266  LGTGENELTRAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLA  325

Query  205  AHFIKT  188
            AHF+K+
Sbjct  326  AHFLKS  331


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = -2

Query  463  KRQRGL----KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            KR +G+    K  G GF    +LS  L +  G  E  ++R +VVK+MW YI+E  LQDP 
Sbjct  108  KRSKGVNSEGKRRGGGFNKVSRLSPQLRELLGVPE--MARTEVVKQMWVYIREKNLQDPV  165

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            NK+ +ICD+ L  L  V+S + F M K L+ H +
Sbjct  166  NKKNIICDEPLHALFGVESIDMFQMNKALSKHIL  199



>ref|XP_010941845.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Elaeis guineensis]
Length=334

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/179 (55%), Positives = 125/179 (70%), Gaps = 10/179 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE--DVTLVKSTPK  545
            R+N+LQDP  +K IICD+TL  IF V TIDMF+MN+ LSKHIWP++ E    T V+S P 
Sbjct  163  RQNSLQDPNNRKNIICDDTLQNIFNVSTIDMFQMNKALSKHIWPLDSEGGSSTTVRSEPT  222

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
                   R        S+   +P ++E+  +  KGG +G L P+ LSD LVKF GTGEN 
Sbjct  223  GGSSTTVR--------SEPKAKPHKKEREVKRQKGGSSGLLVPLPLSDDLVKFIGTGENT  274

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            LSR D VKRMW+YIK+N LQDP++KR VICD KL+EL +VD+F GFT++KLL AHFIKT
Sbjct  275  LSRSDAVKRMWEYIKQNNLQDPADKRNVICDKKLKELFKVDTFRGFTVSKLLAAHFIKT  333


 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS +L +F   GE+ L+R +VVK++W YI++N LQDP+N++ +ICDD L+ 
Sbjct  127  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQN  184

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  V + + F M K L+ H 
Sbjct  185  IFNVSTIDMFQMNKALSKHI  204



>gb|KJB43610.1| hypothetical protein B456_007G210300 [Gossypium raimondii]
Length=315

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 131/177 (74%), Gaps = 18/177 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KS  +E+
Sbjct  157  REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSMEREK  213

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             RK  R+E       D D E K +EKRQ+G       FLAP+QLSD+LVKF GTGEN L+
Sbjct  214  PRKHEREE-------DPD-EAKGKEKRQKG-------FLAPLQLSDALVKFLGTGENELT  258

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R  V+KRMW YIKEN LQDP++KR+VICD+KL+EL EV++F GFT+TKLL AHF+K+
Sbjct  259  RAVVIKRMWDYIKENNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLAAHFLKS  315


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = -2

Query  463  KRQRGL----KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            KR +G+    K  G GF    +LS  L +  G  E  ++R +VVK+MW YI+E  LQDP 
Sbjct  108  KRSKGVNSEGKRRGGGFNKVSRLSPQLRELLGVPE--MARTEVVKQMWVYIREKNLQDPV  165

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            NK+ +ICD+ L  L  V+S + F M K L+ H +
Sbjct  166  NKKNIICDEPLHALFGVESIDMFQMNKALSKHIL  199



>gb|KHG26278.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=331

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 134/186 (72%), Gaps = 20/186 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  KK IICDE L  +F V++IDMF+MN+ LSKHI P++ ++V   KS  +E+
Sbjct  157  REKNLQDPVNKKNIICDEPLHALFGVESIDMFQMNKALSKHILPLDSDEV---KSMEREK  213

Query  538  QRKKGRDEVYT---------DSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKF  386
             RK  R+EV +         + + D D E K +EKRQ+G       FLAP+QLSD+LVKF
Sbjct  214  PRKHEREEVKSTEKEKPRKHEREEDPD-EAKGKEKRQKG-------FLAPLQLSDALVKF  265

Query  385  FGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT  206
             GTGEN L+R  V+KRMW YIK N LQDP++KR+VICD+KL+EL EV++F GFT+TKLL 
Sbjct  266  LGTGENELTRAVVIKRMWDYIKANNLQDPADKRKVICDEKLKELFEVETFHGFTVTKLLA  325

Query  205  AHFIKT  188
            AHF+K+
Sbjct  326  AHFLKS  331


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 55/94 (59%), Gaps = 6/94 (6%)
 Frame = -2

Query  463  KRQRGL----KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            KR +G+    K  G GF    +LS  L +  G  E  ++R +VVK+MW YI+E  LQDP 
Sbjct  108  KRSKGVNSEGKRRGGGFNKVSKLSPQLQELLGVPE--MARTEVVKQMWVYIREKNLQDPV  165

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            NK+ +ICD+ L  L  V+S + F M K L+ H +
Sbjct  166  NKKNIICDEPLHALFGVESIDMFQMNKALSKHIL  199



>gb|KEH27539.1| upstream activation factor subunit UAF30, putative [Medicago 
truncatula]
Length=267

 Score =   196 bits (497),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 11/183 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L+KHIWP++ +DV  VKS PKE+
Sbjct  88   REKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVLAKHIWPLDSDDVIQVKSAPKEK  147

Query  538  ------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT  377
                    +K + +     D D D EPK +EKRQ+   G G GFLAP+QLSD+L KF G 
Sbjct  148  PAPKEKPARKEKKKKQEREDDDLD-EPKGKEKRQK--VGSGKGFLAPLQLSDALAKFLG-  203

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             E+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL+EL +VDSF GFT+TKLL  HF
Sbjct  204  -ESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKLKELFDVDSFVGFTVTKLLAPHF  262

Query  196  IKT  188
            IK 
Sbjct  263  IKA  265


 Score = 72.4 bits (176),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 2/76 (3%)
 Frame = -2

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L +F G  E  ++R +VVK++W YI+E +LQDP+N+R +ICD+ LR L  
Sbjct  55   FCKICSLSPQLQEFVGAPE--MARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFG  112

Query  247  VDSFEGFTMTKLLTAH  200
            VD+   F M K+L  H
Sbjct  113  VDTINMFQMNKVLAKH  128



>ref|XP_004148436.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
sativus]
 gb|KGN62068.1| hypothetical protein Csa_2G295440 [Cucumis sativus]
Length=332

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 135/190 (71%), Gaps = 25/190 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ I+CDE L  +F V +I+MF+MN+ LSKHIWP+E  DV   KS+ KE+
Sbjct  151  RENNLQDPSNRRNILCDEPLKALFGVNSINMFQMNKALSKHIWPLESNDVIPAKSSQKEK  210

Query  538  --------------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSD  401
                          ++K+G++E   DSD  +     +E+KRQ   K G +GFLAP+ LS+
Sbjct  211  PQKEKQPKEKPQKKRQKQGKEE---DSDDSA-----REDKRQ---KKGKSGFLAPLPLSN  259

Query  400  SLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTM  221
            +LV F GTGE+AL R DVVKRMW YIK+N LQDPS+KRR+ICD++L+EL +VDSF GFT+
Sbjct  260  ALVAFLGTGEDALPRSDVVKRMWDYIKQNNLQDPSDKRRIICDERLKELFDVDSFNGFTV  319

Query  220  TKLLTAHFIK  191
            +KLL  HFIK
Sbjct  320  SKLLATHFIK  329


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  ++R +VVK++W +I+EN LQDPSN+R ++CD+
Sbjct  111  VKKRGGGFTKLCSLSPQLQEFIGAPE--MARTEVVKQLWNHIRENNLQDPSNRRNILCDE  168

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
             L+ L  V+S   F M K L+ H 
Sbjct  169  PLKALFGVNSINMFQMNKALSKHI  192



>gb|AES94759.2| upstream activation factor subunit UAF30, putative [Medicago 
truncatula]
Length=344

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 11/183 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L+KHIWP++ +DV  VKS PKE+
Sbjct  165  REKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVLAKHIWPLDSDDVIQVKSAPKEK  224

Query  538  ------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT  377
                    +K + +     D D D EPK +EKRQ+   G G GFLAP+QLSD+L KF G 
Sbjct  225  PAPKEKPARKEKKKKQEREDDDLD-EPKGKEKRQKV--GSGKGFLAPLQLSDALAKFLG-  280

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             E+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL+EL +VDSF GFT+TKLL  HF
Sbjct  281  -ESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKLKELFDVDSFVGFTVTKLLAPHF  339

Query  196  IKT  188
            IK 
Sbjct  340  IKA  342


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L +F G  E  ++R +VVK++W YI+E +LQDP+N+R +ICD+ LR L  
Sbjct  132  FCKICSLSPQLQEFVGAPE--MARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFG  189

Query  247  VDSFEGFTMTKLLTAHF  197
            VD+   F M K+L  H 
Sbjct  190  VDTINMFQMNKVLAKHI  206



>ref|XP_003611801.1| Upstream activation factor subunit spp27 [Medicago truncatula]
Length=361

 Score =   196 bits (498),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 131/183 (72%), Gaps = 11/183 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L+KHIWP++ +DV  VKS PKE+
Sbjct  165  REKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVLAKHIWPLDSDDVIQVKSAPKEK  224

Query  538  ------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT  377
                    +K + +     D D D EPK +EKRQ+   G G GFLAP+QLSD+L KF G 
Sbjct  225  PAPKEKPARKEKKKKQEREDDDLD-EPKGKEKRQK--VGSGKGFLAPLQLSDALAKFLG-  280

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             E+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL+EL +VDSF GFT+TKLL  HF
Sbjct  281  -ESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKLKELFDVDSFVGFTVTKLLAPHF  339

Query  196  IKT  188
            IK 
Sbjct  340  IKA  342


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L +F G  E  ++R +VVK++W YI+E +LQDP+N+R +ICD+ LR L  
Sbjct  132  FCKICSLSPQLQEFVGAPE--MARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFG  189

Query  247  VDSFEGFTMTKLLTAHF  197
            VD+   F M K+L  H 
Sbjct  190  VDTINMFQMNKVLAKHI  206



>ref|XP_009397729.1| PREDICTED: upstream activation factor subunit UAF30-like [Musa 
acuminata subsp. malaccensis]
Length=343

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 121/176 (69%), Gaps = 19/176 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  +++IICDE L  +F V  IDMF+MN+ LSKHIWP+  +D  +  + PK+ 
Sbjct  184  REKNLQDPNNRRKIICDEKLKPLFNVNVIDMFQMNKALSKHIWPLNSDDGPVTSAKPKQH  243

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             +                  PK+E + +R  K G +G LAP+ LSD LVKFFGTGEN LS
Sbjct  244  DK------------------PKKELEGKRQ-KVGSSGLLAPLPLSDDLVKFFGTGENTLS  284

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DVVKRMW YIK N LQDP++KR VICD+KL+ELL+VDSF GFT++KLL  HFIK
Sbjct  285  RSDVVKRMWDYIKGNNLQDPADKRNVICDEKLKELLKVDSFHGFTVSKLLAPHFIK  340


 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L  F   GE  L+R +VVKR+W YI+E  LQDP+N+R++ICD+
Sbjct  144  VKKRGGGFAKLCSLSPLLQDF--VGEPELARTEVVKRLWAYIREKNLQDPNNRRKIICDE  201

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            KL+ L  V+  + F M K L+ H 
Sbjct  202  KLKPLFNVNVIDMFQMNKALSKHI  225



>ref|XP_009587440.1| PREDICTED: upstream activation factor subunit UAF30-like [Nicotiana 
tomentosiformis]
Length=344

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 131/183 (72%), Gaps = 13/183 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL------VK  557
            REN+LQ+P  ++ I CD+TL  +F V  IDMF+MN+ L+KHIWP++ + V+       V 
Sbjct  167  RENDLQEPSNRRNINCDDTLRELFGVDKIDMFQMNKALAKHIWPLDSDGVSTITTSGSVN  226

Query  556  STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT  377
            ST KE+     +     + D DSD EPK++EKR        +G LAP+QLSD+L+KF GT
Sbjct  227  STAKEKSSTAKKKRRKQEEDEDSD-EPKRKEKRH------NSGILAPLQLSDALIKFLGT  279

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            GE+ L RG+VVKR+W YIK+N LQDPS+KR++ICD+KL+EL +VD+F GF ++KLLTAHF
Sbjct  280  GESELPRGNVVKRIWDYIKQNNLQDPSDKRKIICDEKLKELFDVDTFTGFGVSKLLTAHF  339

Query  196  IKT  188
            IK 
Sbjct  340  IKA  342


 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K    GF     LS  L KF  TGE  L+R +VVKRMW YI+EN+LQ+PSN+R + CDD
Sbjct  127  VKRKAGGFTKVCSLSPQLQKF--TGEAELARTEVVKRMWNYIRENDLQEPSNRRNINCDD  184

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
             LREL  VD  + F M K L  H 
Sbjct  185  TLRELFGVDKIDMFQMNKALAKHI  208



>ref|XP_008457882.1| PREDICTED: upstream activation factor subunit UAF30-like [Cucumis 
melo]
Length=332

 Score =   193 bits (491),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 135/190 (71%), Gaps = 25/190 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ I+CDE L  +F V +I+MF+MN+ LSKHIWP+E  DV   KS+ KE+
Sbjct  151  RENNLQDPSNRRNILCDEPLKALFGVNSINMFQMNKALSKHIWPLESNDVIPAKSSQKEK  210

Query  538  --------------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSD  401
                          ++K+G++E   DSD  +     +E+KRQ   K G +GFLAP+ LSD
Sbjct  211  QQKEKQPKEKPQKKRQKQGKEE---DSDDSA-----REDKRQ---KKGKSGFLAPLPLSD  259

Query  400  SLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTM  221
            +LV F GTGE+AL R DVVKRMW YIK+N LQDPS+KRR+ICD++L+EL +VDSF GFT+
Sbjct  260  ALVAFLGTGEDALPRSDVVKRMWDYIKQNNLQDPSDKRRIICDERLKELFDVDSFNGFTV  319

Query  220  TKLLTAHFIK  191
            +KLL  HFIK
Sbjct  320  SKLLATHFIK  329


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L +F G  E  ++R +VVK++W +I+EN LQDPSN+R ++CD+ L+ 
Sbjct  115  GGGFSKLCSLSPQLQEFIGATE--MARTEVVKQLWNHIRENNLQDPSNRRNILCDEPLKA  172

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  V+S   F M K L+ H 
Sbjct  173  LFGVNSINMFQMNKALSKHI  192



>ref|XP_003558997.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Brachypodium distachyon]
Length=334

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 16/178 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED-VTLVKSTPKE  542
            RENNLQDP  K++I+CDETL  +F+V +IDMF+MN+ L+KHIWP+  E   +  KSTPKE
Sbjct  171  RENNLQDPSNKRKILCDETLKKLFKVNSIDMFQMNKALTKHIWPLNSEGPASPKKSTPKE  230

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +K+ ++E                +K++ G    GTG  AP+QLSD L  F GTGE+ L
Sbjct  231  KPQKREKNE---------------GKKQKVGSSRPGTGLNAPLQLSDDLANFIGTGESML  275

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DVVK MW YIKEN LQDPS++R++ICD+KL+ L +VDSF GFT++KLL+ HF KT
Sbjct  276  SRSDVVKIMWDYIKENNLQDPSDRRKIICDEKLKNLFQVDSFTGFTVSKLLSPHFTKT  333


 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 9/97 (9%)
 Frame = -2

Query  466  EKRQRGLKGG-------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENEL  308
             KR+R L  G       G GF     +S +L +F G  E  L+R +VVK++W YI+EN L
Sbjct  118  HKRKRRLDKGNSDGKRKGGGFTKLCSISPTLQEFVGASE--LARTEVVKKLWAYIRENNL  175

Query  307  QDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            QDPSNKR+++CD+ L++L +V+S + F M K LT H 
Sbjct  176  QDPSNKRKILCDETLKKLFKVNSIDMFQMNKALTKHI  212



>ref|XP_009803136.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Nicotiana sylvestris]
Length=340

 Score =   193 bits (491),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 95/183 (52%), Positives = 131/183 (72%), Gaps = 13/183 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL------VK  557
            REN+LQ+P  ++ I CD+TL  +F V  IDMF+MN+ L+KHIWP++ + V+       V 
Sbjct  163  RENDLQEPSNRRNINCDDTLRELFGVDKIDMFQMNKALAKHIWPLDSDGVSTITTSGSVN  222

Query  556  STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT  377
            ST +E+     +     + D DSD EPK++EKR        +G LAP+QLSD+L+KF GT
Sbjct  223  STAREKNSTAKKKRQKQEEDEDSD-EPKRKEKRH------NSGILAPLQLSDALIKFLGT  275

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            GE+ L RG+VVKR+W YIK+N LQDPS+KR++ICD+KL+EL +VD+F GF ++KLLTAHF
Sbjct  276  GESELPRGNVVKRIWDYIKQNNLQDPSDKRKIICDEKLKELFDVDTFTGFGVSKLLTAHF  335

Query  196  IKT  188
            IK 
Sbjct  336  IKA  338


 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L KF  TGE  L+R +VVKRMW YI+EN+LQ+PSN+R + CDD LREL 
Sbjct  129  GFTKICSLSPQLQKF--TGEAELARTEVVKRMWNYIRENDLQEPSNRRNINCDDTLRELF  186

Query  250  EVDSFEGFTMTKLLTAHF  197
             VD  + F M K L  H 
Sbjct  187  GVDKIDMFQMNKALAKHI  204



>ref|XP_010028508.1| PREDICTED: DNA ligase 1 [Eucalyptus grandis]
 gb|KCW55248.1| hypothetical protein EUGRSUZ_I01179 [Eucalyptus grandis]
Length=469

 Score =   196 bits (498),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 131/176 (74%), Gaps = 14/176 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDPK K+ I+CDE+L  +F V TI+MF+MN+ LSKHIWP+   +     S  +ER
Sbjct  306  RANNLQDPKNKQNIVCDESLRSLFCVDTINMFQMNKALSKHIWPLNGGEAPEKNSLKEER  365

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             +        T  + + + + ++++KR       G+GF AP+ LSD+LVKFFGTGE+ALS
Sbjct  366  CQ-------ATRDEDEEEQKDEKQKKR-------GSGFTAPLPLSDALVKFFGTGESALS  411

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DVVKRMW YIK+N+LQDPS+KRRVICD+KLRELLEVDSF GF+++KLLTAHF+K
Sbjct  412  RADVVKRMWDYIKQNDLQDPSDKRRVICDEKLRELLEVDSFNGFSVSKLLTAHFVK  467


 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/205 (36%), Positives = 105/205 (51%), Gaps = 37/205 (18%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+ +LQDP  +++I+CDE+L  +F V +IDMF+MN+ L+KHIWP++ +D   +K T    
Sbjct  159  RQKDLQDPSNRRKILCDESLHKLFHVNSIDMFQMNKALAKHIWPLDADDENAIKKT----  214

Query  538  QRKKGRDEVYTDSDSDSDFEPK--------------------------QEEKRQRGLKGG  437
                 ++E   DS SD +                              +  K  +G+K  
Sbjct  215  -----KNEESVDSHSDGEVSNAMEEAEEDEQNENEEEEEMNGRRSKKGRSSKEDKGVKKR  269

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L     TGE  L+R +VVKR+W YI+ N LQDP NK+ ++CD+ LR 
Sbjct  270  GGGFNKLCSLSPQLQVV--TGEPDLARPEVVKRLWAYIRANNLQDPKNKQNIVCDESLRS  327

Query  256  LLEVDSFEGFTMTKLLTAHFIKTAG  182
            L  VD+   F M K L+ H     G
Sbjct  328  LFCVDTINMFQMNKALSKHIWPLNG  352


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L  F   GE+ L+R +VVKR+W +I++ +LQDPSN+R+++CD+ L +L 
Sbjct  125  GFNKLCSLSPQLQSF--VGESTLARTEVVKRIWNHIRQKDLQDPSNRRKILCDESLHKLF  182

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S + F M K L  H 
Sbjct  183  HVNSIDMFQMNKALAKHI  200



>ref|XP_010691015.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=335

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 129/186 (69%), Gaps = 12/186 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-EDVTLVKSTPKE  542
            +E +LQDPK ++ I CD+ L  IFRV TI+MF+MN++L+KHIWP+E  ED +     P +
Sbjct  149  KEKDLQDPKNRRNIKCDQMLHSIFRVDTINMFQMNKSLTKHIWPLESGEDCSTDAPAPAK  208

Query  541  RQRKKGRDEVYTDSDS---------DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVK  389
            +Q+ +  ++  TD+ +         D D E   E  +Q+  KG  TGFL P+QLSD+  K
Sbjct  209  KQKGQKDEDRSTDAPAPAKKQKRRKDEDTEKSNENTKQK--KGNATGFLKPLQLSDAFAK  266

Query  388  FFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLL  209
            F GTGE  + R D VKR+W YIK+N+LQDPS+KRR++CD+KL+EL +VD+F GFT++KLL
Sbjct  267  FLGTGETTIVRSDAVKRIWDYIKQNQLQDPSDKRRILCDEKLKELFDVDTFNGFTVSKLL  326

Query  208  TAHFIK  191
            +AH  K
Sbjct  327  SAHLTK  332


 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G+GF     LS  L +  G  E  ++R +VVK++W YIKE +LQDP N+R + CD  L  
Sbjct  113  GSGFTRLCSLSPQLQELVGVPE--MARTEVVKKLWAYIKEKDLQDPKNRRNIKCDQMLHS  170

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  VD+   F M K LT H 
Sbjct  171  IFRVDTINMFQMNKSLTKHI  190



>ref|XP_010096161.1| Upstream activation factor subunit spp27 [Morus notabilis]
 gb|EXB63556.1| Upstream activation factor subunit spp27 [Morus notabilis]
Length=463

 Score =   194 bits (492),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 139/177 (79%), Gaps = 3/177 (2%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +EN+LQDPK K+ IICDE+L  +F V  I+MF+MN+ L+KHIWP+  ++     S+ KE+
Sbjct  289  KENDLQDPKNKQNIICDESLRALFHVDRINMFQMNKALAKHIWPLNADNAVTENSSQKEK  348

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ ++E   +   +   EPK++EKRQ   K GG+GF AP+ LSD+LVKF GTGEN LS
Sbjct  349  QSKQEQEEEEEEDKEEDSDEPKKKEKRQ---KKGGSGFTAPLPLSDALVKFIGTGENTLS  405

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DVVKRMW+YIK+N+LQDPS+KRR++CDDKL+EL +VDSF GF++TKLLTAHF+KT
Sbjct  406  RADVVKRMWQYIKQNDLQDPSDKRRILCDDKLKELFDVDSFNGFSVTKLLTAHFVKT  462


 Score =   149 bits (376),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/198 (43%), Positives = 111/198 (56%), Gaps = 33/198 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            REN+LQDPK K+ IICDE+L  +FRV TI+MF+MN+ LSKHIWP+  ED  +       R
Sbjct  142  RENDLQDPKNKRNIICDESLQALFRVNTINMFQMNKALSKHIWPLSTEDENV-------R  194

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGL------------------------KGGGT  431
            Q+KK  D  +++S+ +S+   KQEE+ +                           K GG 
Sbjct  195  QKKKAEDIDHSESEEESNKAQKQEEEEEEEEEEDEKDSRRRKRKGRSAKVDKDVKKRGGG  254

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L  F G  E  L+R +VVK++W YIKEN+LQDP NK+ +ICD+ LR L 
Sbjct  255  GFAKVCSLSPQLQAFIGEAE--LARTEVVKKLWSYIKENDLQDPKNKQNIICDESLRALF  312

Query  250  EVDSFEGFTMTKLLTAHF  197
             VD    F M K L  H 
Sbjct  313  HVDRINMFQMNKALAKHI  330


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/115 (37%), Positives = 62/115 (54%), Gaps = 21/115 (18%)
 Frame = -2

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            R R+KGR               K+++ ++RG      GF     LS  L +  G  E  +
Sbjct  90   RGRRKGRSN-------------KEDKVKKRG------GFNKLCSLSPHLQEVVGEAE--M  128

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            SR +VVK++W YI+EN+LQDP NKR +ICD+ L+ L  V++   F M K L+ H 
Sbjct  129  SRPEVVKKLWSYIRENDLQDPKNKRNIICDESLQALFRVNTINMFQMNKALSKHI  183



>ref|XP_010691016.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=330

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 124/181 (69%), Gaps = 7/181 (4%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-EDVTLVKSTPKE  542
            +E +LQDPK ++ I CD+ L  IFRV TI+MF+MN++L+KHIWP+E  ED +     P +
Sbjct  149  KEKDLQDPKNRRNIKCDQMLHSIFRVDTINMFQMNKSLTKHIWPLESGEDCSTDAPAPAK  208

Query  541  RQRKKGRDEVYTDSDS----DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTG  374
            +Q+ +  D            D D E   E  +Q+  KG  TGFL P+QLSD+  KF GTG
Sbjct  209  KQKDRSTDAPAPAKKQKRRKDEDTEKSNENTKQK--KGNATGFLKPLQLSDAFAKFLGTG  266

Query  373  ENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            E  + R D VKR+W YIK+N+LQDPS+KRR++CD+KL+EL +VD+F GFT++KLL+AH  
Sbjct  267  ETTIVRSDAVKRIWDYIKQNQLQDPSDKRRILCDEKLKELFDVDTFNGFTVSKLLSAHLT  326

Query  193  K  191
            K
Sbjct  327  K  327


 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G+GF     LS  L +  G  E  ++R +VVK++W YIKE +LQDP N+R + CD  L  
Sbjct  113  GSGFTRLCSLSPQLQELVGVPE--MARTEVVKKLWAYIKEKDLQDPKNRRNIKCDQMLHS  170

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  VD+   F M K LT H 
Sbjct  171  IFRVDTINMFQMNKSLTKHI  190



>ref|XP_006650641.1| PREDICTED: upstream activation factor subunit spp27-like [Oryza 
brachyantha]
Length=338

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 126/181 (70%), Gaps = 19/181 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE----DVTLVKST  551
            REN+LQDP  KK+I+CDE L  IF V +IDMF+MN+ L+KHIWP+  E     V+  +ST
Sbjct  172  RENSLQDPNNKKKILCDERLKKIFNVNSIDMFQMNKALTKHIWPLNSEGPVTSVSPERST  231

Query  550  PKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGE  371
            PKE+ +K+ R+E        S                  +GFL P+QLSD LVKF GTGE
Sbjct  232  PKEKPQKRERNEGKKQKGGSSGSG---------------SGFLVPLQLSDDLVKFIGTGE  276

Query  370  NALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + LSR DVVKRMW YIKEN+LQDPS++R++ICD+KL++LL+V+SF GFT++KLL  HF K
Sbjct  277  SMLSRSDVVKRMWDYIKENKLQDPSDRRKIICDEKLKDLLQVESFNGFTVSKLLAPHFTK  336

Query  190  T  188
            T
Sbjct  337  T  337


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     +S +L +F G  E  L+R +VVK++W YI+EN LQDP+NK++++CD++L++
Sbjct  136  GGGFTKLCSISPTLQEFVGASE--LARTEVVKKLWAYIRENSLQDPNNKKKILCDERLKK  193

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  V+S + F M K LT H 
Sbjct  194  IFNVNSIDMFQMNKALTKHI  213



>dbj|BAB01706.1| unnamed protein product [Arabidopsis thaliana]
Length=452

 Score =   192 bits (487),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 130/177 (73%), Gaps = 11/177 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+   +F V++I+MF+MN+ L+KHIWP+E      V S    +
Sbjct  285  KENNLQDPNDKRSIICDESFRSLFPVESINMFQMNKQLTKHIWPLEDNAGESVSS----K  340

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K G+ ++ +D D+DS+ EP +++K+Q+         LAP+ LSD+LVKF G GEN+LS
Sbjct  341  SPKNGKQKMESDGDTDSE-EPNEKDKKQK------KEVLAPLPLSDALVKFLGDGENSLS  393

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DVVKR+W+YI  N+LQDPS+KRRVICD+KL+EL EVDSFE  +++KLLT HFIK 
Sbjct  394  RADVVKRLWEYINHNDLQDPSDKRRVICDEKLKELFEVDSFEDTSVSKLLTNHFIKA  450


 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/198 (41%), Positives = 108/198 (55%), Gaps = 30/198 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKSTPK  545
            RE +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+KHIWP+   D     VK    
Sbjct  135  REKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTKHIWPLGDGDGCANDVKEE-D  193

Query  544  ERQRKKGRDEVYTDSDSDSDFE----------------------PKQEEKRQRGLKGGGT  431
            E +  +G D+    S+   + +                       K  EK +R  KGGG 
Sbjct  194  EDEASEGTDKKGEQSEEVEENKEEESEEQEVRSLRKRKRKKNRPAKSVEKPKR--KGGG-  250

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L  F G  E  L+R +VVK +WKYIKEN LQDP++KR +ICD+  R L 
Sbjct  251  GFAKVCSLSPELQAFTGVTE--LARTEVVKLLWKYIKENNLQDPNDKRSIICDESFRSLF  308

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K LT H 
Sbjct  309  PVESINMFQMNKQLTKHI  326


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G G     QLS  L K  G  +  L R +VVK+MW YI+E +LQDP ++R+++CD+ L  
Sbjct  99   GGGITKVSQLSPQLEKVVGASQ--LGRTEVVKKMWAYIREKDLQDPKDRRKIVCDELLHS  156

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  V +   F M K LT H 
Sbjct  157  LFRVKTINMFQMNKALTKHI  176



>gb|ABF99032.1| SWIB complex BAF60b domain-containing protein, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEC76232.1| hypothetical protein OsI_13647 [Oryza sativa Indica Group]
 gb|EEE59982.1| hypothetical protein OsJ_12695 [Oryza sativa Japonica Group]
Length=334

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 95/181 (52%), Positives = 125/181 (69%), Gaps = 19/181 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE----DVTLVKST  551
            RENNLQDP  K++I+CDE L  IF V +IDMF+MN+ L+KHIWP+  +      +  +ST
Sbjct  168  RENNLQDPSNKRKILCDERLKKIFNVNSIDMFQMNKALTKHIWPLNSDGPVTSASPERST  227

Query  550  PKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGE  371
            PKE+ +K+ R+E        S                  +GFL P+QLSD LVKF GTGE
Sbjct  228  PKEKPQKRERNEGKKQKGGSSGSG---------------SGFLVPLQLSDDLVKFIGTGE  272

Query  370  NALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + LSR DVVKRMW YIKEN+LQDPS++R++ICD+KL++LL+V+SF GFT++KLL  HF K
Sbjct  273  SMLSRSDVVKRMWDYIKENKLQDPSDRRKIICDEKLKDLLQVESFNGFTVSKLLAPHFTK  332

Query  190  T  188
            T
Sbjct  333  T  333


 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     +S +L +F G  E  L+R +VVK++W YI+EN LQDPSNKR+++CD++L++
Sbjct  132  GGGFTKLCSISPTLQEFVGASE--LARTEVVKKLWAYIRENNLQDPSNKRKILCDERLKK  189

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  V+S + F M K LT H 
Sbjct  190  IFNVNSIDMFQMNKALTKHI  209



>ref|NP_188538.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AEE76191.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=462

 Score =   188 bits (478),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 128/177 (72%), Gaps = 13/177 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+   +F V++I+MF+MN+ L+KHIWP+E      V S    +
Sbjct  297  KENNLQDPNDKRSIICDESFRSLFPVESINMFQMNKQLTKHIWPLEDNAGESVSS----K  352

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K G+ ++ +D DS+   EP +++K+Q+         LAP+ LSD+LVKF G GEN+LS
Sbjct  353  SPKNGKQKMESDGDSE---EPNEKDKKQK------KEVLAPLPLSDALVKFLGDGENSLS  403

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DVVKR+W+YI  N+LQDPS+KRRVICD+KL+EL EVDSFE  +++KLLT HFIK 
Sbjct  404  RADVVKRLWEYINHNDLQDPSDKRRVICDEKLKELFEVDSFEDTSVSKLLTNHFIKA  460


 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/195 (43%), Positives = 104/195 (53%), Gaps = 26/195 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKST--  551
            RE +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+KHIWP+   D     VK    
Sbjct  149  REKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTKHIWPLGDGDGCANDVKEEDE  208

Query  550  --PKERQRKKGRDE---------------VYTDSDSDSDFEPKQEEKRQRGLKGGGTGFL  422
                E   KKG                  V +          K  EK +R  KGGG GF 
Sbjct  209  DEASEGTDKKGEQSEEVEENKEEESEEQEVRSLRKRKRKKPAKSVEKPKR--KGGG-GFA  265

Query  421  APIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVD  242
                LS  L  F G  E  L+R +VVK +WKYIKEN LQDP++KR +ICD+  R L  V+
Sbjct  266  KVCSLSPELQAFTGVTE--LARTEVVKLLWKYIKENNLQDPNDKRSIICDESFRSLFPVE  323

Query  241  SFEGFTMTKLLTAHF  197
            S   F M K LT H 
Sbjct  324  SINMFQMNKQLTKHI  338


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 4/83 (5%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            +GGG   ++  QLS  L K  G  +  L R +VVK+MW YI+E +LQDP ++R+++CD+ 
Sbjct  112  RGGGITKVS--QLSPQLEKVVGASQ--LGRTEVVKKMWAYIREKDLQDPKDRRKIVCDEL  167

Query  265  LRELLEVDSFEGFTMTKLLTAHF  197
            L  L  V +   F M K LT H 
Sbjct  168  LHSLFRVKTINMFQMNKALTKHI  190



>emb|CDX99270.1| BnaC05g33850D [Brassica napus]
Length=464

 Score =   184 bits (467),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 134/179 (75%), Gaps = 13/179 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE-KEDVTLVKSTPKE  542
            +ENNLQDPK  + IICDE+L  +F +++I+MF+MN+ L+KHIWP+E     +   S+PK 
Sbjct  293  KENNLQDPKDGRTIICDESLRSLFPLESINMFQMNKHLTKHIWPLEDNAGESGGSSSPKN  352

Query  541  RQRKKGRDEVYTDSD--SDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             + K   ++  T+SD  +++D +PK+E          G G LAP+ LSD+L+KF G GE+
Sbjct  353  GKLKMETEDGDTESDELNENDEKPKKE----------GCGLLAPLPLSDALIKFLGDGES  402

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            +LSR DVVKR+W+YI++N+LQDPS+K+R+ICD+KL+EL EVDSFE  +++KLLT+H+IK
Sbjct  403  SLSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKELFEVDSFEDISVSKLLTSHYIK  461


 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 104/192 (54%), Gaps = 23/192 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            +E +LQDPK +++I+CDE+L  +F VK I+MF+MN+ L+KHIWP+       VT VK   
Sbjct  148  KEKDLQDPKDRRKILCDESLHSLFHVKAINMFQMNKALAKHIWPLGDGGDGCVTSVKEEE  207

Query  547  KERQRKKGRDE---------------VYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPI  413
             E    + RDE               V            K EEK +R  KGGG GF    
Sbjct  208  DEGDASEERDEKGDKTEEMEEDDEEEVRNLRKRKRKKPAKSEEKPKR--KGGG-GFAKVC  264

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKYIKEN LQDP + R +ICD+ LR L  ++S  
Sbjct  265  SLSPELQAF--TGMTKLARTEVVKMLWKYIKENNLQDPKDGRTIICDESLRSLFPLESIN  322

Query  232  GFTMTKLLTAHF  197
             F M K LT H 
Sbjct  323  MFQMNKHLTKHI  334


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            K GG GF    QLS  L KF GT +  L+R +VVK+MW YIKE +LQDP ++R+++CD+ 
Sbjct  109  KRGGGGFAKVCQLSPQLEKFIGTSQ--LARTEVVKKMWAYIKEKDLQDPKDRRKILCDES  166

Query  265  LRELLEVDSFEGFTMTKLLTAHF  197
            L  L  V +   F M K L  H 
Sbjct  167  LHSLFHVKAINMFQMNKALAKHI  189



>ref|XP_009145829.1| PREDICTED: uncharacterized protein LOC103869495 [Brassica rapa]
Length=451

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 133/179 (74%), Gaps = 13/179 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE-KEDVTLVKSTPKE  542
            +ENNLQDPK  + IICDE+L  +F +++I+MF+MN+ LSKHIWP+E     +   S+PK 
Sbjct  280  KENNLQDPKDGRTIICDESLRSLFPLESINMFQMNKHLSKHIWPLEDNAGESGGSSSPKN  339

Query  541  RQRKKGRDEVYTDSD--SDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             + K   ++  T+SD  +++D +PK+E          G G LAP+ LSD+L+KF G GE+
Sbjct  340  GKLKMETEDGDTESDELNENDEKPKKE----------GCGLLAPLPLSDALIKFLGDGES  389

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + SR DVVKR+W+YI++N+LQDPS+K+R+ICD+KL+EL EVDSFE  +++KLLT+H+IK
Sbjct  390  SFSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKELFEVDSFEDISVSKLLTSHYIK  448


 Score =   125 bits (314),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 104/195 (53%), Gaps = 26/195 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKS-----  554
            +E +LQDPK +++I+CDE+L  +F VK I+MF+MN+ L+KHIWP+       V S     
Sbjct  132  KEKDLQDPKDRRKILCDESLHSLFHVKAINMFQMNKALAKHIWPLGDGGDGCVTSLKEED  191

Query  553  ---TPKERQRKKGR-------------DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFL  422
                  ER  K G+             +EV            K EEK +R  KGGG GF 
Sbjct  192  EADASGERDEKGGKAEEMEEDNEEESEEEVRNLRKRKRKKPAKSEEKPKR--KGGG-GFA  248

Query  421  APIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVD  242
                LS  L  F  TG   L+R +VVK +WKYIKEN LQDP + R +ICD+ LR L  ++
Sbjct  249  KVCSLSPELQAF--TGMTKLARTEVVKMLWKYIKENNLQDPKDGRTIICDESLRSLFPLE  306

Query  241  SFEGFTMTKLLTAHF  197
            S   F M K L+ H 
Sbjct  307  SINMFQMNKHLSKHI  321


 Score = 80.9 bits (198),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            K GG GF    QLS  L KF GT +  L+R +VVK+MW YIKE +LQDP ++R+++CD+ 
Sbjct  93   KRGGGGFAKVCQLSPQLEKFIGTSQ--LARTEVVKKMWAYIKEKDLQDPKDRRKILCDES  150

Query  265  LRELLEVDSFEGFTMTKLLTAHF  197
            L  L  V +   F M K L  H 
Sbjct  151  LHSLFHVKAINMFQMNKALAKHI  173



>emb|CDX92300.1| BnaA05g21070D [Brassica napus]
Length=452

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 133/179 (74%), Gaps = 13/179 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE-KEDVTLVKSTPKE  542
            +ENNLQDPK  + IICDE+L  +F +++I+MF+MN+ LSKHIWP+E     +   S+PK 
Sbjct  281  KENNLQDPKDGRTIICDESLRSLFPLESINMFQMNKHLSKHIWPLEDNAGESGGSSSPKN  340

Query  541  RQRKKGRDEVYTDSD--SDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             + K   ++  T+SD  +++D +PK+E          G G LAP+ LSD+L+KF G GE+
Sbjct  341  GKLKMETEDGDTESDELNENDEKPKKE----------GCGLLAPLPLSDALIKFLGDGES  390

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + SR DVVKR+W+YI++N+LQDPS+K+R+ICD+KL+EL EVDSFE  +++KLLT+H+IK
Sbjct  391  SFSRADVVKRLWEYIEQNDLQDPSDKKRIICDEKLKELFEVDSFEDISVSKLLTSHYIK  449


 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/196 (41%), Positives = 103/196 (53%), Gaps = 27/196 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            +E +LQDPK +++I+CDE+L  +F VK I+MF+MN+ L+KHIWP+       VT VK   
Sbjct  132  KEKDLQDPKDRRKILCDESLHSLFHVKAINMFQMNKALAKHIWPLGDGGDGCVTSVKEEE  191

Query  547  KERQRKKGRDE-------------------VYTDSDSDSDFEPKQEEKRQRGLKGGGTGF  425
             E      RDE                   V            K EEK +R  KGGG GF
Sbjct  192  DEGDASGERDEKGEKAEEREEDNEEESEEEVRNLRKRKRKKPAKSEEKPKR--KGGG-GF  248

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
                 LS  L  F  TG   L+R +VVK +WKYIKEN LQDP + R +ICD+ LR L  +
Sbjct  249  AKVCSLSPELQAF--TGMTKLARTEVVKMLWKYIKENNLQDPKDGRTIICDESLRSLFPL  306

Query  244  DSFEGFTMTKLLTAHF  197
            +S   F M K L+ H 
Sbjct  307  ESINMFQMNKHLSKHI  322


 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            K GG GF    QLS  L KF G+ +  L+R +VVK+MW YIKE +LQDP ++R+++CD+ 
Sbjct  93   KRGGGGFAKVCQLSPQLEKFIGSSQ--LARTEVVKKMWVYIKEKDLQDPKDRRKILCDES  150

Query  265  LRELLEVDSFEGFTMTKLLTAHF  197
            L  L  V +   F M K L  H 
Sbjct  151  LHSLFHVKAINMFQMNKALAKHI  173



>ref|XP_004981658.1| PREDICTED: upstream activation factor subunit spp27-like [Setaria 
italica]
Length=332

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 129/178 (72%), Gaps = 16/178 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE-DVTLVKSTPKE  542
            RE+NLQD   K++I+ DE L  IF V +IDMF+MN+ L+KHIWP+  E  V+  +STPKE
Sbjct  169  REHNLQDQSNKRKILPDERLRKIFNVNSIDMFQMNKALTKHIWPLNSEGPVSPDRSTPKE  228

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +K+ R+E                +K++ G  G G+G L P+QLS+ LVKF GTGE+ L
Sbjct  229  KPQKRDRNE---------------GKKQKGGSSGAGSGLLVPLQLSNDLVKFIGTGESML  273

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DVVKRMW+YIKEN LQDPS++R++ICD+KL++LL+V+SF GFT++KLL  HF KT
Sbjct  274  SRSDVVKRMWEYIKENNLQDPSDRRKIICDEKLKDLLQVESFNGFTVSKLLAPHFTKT  331


 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 2/77 (3%)
 Frame = -2

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS +L +F G  E  L+R +VVK++W YI+E+ LQD SNKR+++ D++LR++  
Sbjct  136  FTKLCSLSPALQEFVGASE--LARTEVVKKLWAYIREHNLQDQSNKRKILPDERLRKIFN  193

Query  247  VDSFEGFTMTKLLTAHF  197
            V+S + F M K LT H 
Sbjct  194  VNSIDMFQMNKALTKHI  210



>gb|KFK39235.1| hypothetical protein AALP_AA3G218000 [Arabis alpina]
Length=470

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 131/178 (74%), Gaps = 12/178 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE-KEDVTLVKSTPK-  545
            +EN LQDP   +RIICDE+L  +F  ++I+MF+MN+ L+KHIWP+E     ++  ++PK 
Sbjct  300  KENKLQDPNDGRRIICDESLQSLFSFESINMFQMNKLLTKHIWPLEDNAGESVCSNSPKI  359

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            E+Q         T++D D++ +   E+ +++ +KG     LAP+ LSD+LVKF G  E++
Sbjct  360  EKQN--------TETDEDTESDKLNEKDKKQKIKG--CALLAPLSLSDALVKFLGNEESS  409

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            LSR DVVKR+W+YIK+N+LQDPS+KRR+ICD+KL+EL EVDSFE  +++KLLT HFIK
Sbjct  410  LSRADVVKRLWEYIKQNDLQDPSDKRRIICDEKLKELFEVDSFEDISVSKLLTNHFIK  467


 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 115/201 (57%), Gaps = 29/201 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVK----  557
            RE  LQDPK ++RI+CDE+L  +F VK+I+MF+M++ LSKHIWP+   D  V  VK    
Sbjct  143  REKELQDPKDRRRILCDESLRSLFNVKSINMFQMSKALSKHIWPLGDGDGCVNSVKEEED  202

Query  556  ------------STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQR---------GLKG  440
                        ++ K+ ++ +  ++V   ++ +S+ E +   KR+R           + 
Sbjct  203  DDDDDEEEDEDIASVKKAEKVEENEQVEESTEEESEEEVRSLRKRKRKDPAKSVEKPKRK  262

Query  439  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  260
            GG GF     LS  L  F G  E  L+R +VVK +W+YIKEN+LQDP++ RR+ICD+ L+
Sbjct  263  GGGGFTKVCSLSPELQAFTGVTE--LARTEVVKMLWRYIKENKLQDPNDGRRIICDESLQ  320

Query  259  ELLEVDSFEGFTMTKLLTAHF  197
             L   +S   F M KLLT H 
Sbjct  321  SLFSFESINMFQMNKLLTKHI  341


 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 51/119 (43%), Positives = 71/119 (60%), Gaps = 10/119 (8%)
 Frame = -2

Query  553  TPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTG  374
            TPK +   +G DE+ ++SD D +  P + +KR       G GF    QLS  L  F GT 
Sbjct  76   TPKPKAETEG-DEIGSESDQDKEQRPVKAKKR-------GNGFTKVCQLSPKLGDFIGTS  127

Query  373  ENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +  L+R +VVK+MW YI+E ELQDP ++RR++CD+ LR L  V S   F M+K L+ H 
Sbjct  128  Q--LARTEVVKKMWVYIREKELQDPKDRRRILCDESLRSLFNVKSINMFQMSKALSKHI  184



>ref|NP_001147426.1| LOC100281035 [Zea mays]
 gb|ACG27473.1| SWIB/MDM2 domain containing protein [Zea mays]
 gb|AFW67526.1| SWIB/MDM2 domain containing protein [Zea mays]
Length=328

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 127/178 (71%), Gaps = 16/178 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE-DVTLVKSTPKE  542
            RENNLQD   +++I+ DE L  IF V +IDMF+MN+ L+KHIWP+  E  V+  +STPKE
Sbjct  165  RENNLQDQNNRRKILPDERLKKIFNVNSIDMFQMNKALTKHIWPLNSEGPVSPDRSTPKE  224

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +KK R+E                +K++ G  G G+G L P+QLSD L+KF GTGE+ L
Sbjct  225  KPQKKDRNE---------------GKKQKGGSSGAGSGLLVPLQLSDDLMKFIGTGESML  269

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DVVKRMW YIKEN LQDPS++R++ICD+KL++LL V++F GFT++KLL  HF KT
Sbjct  270  SRSDVVKRMWDYIKENNLQDPSDRRKIICDEKLKDLLGVETFTGFTVSKLLAPHFTKT  327


 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query  463  KRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W YI+EN LQD +N+
Sbjct  118  KKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWAYIRENNLQDQNNR  175

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R+++ D++L+++  V+S + F M K LT H 
Sbjct  176  RKILPDERLKKIFNVNSIDMFQMNKALTKHI  206



>ref|XP_002466401.1| hypothetical protein SORBIDRAFT_01g007140 [Sorghum bicolor]
 gb|EER93399.1| hypothetical protein SORBIDRAFT_01g007140 [Sorghum bicolor]
Length=326

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 127/178 (71%), Gaps = 16/178 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED-VTLVKSTPKE  542
            RENNLQD   +++I+ DE L  IF V +IDMF+MN+ L+KHIWP+  E  V+  +STPKE
Sbjct  163  RENNLQDQNNRRKILPDERLRKIFNVNSIDMFQMNKALTKHIWPLNSEGPVSPDRSTPKE  222

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +K+ R+E                +K++ G  G G+G L P+QLSD LVKF GTGE+ L
Sbjct  223  KPQKRDRNE---------------GKKQKGGSSGAGSGLLVPLQLSDDLVKFIGTGESML  267

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DVVK+MW YIKEN LQDPS++R++ICD+KL++LL V++F GFT++KLL  HF KT
Sbjct  268  SRSDVVKKMWDYIKENNLQDPSDRRKIICDEKLKDLLGVETFTGFTVSKLLAPHFTKT  325


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query  463  KRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W YI+EN LQD +N+
Sbjct  116  KKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWAYIRENNLQDQNNR  173

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R+++ D++LR++  V+S + F M K LT H 
Sbjct  174  RKILPDERLRKIFNVNSIDMFQMNKALTKHI  204



>gb|AGT16365.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
 gb|AGT16695.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
Length=332

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 126/178 (71%), Gaps = 16/178 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED-VTLVKSTPKE  542
            RENNLQD   +++I+ DE L  IF V +IDMF+MN+ L+KHIWP+  E  V+  +STPKE
Sbjct  169  RENNLQDQNNRRKILPDERLRKIFNVNSIDMFQMNKALTKHIWPLNSEGPVSPDRSTPKE  228

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +K+ R+E                +K + G  G G+G L P+QLSD LVKF GTGE+ L
Sbjct  229  KPQKRDRNE---------------GKKPKGGSSGAGSGLLVPLQLSDDLVKFIGTGESML  273

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DVVK+MW YIKEN LQDPS++R++ICD+KL++LL V++F GFT++KLL  HF KT
Sbjct  274  SRSDVVKKMWDYIKENNLQDPSDRRKIICDEKLKDLLGVETFTGFTVSKLLAPHFTKT  331


 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query  463  KRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W YI+EN LQD +N+
Sbjct  122  KKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWAYIRENNLQDQNNR  179

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R+++ D++LR++  V+S + F M K LT H 
Sbjct  180  RKILPDERLRKIFNVNSIDMFQMNKALTKHI  210



>gb|AGT16808.1| SWIB/MDM2 domain containing protein [Saccharum hybrid cultivar 
R570]
Length=326

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 126/178 (71%), Gaps = 16/178 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED-VTLVKSTPKE  542
            RENNLQD   +++I+ DE L  +F V +IDMF+MN+ L+KHIWP+  E  V+  +STPKE
Sbjct  163  RENNLQDQNNRRKILPDERLRKVFNVNSIDMFQMNKALTKHIWPLNSEGPVSPDRSTPKE  222

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +K+ R+E                +K + G  G G+G L P+QLSD LVKF GTGE+ L
Sbjct  223  KPQKRDRNE---------------GKKPKGGSSGAGSGLLVPLQLSDDLVKFIGTGESML  267

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DVVK+MW YIKEN LQDPS++R++ICD+KL++LL V++F GFT++KLL  HF KT
Sbjct  268  SRSDVVKKMWDYIKENNLQDPSDRRKIICDEKLKDLLGVETFTGFTVSKLLAPHFTKT  325


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query  463  KRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W YI+EN LQD +N+
Sbjct  116  KKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWAYIRENNLQDQNNR  173

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R+++ D++LR++  V+S + F M K LT H 
Sbjct  174  RKILPDERLRKVFNVNSIDMFQMNKALTKHI  204



>ref|NP_001148210.1| SWIB/MDM2 domain containing protein [Zea mays]
 gb|ACG30187.1| SWIB/MDM2 domain containing protein [Zea mays]
Length=329

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/178 (52%), Positives = 125/178 (70%), Gaps = 16/178 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED-VTLVKSTPKE  542
            RENNLQD   +++I+ DE L  IF V +IDMF+MN+ L+KHIWP+  E  V+  +STPKE
Sbjct  166  RENNLQDQNNRRKILPDERLKKIFNVNSIDMFQMNKALTKHIWPLNSEGPVSPDRSTPKE  225

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +K+ R E                +K++ G  G G+GFL P+QLSD LVKF GTGE+ L
Sbjct  226  KPQKRDRSE---------------GKKQKGGSSGAGSGFLVPLQLSDDLVKFIGTGESML  270

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DVVK+MW YIK N LQDPS++R++ICD+KL++L  V++F GFT++KLL  HF KT
Sbjct  271  SRSDVVKKMWDYIKGNNLQDPSDRRKIICDEKLKDLFGVETFTGFTVSKLLAPHFTKT  328


 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query  463  KRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W YI+EN LQD +N+
Sbjct  119  KKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWAYIRENNLQDQNNR  176

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R+++ D++L+++  V+S + F M K LT H 
Sbjct  177  RKILPDERLKKIFNVNSIDMFQMNKALTKHI  207



>ref|XP_002977839.1| hypothetical protein SELMODRAFT_176439 [Selaginella moellendorffii]
 gb|EFJ21177.1| hypothetical protein SELMODRAFT_176439 [Selaginella moellendorffii]
Length=342

 Score =   173 bits (438),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 118/178 (66%), Gaps = 4/178 (2%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R +NLQDP+ K+ IICD+ L  +F     DMF+MN+ LSKHIW I +E         +  
Sbjct  169  RAHNLQDPENKRNIICDDPLRELFGTDQTDMFQMNKLLSKHIWTITEEGECFGFCASQNG  228

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K    + + D     D EPK + +++   KG  +GFL P  +SD+L KFFGTGE+ ++
Sbjct  229  DHK----DCFLDCAGAEDSEPKTKRQKKDSGKGKASGFLVPSPISDALQKFFGTGESEVT  284

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTA  185
            R +VVKR+W YI+ N+LQDP++K++++CD+KL+EL E DSF GFTM KLL +HF+ ++
Sbjct  285  RSEVVKRIWDYIRSNQLQDPTDKKKILCDNKLQELFECDSFLGFTMPKLLASHFVTSS  342


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 56/157 (36%), Positives = 80/157 (51%), Gaps = 21/157 (13%)
 Frame = -2

Query  583  EKEDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLS  404
            E++  T   S P +++ ++ R+ +     +  D  PK+++KR      GG   L   +LS
Sbjct  95   EEQQGTAEDSLPNDQELEQFRENIEL---AIEDSTPKEKKKR------GGLNKLC--RLS  143

Query  403  DSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFT  224
              L    G  E +L R  VVK++W YI+ + LQDP NKR +ICDD LREL   D  + F 
Sbjct  144  PELQAIIG--EESLPRTQVVKQLWVYIRAHNLQDPENKRNIICDDPLRELFGTDQTDMFQ  201

Query  223  MTKLLTAHF--IKTAG*CYLTFLAT*K-----CLLSC  134
            M KLL+ H   I   G C+  F A+       C L C
Sbjct  202  MNKLLSKHIWTITEEGECF-GFCASQNGDHKDCFLDC  237



>ref|XP_010536330.1| PREDICTED: synaptonemal complex protein 1 isoform X5 [Tarenaya 
hassleriana]
Length=1056

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 132/176 (75%), Gaps = 14/176 (8%)
 Frame = -2

Query  718   RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
             +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK++         ++
Sbjct  894   KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDE---------DK  944

Query  538   QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
               K G+ ++ T+ +SD   E +++EKRQ   K GG+G L P+ LSD+LVKF GTGEN+LS
Sbjct  945   PLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGLLIPLPLSDALVKFLGTGENSLS  999

Query  358   RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             R DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +VD+F  F+++KLLT HFIK
Sbjct  1000  RADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDVDTFNSFSVSKLLTNHFIK  1055


 Score =   140 bits (352),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 82/192 (43%), Positives = 112/192 (58%), Gaps = 20/192 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP------------IEKE  575
            RE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSKHIWP            +E E
Sbjct  152  REKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSKHIWPLSDGDGGVNNEKVEDE  211

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAPI  413
            D    ++  KE Q ++ ++     S+ + +    ++ KR++  K        G GF    
Sbjct  212  DDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRRKSAKSDQKTTKRGGGFAKVC  271

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKYIKEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  272  GLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSIN  329

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  330  MFQMTKHLSKHI  341


 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 108/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  449  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVNGGVNNVKVEDE  508

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +        + +   ++ ++R R  K        G GF   
Sbjct  509  DDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAKRRNRSAKSDQNTTKRGCGFAKV  568

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  569  CCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  626

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  627  NMFQMTKHLSKHI  639


 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 109/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  745  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVKGGVNNVKVEDE  804

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +      + + +   ++ ++R R  K        G GF   
Sbjct  805  DDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQRRNRPAKSDRKTTKRGGGFAKV  864

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  865  CGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  922

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  923  NMFQMTKHLSKHI  935


 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 21/192 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK------------E  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK            E
Sbjct  598  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDEGGVDNVKVEDE  657

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR------QRGLKGGGTGFLAPI  413
            D    ++  KE Q ++  +      + + +   ++ +KR      Q+  K GG GF    
Sbjct  658  DDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKKRKSAKSDQKTTKKGG-GFAKVC  716

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  717  GLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSIN  774

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  775  MFQMTKHLSKHI  786


 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 103/193 (53%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK----------EDV  569
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW  E+          ED 
Sbjct  300  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRPEEVKGGVNNVKVEDE  359

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG---------GTGFLAP  416
              V    + R+ +    E   +   + + + +   K +R  +           G GF   
Sbjct  360  DDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAKRINRSAKSDEKTTKRGGGFAKV  419

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  420  CGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSI  477

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  478  NMFQMTKHLSKHI  490


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  472  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  293
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  292  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536329.1| PREDICTED: calponin homology domain-containing protein DDB_G0272472 
isoform X4 [Tarenaya hassleriana]
Length=1056

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 132/176 (75%), Gaps = 14/176 (8%)
 Frame = -2

Query  718   RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
             +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK++         ++
Sbjct  894   KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDE---------DK  944

Query  538   QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
               K G+ ++ T+ +SD   E +++EKRQ   K GG+G L P+ LSD+LVKF GTGEN+LS
Sbjct  945   PLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGLLIPLPLSDALVKFLGTGENSLS  999

Query  358   RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             R DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +VD+F  F+++KLLT HFIK
Sbjct  1000  RADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDVDTFNSFSVSKLLTNHFIK  1055


 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 113/194 (58%), Gaps = 23/194 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP------------IEKE  575
            RE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSKHIWP            +E E
Sbjct  152  REKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSKHIWPLSDGDGGVNNEKVEDE  211

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR--------QRGLKGGGTGFLA  419
            D    ++  KE Q ++ ++     S+ + +    ++ KR        Q+  K GG GF  
Sbjct  212  DDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRRNRSAKSDQKTTKRGG-GFAK  270

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F  TG   L+R +VVK +WKYIKEN LQDPS+KR++ICD+ LR L  VDS
Sbjct  271  VCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDS  328

Query  238  FEGFTMTKLLTAHF  197
               F MTK L+ H 
Sbjct  329  INMFQMTKHLSKHI  342


 Score =   130 bits (326),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 20/192 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW------------PIEKE  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW             +E E
Sbjct  450  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVNGGVNNVKVEDE  509

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAPI  413
            D    ++  KE Q ++  +     S+ + +    ++ KR++  K        G GF    
Sbjct  510  DDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAKRRKSAKSDQNTTKRGCGFAKVC  569

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  570  CLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSIN  627

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  628  MFQMTKHLSKHI  639


 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 109/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  745  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVKGGVNNVKVEDE  804

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +      + + +   ++ ++R R  K        G GF   
Sbjct  805  DDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQRRNRPAKSDRKTTKRGGGFAKV  864

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  865  CGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  922

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  923  NMFQMTKHLSKHI  935


 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 21/192 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK------------E  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK            E
Sbjct  598  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDEGGVDNVKVEDE  657

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR------QRGLKGGGTGFLAPI  413
            D    ++  KE Q ++  +      + + +   ++ +KR      Q+  K GG GF    
Sbjct  658  DDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKKRKSAKSDQKTTKKGG-GFAKVC  716

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  717  GLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSIN  774

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  775  MFQMTKHLSKHI  786


 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 103/193 (53%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK----------EDV  569
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW  E+          ED 
Sbjct  301  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRPEEVKGGVNNVKVEDE  360

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG---------GTGFLAP  416
              V    + R+ +    E   +   + + + +   K +R  +           G GF   
Sbjct  361  DDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAKRINRSAKSDEKTTKRGGGFAKV  420

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  421  CGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSI  478

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  479  NMFQMTKHLSKHI  491


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  472  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  293
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  292  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536328.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X3 [Tarenaya hassleriana]
Length=1056

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 132/176 (75%), Gaps = 14/176 (8%)
 Frame = -2

Query  718   RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
             +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK++         ++
Sbjct  894   KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDE---------DK  944

Query  538   QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
               K G+ ++ T+ +SD   E +++EKRQ   K GG+G L P+ LSD+LVKF GTGEN+LS
Sbjct  945   PLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGLLIPLPLSDALVKFLGTGENSLS  999

Query  358   RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             R DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +VD+F  F+++KLLT HFIK
Sbjct  1000  RADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDVDTFNSFSVSKLLTNHFIK  1055


 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 113/194 (58%), Gaps = 23/194 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP------------IEKE  575
            RE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSKHIWP            +E E
Sbjct  152  REKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSKHIWPLSDGDGGVNNEKVEDE  211

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR--------QRGLKGGGTGFLA  419
            D    ++  KE Q ++ ++     S+ + +    ++ KR        Q+  K GG GF  
Sbjct  212  DDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRRNRSAKSDQKTTKRGG-GFAK  270

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F  TG   L+R +VVK +WKYIKEN LQDPS+KR++ICD+ LR L  VDS
Sbjct  271  VCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDS  328

Query  238  FEGFTMTKLLTAHF  197
               F MTK L+ H 
Sbjct  329  INMFQMTKHLSKHI  342


 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 108/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  449  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVNGGVNNVKVEDE  508

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +        + +   ++ ++R R  K        G GF   
Sbjct  509  DDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAKRRNRSAKSDQNTTKRGCGFAKV  568

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  569  CCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  626

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  627  NMFQMTKHLSKHI  639


 Score =   129 bits (324),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 109/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  745  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVKGGVNNVKVEDE  804

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +      + + +   ++ ++R R  K        G GF   
Sbjct  805  DDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQRRNRPAKSDRKTTKRGGGFAKV  864

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  865  CGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  922

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  923  NMFQMTKHLSKHI  935


 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 21/192 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK------------E  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK            E
Sbjct  598  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDEGGVDNVKVEDE  657

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR------QRGLKGGGTGFLAPI  413
            D    ++  KE Q ++  +      + + +   ++ +KR      Q+  K GG GF    
Sbjct  658  DDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKKRKSAKSDQKTTKKGG-GFAKVC  716

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  717  GLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSIN  774

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  775  MFQMTKHLSKHI  786


 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 76/192 (40%), Positives = 104/192 (54%), Gaps = 20/192 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW------------PIEKE  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW             +E E
Sbjct  301  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRPEEVKGGVNNVKVEDE  360

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAPI  413
            D    ++  +E Q ++  +      + +      ++ KR +  K        G GF    
Sbjct  361  DDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAKRIKSAKSDEKTTKRGGGFAKVC  420

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  421  GLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSIN  478

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  479  MFQMTKHLSKHI  490


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  472  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  293
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  292  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536327.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X2 [Tarenaya hassleriana]
Length=1056

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 132/176 (75%), Gaps = 14/176 (8%)
 Frame = -2

Query  718   RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
             +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK++         ++
Sbjct  894   KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDE---------DK  944

Query  538   QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
               K G+ ++ T+ +SD   E +++EKRQ   K GG+G L P+ LSD+LVKF GTGEN+LS
Sbjct  945   PLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGLLIPLPLSDALVKFLGTGENSLS  999

Query  358   RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             R DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +VD+F  F+++KLLT HFIK
Sbjct  1000  RADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDVDTFNSFSVSKLLTNHFIK  1055


 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 113/194 (58%), Gaps = 23/194 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP------------IEKE  575
            RE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSKHIWP            +E E
Sbjct  152  REKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSKHIWPLSDGDGGVNNEKVEDE  211

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR--------QRGLKGGGTGFLA  419
            D    ++  KE Q ++ ++     S+ + +    ++ KR        Q+  K GG GF  
Sbjct  212  DDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRRNRSAKSDQKTTKRGG-GFAK  270

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F  TG   L+R +VVK +WKYIKEN LQDPS+KR++ICD+ LR L  VDS
Sbjct  271  VCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDS  328

Query  238  FEGFTMTKLLTAHF  197
               F MTK L+ H 
Sbjct  329  INMFQMTKHLSKHI  342


 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 108/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  450  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVNGGVNNVKVEDE  509

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +        + +   ++ ++R R  K        G GF   
Sbjct  510  DDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAKRRNRSAKSDQNTTKRGCGFAKV  569

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  570  CCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  627

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  628  NMFQMTKHLSKHI  640


 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 21/192 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK------------E  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK            E
Sbjct  599  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDEGGVDNVKVEDE  658

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR------QRGLKGGGTGFLAPI  413
            D    ++  KE Q ++  +      + + +   ++ +KR      Q+  K GG GF    
Sbjct  659  DDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKKRKSAKSDQKTTKKGG-GFAKVC  717

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  718  GLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSIN  775

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  776  MFQMTKHLSKHI  787


 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/192 (41%), Positives = 109/192 (57%), Gaps = 20/192 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIW------------PIEKE  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW             +E E
Sbjct  746  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVKGGVNNVKVEDE  805

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAPI  413
            D    ++  KE Q ++  +      + + +    ++ +R++  K        G GF    
Sbjct  806  DDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQRRKPAKSDRKTTKRGGGFAKVC  865

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  866  GLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSIN  923

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  924  MFQMTKHLSKHI  935


 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 103/193 (53%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK----------EDV  569
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW  E+          ED 
Sbjct  301  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRPEEVKGGVNNVKVEDE  360

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG---------GTGFLAP  416
              V    + R+ +    E   +   + + + +   K +R  +           G GF   
Sbjct  361  DDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAKRINRSAKSDEKTTKRGGGFAKV  420

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  421  CGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSI  478

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  479  NMFQMTKHLSKHI  491


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  472  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  293
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  292  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010536324.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X1 [Tarenaya hassleriana]
 ref|XP_010536326.1| PREDICTED: golgin subfamily A member 6-like protein 22 isoform 
X1 [Tarenaya hassleriana]
Length=1057

 Score =   181 bits (458),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/176 (54%), Positives = 132/176 (75%), Gaps = 14/176 (8%)
 Frame = -2

Query  718   RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
             +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK++         ++
Sbjct  895   KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDE---------DK  945

Query  538   QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
               K G+ ++ T+ +SD   E +++EKRQ   K GG+G L P+ LSD+LVKF GTGEN+LS
Sbjct  946   PLKNGKRKLETEEESDD--ETEEKEKRQ---KKGGSGLLIPLPLSDALVKFLGTGENSLS  1000

Query  358   RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             R DV KR W YIK+N+LQDPS+KRR++CD+KL+EL +VD+F  F+++KLLT HFIK
Sbjct  1001  RADVTKRFWDYIKQNDLQDPSDKRRILCDEKLKELFDVDTFNSFSVSKLLTNHFIK  1056


 Score =   138 bits (347),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 84/194 (43%), Positives = 113/194 (58%), Gaps = 23/194 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP------------IEKE  575
            RE NLQDPK K+ IICDE+L  +F+VK I+MF+M++ LSKHIWP            +E E
Sbjct  152  REKNLQDPKNKRNIICDESLHSLFKVKAINMFQMSKALSKHIWPLSDGDGGVNNEKVEDE  211

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR--------QRGLKGGGTGFLA  419
            D    ++  KE Q ++ ++     S+ + +    ++ KR        Q+  K GG GF  
Sbjct  212  DDVSDETEGKEEQNEEAKENDEEQSEEEEENRSVRKTKRRNRSAKSDQKTTKRGG-GFAK  270

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F  TG   L+R +VVK +WKYIKEN LQDPS+KR++ICD+ LR L  VDS
Sbjct  271  VCGLSPELQAF--TGMTELARTEVVKMLWKYIKENNLQDPSDKRKIICDEALRSLFPVDS  328

Query  238  FEGFTMTKLLTAHF  197
               F MTK L+ H 
Sbjct  329  INMFQMTKHLSKHI  342


 Score =   130 bits (327),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 108/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  450  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVNGGVNNVKVEDE  509

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +        + +   ++ ++R R  K        G GF   
Sbjct  510  DDVSDETEGKEEQNEEAEENGEEQSEKEEENRSVRKAKRRNRSAKSDQNTTKRGCGFAKV  569

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  570  CCLSPELQAF--TGMNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  627

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  628  NMFQMTKHLSKHI  640


 Score =   129 bits (325),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/193 (40%), Positives = 109/193 (56%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK-------------  578
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW +E+             
Sbjct  746  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRLEEVKGGVNNVKVEDE  805

Query  577  EDVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG------GTGFLAP  416
            +DV+      +E+  +   +      + + +   ++ ++R R  K        G GF   
Sbjct  806  DDVSDETEGKEEQNEEAEENGEAQREEEEENRSVRKAQRRNRPAKSDRKTTKRGGGFAKV  865

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG N L+R +VVKR+WKYIKEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  866  CGLSPELQAF--TGVNELARTEVVKRLWKYIKENNLQDPSDKRKIICDEALRSLFPVDSI  923

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  924  NMFQMTKHLSKHI  936


 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/192 (42%), Positives = 110/192 (57%), Gaps = 21/192 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK------------E  575
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIWP+EK            E
Sbjct  599  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWPLEKDEGGVDNVKVEDE  658

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR------QRGLKGGGTGFLAPI  413
            D    ++  KE Q ++  +      + + +   ++ +KR      Q+  K GG GF    
Sbjct  659  DDVSDETEGKEEQNEEAEENGEEQREEEENRSVRKVKKRKSAKSDQKTTKKGG-GFAKVC  717

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS  
Sbjct  718  GLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSIN  775

Query  232  GFTMTKLLTAHF  197
             F MTK L+ H 
Sbjct  776  MFQMTKHLSKHI  787


 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 76/193 (39%), Positives = 103/193 (53%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEK----------EDV  569
            +ENNLQDP  K++IICDE L  +F V +I+MF+M + LSKHIW  E+          ED 
Sbjct  301  KENNLQDPSDKRKIICDEALRSLFPVDSINMFQMTKHLSKHIWRPEEVKGGVNNVKVEDE  360

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGG---------GTGFLAP  416
              V    + R+ +    E   +   + + + +   K +R  +           G GF   
Sbjct  361  DDVSDETEGREEQNEEAEENGEEQREEEEKNRSVRKAKRINRSAKSDEKTTKRGGGFAKV  420

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F  TG   L+R +VVK +WKY KEN LQDPS+KR++ICD+ LR L  VDS 
Sbjct  421  CGLSPELQAF--TGMTELARTEVVKMLWKYAKENNLQDPSDKRKIICDEALRSLFPVDSI  478

Query  235  EGFTMTKLLTAHF  197
              F MTK L+ H 
Sbjct  479  NMFQMTKHLSKHI  491


 Score = 76.3 bits (186),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  472  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  293
            ++E+  +  K  G GF    QLS  L  F G+ +  L+R +VVK++W YI+E  LQDP N
Sbjct  104  KKERAGKAKKRRGGGFSKLWQLSPQLENFIGSSQ--LARTEVVKKIWAYIREKNLQDPKN  161

Query  292  KRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            KR +ICD+ L  L +V +   F M+K L+ H 
Sbjct  162  KRNIICDESLHSLFKVKAINMFQMSKALSKHI  193



>ref|XP_010680445.1| PREDICTED: uncharacterized protein LOC104895589 [Beta vulgaris 
subsp. vulgaris]
Length=320

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 124/176 (70%), Gaps = 18/176 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+ NLQDP   K I+CDETL  +  V +I++ ++N+ L+KHI P        VKS  +++
Sbjct  162  RDKNLQDPHDGKSIMCDETLRELLGVGSINILQINKALTKHISPS-------VKSMKRDK  214

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R+E          +E + +EKRQ+ +    +GFLAP+ LS +L+KF GTGE+AL+
Sbjct  215  QRKQEREEDL--------YEAELKEKRQKKVY---SGFLAPLPLSHTLIKFLGTGESALT  263

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R DV+KR+W+YIK N LQDP NK+ VICD+KL+EL  VDSF GFT++KLL+AHF+K
Sbjct  264  RADVIKRVWEYIKINNLQDPFNKKTVICDEKLKELFNVDSFHGFTVSKLLSAHFVK  319


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/71 (42%), Positives = 43/71 (61%), Gaps = 2/71 (3%)
 Frame = -2

Query  409  LSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEG  230
            LS  L KF G     ++R +VVKR+W Y+++  LQDP + + ++CD+ LRELL V S   
Sbjct  135  LSPELQKFLGVPH--MTRTEVVKRLWSYVRDKNLQDPHDGKSIMCDETLRELLGVGSINI  192

Query  229  FTMTKLLTAHF  197
              + K LT H 
Sbjct  193  LQINKALTKHI  203



>gb|EYU44365.1| hypothetical protein MIMGU_mgv1a025674mg [Erythranthe guttata]
Length=305

 Score =   168 bits (426),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 115/176 (65%), Gaps = 32/176 (18%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  ++ IICD+TL  +F V +IDMF+MN++L+KHIWP+               
Sbjct  159  KENNLQDPSNRRTIICDDTLRNLFEVDSIDMFQMNKSLAKHIWPL---------------  203

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                          SDSD    +EE  ++  +  G  FL P++LSD+LVKF GTGE+ L 
Sbjct  204  -------------GSDSD----EEEPERKEKRPRGAAFLVPLKLSDALVKFLGTGESELP  246

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            R +VVKR+W YIK N LQDPS+KR+++CD+KL+EL  VD+F GFT+ KLLTAH IK
Sbjct  247  RSNVVKRIWDYIKLNNLQDPSDKRQILCDEKLKELFNVDTFHGFTVAKLLTAHIIK  302


 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -2

Query  439  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  260
            GG GF     LS  L KF G  E  L+R +VV+++W YIKEN LQDPSN+R +ICDD LR
Sbjct  122  GGGGFTKLCTLSPELQKFTGVPE--LARTEVVRQLWSYIKENNLQDPSNRRTIICDDTLR  179

Query  259  ELLEVDSFEGFTMTKLLTAHF  197
             L EVDS + F M K L  H 
Sbjct  180  NLFEVDSIDMFQMNKSLAKHI  200



>ref|XP_002883161.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH59420.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=463

 Score =   171 bits (432),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 89/178 (50%), Positives = 125/178 (70%), Gaps = 14/178 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F  ++I+MF+M++ L+KHIWP+E      V S     
Sbjct  297  KENNLQDPNDKRIIICDESLRSLFPFESINMFQMSKLLTKHIWPLEDNAGESVSSN----  352

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT-GENAL  362
              K G+ ++ +D DS+   EP +++K+Q+         LAP+ LS +LVKF G  GE++L
Sbjct  353  SPKNGKQKMESDGDSE---EPNEKDKKQK------KEVLAPLPLSVALVKFLGNNGESSL  403

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            SR DV KR+W+YIK+N+LQDPS+KRR+ICD+KL+EL EVDSFE  + + LLT HFIK 
Sbjct  404  SRADVGKRLWEYIKQNDLQDPSDKRRIICDEKLKELFEVDSFEDTSFSTLLTNHFIKA  461


 Score =   130 bits (326),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/195 (44%), Positives = 110/195 (56%), Gaps = 26/195 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKSTPK  545
            REN+LQDPK +++I+CDE L  +FRVKTI+MF+M++ L+KHIWP+   D     VK   +
Sbjct  149  RENDLQDPKDRRKIVCDELLHSLFRVKTINMFQMSKALTKHIWPLGDGDGCANNVKEEDE  208

Query  544  ERQR----KKG---------------RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFL  422
            E       KKG                +EV +          K  EK +R  KGGG GF 
Sbjct  209  EEASEGTDKKGDQSEEVEENKEEESEEEEVRSLRKRKRKKPAKSVEKPKR--KGGG-GFA  265

Query  421  APIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVD  242
                LS  L  F G  E  L+R +VVK +WKYIKEN LQDP++KR +ICD+ LR L   +
Sbjct  266  KVCSLSPELQAFTGVTE--LARTEVVKMLWKYIKENNLQDPNDKRIIICDESLRSLFPFE  323

Query  241  SFEGFTMTKLLTAHF  197
            S   F M+KLLT H 
Sbjct  324  SINMFQMSKLLTKHI  338


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF    QLS  L K  G  +  L R +VVK+MW YI+EN+LQDP ++R+++CD+ L  
Sbjct  113  GGGFTKVSQLSPQLEKVVGASQ--LGRTEVVKKMWAYIRENDLQDPKDRRKIVCDELLHS  170

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  V +   F M+K LT H 
Sbjct  171  LFRVKTINMFQMSKALTKHI  190



>ref|XP_002979488.1| hypothetical protein SELMODRAFT_419232 [Selaginella moellendorffii]
 gb|EFJ19377.1| hypothetical protein SELMODRAFT_419232 [Selaginella moellendorffii]
Length=320

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 26/178 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R +NLQDP+ K+ IICD+ L  +F     DMF+MN+ LSKHIW I +E            
Sbjct  169  RAHNLQDPENKRNIICDDPLRELFGTDQTDMFQMNKLLSKHIWTITEEGA----------  218

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                             D EPK + +++   KG  +GFL P  +SD+L KFFGTGE+ ++
Sbjct  219  ----------------EDSEPKTKRQKKDSGKGKASGFLVPSPISDALQKFFGTGESEVT  262

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTA  185
            R +VVKR+W YI+ N+LQDP++K++++CD+KL+EL E DSF GFTM KLL +HF+ ++
Sbjct  263  RSEVVKRIWDYIRSNQLQDPTDKKKILCDNKLQELFECDSFLGFTMPKLLASHFVTSS  320


 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 55/97 (57%), Gaps = 10/97 (10%)
 Frame = -2

Query  487  DFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENEL  308
            D  PK+++KR      GG   L   +LS  L    G  E +L R  VVK++W YI+ + L
Sbjct  124  DSTPKEKKKR------GGLNKLC--RLSPELQAIIG--EESLPRTQVVKQLWVYIRAHNL  173

Query  307  QDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            QDP NKR +ICDD LREL   D  + F M KLL+ H 
Sbjct  174  QDPENKRNIICDDPLRELFGTDQTDMFQMNKLLSKHI  210



>gb|KDO79318.1| hypothetical protein CISIN_1g0196442mg, partial [Citrus sinensis]
Length=180

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 103/138 (75%), Gaps = 11/138 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  48   REKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKALSKHIWPLDSDDVISVKSTPKEK  107

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E   D D     EP ++EKRQ   KGG +GFLAP+QLSD+L+KF GTGE+AL 
Sbjct  108  QRKQERTE---DLD-----EPTRKEKRQ---KGGKSGFLAPLQLSDALIKFLGTGESALP  156

Query  358  RGDVVKRMWKYIKENELQ  305
            R DV+KRMW YIKE  LQ
Sbjct  157  RSDVIKRMWDYIKEKNLQ  174


 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  L+R +VVK++W YI+E +LQDP+N+R ++CD+
Sbjct  8    VKKRGGGFSKLCALSPQLQEFIGVTE--LARTEVVKQLWAYIREKDLQDPNNRRNIVCDE  65

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  VD+   F M K L+ H 
Sbjct  66   RLRALFGVDTINMFQMNKALSKHI  89



>gb|KDO79319.1| hypothetical protein CISIN_1g0196442mg, partial [Citrus sinensis]
Length=179

 Score =   161 bits (407),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 103/138 (75%), Gaps = 11/138 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ I+CDE L  +F V TI+MF+MN+ LSKHIWP++ +DV  VKSTPKE+
Sbjct  48   REKDLQDPNNRRNIVCDERLRALFGVDTINMFQMNKALSKHIWPLDSDDVISVKSTPKEK  107

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E   D D     EP ++EKRQ   KGG +GFLAP+QLSD+L+KF GTGE+AL 
Sbjct  108  QRKQERTE---DLD-----EPTRKEKRQ---KGGKSGFLAPLQLSDALIKFLGTGESALP  156

Query  358  RGDVVKRMWKYIKENELQ  305
            R DV+KRMW YIKE  LQ
Sbjct  157  RSDVIKRMWDYIKEKNLQ  174


 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  448  LKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDD  269
            +K  G GF     LS  L +F G  E  L+R +VVK++W YI+E +LQDP+N+R ++CD+
Sbjct  8    VKKRGGGFSKLCALSPQLQEFIGVTE--LARTEVVKQLWAYIREKDLQDPNNRRNIVCDE  65

Query  268  KLRELLEVDSFEGFTMTKLLTAHF  197
            +LR L  VD+   F M K L+ H 
Sbjct  66   RLRALFGVDTINMFQMNKALSKHI  89



>gb|AFW67527.1| hypothetical protein ZEAMMB73_352797 [Zea mays]
Length=316

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 85/177 (48%), Positives = 111/177 (63%), Gaps = 26/177 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQD   +++I+ DE L  IF V +IDMF+MN+ L+KHIWP+  E       +P   
Sbjct  165  RENNLQDQNNRRKILPDERLKKIFNVNSIDMFQMNKALTKHIWPLNSEGPV----SPDRS  220

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             RKK +                             +G L P+QLSD L+KF GTGE+ LS
Sbjct  221  TRKKQKGGSSGAG----------------------SGLLVPLQLSDDLMKFIGTGESMLS  258

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DVVKRMW YIKEN LQDPS++R++ICD+KL++LL V++F GFT++KLL  HF KT
Sbjct  259  RSDVVKRMWDYIKENNLQDPSDRRKIICDEKLKDLLGVETFTGFTVSKLLAPHFTKT  315


 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 59/91 (65%), Gaps = 4/91 (4%)
 Frame = -2

Query  463  KRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            K+QRG  G   G GF     LS +L +F G  E  L+R +VVK++W YI+EN LQD +N+
Sbjct  118  KKQRGNDGKKRGGGFTKLCSLSPALQEFVGASE--LARTEVVKKLWAYIRENNLQDQNNR  175

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R+++ D++L+++  V+S + F M K LT H 
Sbjct  176  RKILPDERLKKIFNVNSIDMFQMNKALTKHI  206



>gb|ACJ85465.1| unknown [Medicago truncatula]
Length=320

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 86/161 (53%), Positives = 114/161 (71%), Gaps = 11/161 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ IICDE L  +F V TI+MF+MN+ L+KHIWP++ +DV  VKS PKE+
Sbjct  165  REKDLQDPNNRRNIICDEPLRALFGVDTINMFQMNKVLAKHIWPLDSDDVIQVKSAPKEK  224

Query  538  ------QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT  377
                    +K + +     D D D EPK +EKRQ+   G G GF+AP+QLSD+L KF   
Sbjct  225  PAPKEKPTRKEKKKKQEREDDDLD-EPKGKEKRQK--VGSGKGFIAPLQLSDALAKFL--  279

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  254
            GE+ LSR DV+KRMW YIK N LQDPS+KR+++CD+KL+EL
Sbjct  280  GESELSRSDVIKRMWDYIKGNNLQDPSDKRQILCDEKLKEL  320


 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 48/77 (62%), Gaps = 2/77 (3%)
 Frame = -2

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L +F G  E  ++R +VVK++W YI+E +LQDP+N+R +ICD+ LR L  
Sbjct  132  FCKICSLSPQLQEFVGAPE--MARTEVVKQLWAYIREKDLQDPNNRRNIICDEPLRALFG  189

Query  247  VDSFEGFTMTKLLTAHF  197
            VD+   F M K+L  H 
Sbjct  190  VDTINMFQMNKVLAKHI  206



>ref|XP_001768652.1| predicted protein [Physcomitrella patens]
 gb|EDQ66590.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   158 bits (399),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/181 (47%), Positives = 117/181 (65%), Gaps = 20/181 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE+NLQDP  K++IIC++ L  +    + DMF+MN+ LSKHI+P++       +ST    
Sbjct  139  REHNLQDPDDKRKIICNDALRNLLGTNSTDMFKMNKLLSKHIFPLDN------RSTGAA-  191

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG-----TGFLAPIQLSDSLVKFFGTG  374
               KGRD    D+D++ D EPK   K+Q+  K GG      GFLAP  +S+ L KF    
Sbjct  192  --AKGRDR---DTDTE-DAEPK--AKKQKADKSGGGKGKIVGFLAPCPISEQLAKFLDAE  243

Query  373  ENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +  +SR D VKR+W YIKEN LQDPSNK+ ++CD++L++L + D F GF +TKLLT HFI
Sbjct  244  DGKVSRADAVKRLWIYIKENNLQDPSNKKMIVCDEQLQDLFDCDHFVGFDLTKLLTRHFI  303

Query  193  K  191
            K
Sbjct  304  K  304


 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -2

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            GE  L R  VVK++W YI+E+ LQDP +KR++IC+D LR LL  +S + F M KLL+ H 
Sbjct  121  GEAELPRTQVVKQLWAYIREHNLQDPDDKRKIICNDALRNLLGTNSTDMFKMNKLLSKHI  180



>emb|CBI23284.3| unnamed protein product [Vitis vinifera]
Length=303

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 106/149 (71%), Gaps = 20/149 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDP  ++ IICDETL  +F V +I+MF+MN+ LSKHIWP++ +D   VK TPKE+
Sbjct  166  REKDLQDPNNRRNIICDETLRALFGVDSINMFQMNKALSKHIWPLDSDDAAPVKPTPKEK  225

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ RD    DSD     EPK+++KRQ   KGG +GFLAP+ LSD+LVKF    E+ALS
Sbjct  226  QRKQERD----DSD-----EPKRKQKRQ---KGGNSGFLAPLPLSDALVKFLNIEESALS  273

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICD  272
            R +VVK++W+YIK+N LQ        +CD
Sbjct  274  RAEVVKKIWEYIKQNNLQ--------VCD  294


 Score = 78.6 bits (192),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/90 (44%), Positives = 55/90 (61%), Gaps = 2/90 (2%)
 Frame = -2

Query  466  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  287
            +K  + +K  G GF     LS  L KF G  E  L+R +VVK++W +I+E +LQDP+N+R
Sbjct  120  KKSNKEVKKRGGGFCKLCSLSPELQKFIGVPE--LARTEVVKQLWVHIREKDLQDPNNRR  177

Query  286  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             +ICD+ LR L  VDS   F M K L+ H 
Sbjct  178  NIICDETLRALFGVDSINMFQMNKALSKHI  207



>ref|XP_010317157.1| PREDICTED: LOW QUALITY PROTEIN: upstream activation factor subunit 
spp27-like [Solanum lycopersicum]
Length=324

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 119/173 (69%), Gaps = 21/173 (12%)
 Frame = -2

Query  712  NNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKERQR  533
            N L++P  K+ I CD+TL  +F V++I+MF MN+ L+KHIWP++ +          ++QR
Sbjct  158  NELKNPSDKRIINCDDTLRELFGVESINMFAMNKALTKHIWPLDSD-------AANKKQR  210

Query  532  KKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRG  353
            K+  DE       D D EPK+EE+++       +G  AP++LS++L+ F GTGE+ +SR 
Sbjct  211  KQEEDE-------DLD-EPKKEEQQK------NSGMHAPLRLSNALINFLGTGESXISRP  256

Query  352  DVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             VVKR+W+YIK+N LQDPS++RRVICD+KL+E+  V++  G  +TKLL+ HFI
Sbjct  257  IVVKRIWEYIKQNGLQDPSDERRVICDEKLKEVFHVETHRGIGVTKLLSPHFI  309


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 57/95 (60%), Gaps = 3/95 (3%)
 Frame = -2

Query  481  EPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  302
            E K  +K + G +  G GF     LS  L K   TGE  L+R +VVKRMW+YI  NEL++
Sbjct  106  EKKPGKKNESGKRKAG-GFTKICSLSPQLQKI--TGEAELARTEVVKRMWQYINANELKN  162

Query  301  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            PS+KR + CDD LREL  V+S   F M K LT H 
Sbjct  163  PSDKRIINCDDTLRELFGVESINMFAMNKALTKHI  197



>ref|XP_010263743.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Nelumbo nucifera]
Length=365

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 102/138 (74%), Gaps = 12/138 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSKHI P++ ED   VKST KE+
Sbjct  164  REKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSKHIGPLDTEDAP-VKSTQKEK  222

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E       D++ EPKQ+EKRQ   KGG +GFLAP+ LS +LVKF GTGEN+LS
Sbjct  223  QRKQERKE-------DTN-EPKQKEKRQ---KGGNSGFLAPLPLSGALVKFLGTGENSLS  271

Query  358  RGDVVKRMWKYIKENELQ  305
            R  VVKRMW+YIK+N LQ
Sbjct  272  RASVVKRMWEYIKQNNLQ  289


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K   K  + +K  G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+
Sbjct  115  KSSNKLSKEVKKRGGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPN  172

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            NKR ++CD+KLR L  VDS   F M K L+ H 
Sbjct  173  NKRNIMCDEKLRSLFGVDSINMFQMNKALSKHI  205



>ref|XP_010263742.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Nelumbo nucifera]
Length=366

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 102/138 (74%), Gaps = 12/138 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  K+ I+CDE L  +F V +I+MF+MN+ LSKHI P++ ED   VKST KE+
Sbjct  165  REKNLQDPNNKRNIMCDEKLRSLFGVDSINMFQMNKALSKHIGPLDTEDAP-VKSTQKEK  223

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            QRK+ R E       D++ EPKQ+EKRQ   KGG +GFLAP+ LS +LVKF GTGEN+LS
Sbjct  224  QRKQERKE-------DTN-EPKQKEKRQ---KGGNSGFLAPLPLSGALVKFLGTGENSLS  272

Query  358  RGDVVKRMWKYIKENELQ  305
            R  VVKRMW+YIK+N LQ
Sbjct  273  RASVVKRMWEYIKQNNLQ  290


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 50/80 (63%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L KF G  E  ++R +VVK++W YI+E  LQDP+NKR ++CD+KLR 
Sbjct  129  GGGFTKLCTLSPQLKKFVGVPE--MARTEVVKQLWVYIREKNLQDPNNKRNIMCDEKLRS  186

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  VDS   F M K L+ H 
Sbjct  187  LFGVDSINMFQMNKALSKHI  206



>gb|KDP38240.1| hypothetical protein JCGZ_04883 [Jatropha curcas]
Length=238

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 100/138 (72%), Gaps = 14/138 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  +F V +I+MF+MN+ LSKHIWP+ +E      ++ KE+
Sbjct  111  RERNLQDPKNKQNIICDESLHALFHVNSINMFQMNKALSKHIWPLNEEVPN--NTSEKEK  168

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + K+ R+         SD EPKQ+EKRQ   K G +G LAP+ LSD+LVKFFGTGEN LS
Sbjct  169  RSKQPRE--------GSD-EPKQKEKRQ---KKGASGLLAPLPLSDALVKFFGTGENELS  216

Query  358  RGDVVKRMWKYIKENELQ  305
            R DVVKRMW YIK+N+LQ
Sbjct  217  RADVVKRMWGYIKQNDLQ  234


 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 48/80 (60%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L +F G  E+ L+R +VVKR+W YI+E  LQDP NK+ +ICD+ L  
Sbjct  75   GGGFTKLCSLSPQLQEFIG--ESELARTEVVKRLWAYIRERNLQDPKNKQNIICDESLHA  132

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  V+S   F M K L+ H 
Sbjct  133  LFHVNSINMFQMNKALSKHI  152



>gb|EMS67367.1| Upstream activation factor subunit spp27 [Triticum urartu]
Length=489

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 110/159 (69%), Gaps = 11/159 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVK--STPK  545
            RENNLQDP  +++I+CD+ L  IF V +IDMF+MN+ L+KHIWP++ +     K  STPK
Sbjct  237  RENNLQDPSNRRKILCDDNLKKIFNVNSIDMFQMNKALTKHIWPLDSDGPVSPKEKSTPK  296

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            E+   KG+ +    S+ +         K++ G  G  +G LAP+ LSD L KF GTGEN 
Sbjct  297  EKSTPKGKPQKRDRSEGN---------KQKGGSSGSTSGLLAPLVLSDDLAKFIGTGENM  347

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            LSR DVVKRMW YIK+N LQDPS++R++ICD+KL++L +
Sbjct  348  LSRSDVVKRMWDYIKDNNLQDPSDRRKIICDEKLKDLFQ  386


 Score = 80.1 bits (196),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 55/85 (65%), Gaps = 3/85 (4%)
 Frame = -2

Query  451  GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            G K  G GF     +S +L +F G  E A  R +VVK++W YI+EN LQDPSN+R+++CD
Sbjct  197  GKKKAG-GFTKLCSISPALQEFVGASECA--RTEVVKKLWAYIRENNLQDPSNRRKILCD  253

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
            D L+++  V+S + F M K LT H 
Sbjct  254  DNLKKIFNVNSIDMFQMNKALTKHI  278



>ref|XP_008236631.1| PREDICTED: upstream activation factor subunit UAF30 isoform X1 
[Prunus mume]
Length=364

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 116/204 (57%), Gaps = 34/204 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +ED  +       +
Sbjct  147  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSREDEPV-------K  199

Query  538  QRKKGRDEVYTDSDSDSD------------------FEPKQEEKRQRGLK-------GGG  434
            Q+KKG +  ++ S+ D +                     ++E K++R  K        GG
Sbjct  200  QKKKGEESDHSVSEGDVNNVAQEEEEVEEEEEEEEKVSKQKESKKRRAAKVDKEVKKRGG  259

Query  433  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  254
             GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDP+NKR +ICD+ LR L
Sbjct  260  GGFTKLCSLSPELQKFMGVPE--LARTEVVKKLWSYIRENNLQDPNNKREIICDESLRAL  317

Query  253  LEVDSFEGFTMTKLLTAHFIKTAG  182
             +VDS   F M K L+ H +   G
Sbjct  318  FDVDSINMFQMNKALSKHILPLNG  341


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VVKR+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  113  GFNKICSLSPQLQEFVGEPE--MARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLF  170

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K+L+ H 
Sbjct  171  RVNSINMFQMNKVLSKHI  188


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE  575
            RENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ LSKHI P+  E
Sbjct  295  RENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILPLNGE  342



>ref|XP_008236632.1| PREDICTED: upstream activation factor subunit UAF30 isoform X2 
[Prunus mume]
Length=363

 Score =   149 bits (376),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 82/204 (40%), Positives = 116/204 (57%), Gaps = 34/204 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +ED  +       +
Sbjct  147  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSREDEPV-------K  199

Query  538  QRKKGRDEVYTDSDSDSD------------------FEPKQEEKRQRGLK-------GGG  434
            Q+KKG +  ++ S+ D +                     ++E K++R  K        GG
Sbjct  200  QKKKGEESDHSVSEGDVNNVAQEEEEVEEEEEEEEKVSKQKESKKRRAAKVDKEVKKRGG  259

Query  433  TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLREL  254
             GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDP+NKR +ICD+ LR L
Sbjct  260  GGFTKLCSLSPELQKFMGVPE--LARTEVVKKLWSYIRENNLQDPNNKREIICDESLRAL  317

Query  253  LEVDSFEGFTMTKLLTAHFIKTAG  182
             +VDS   F M K L+ H +   G
Sbjct  318  FDVDSINMFQMNKALSKHILPLNG  341


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VVKR+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  113  GFNKICSLSPQLQEFVGEPE--MARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLF  170

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K+L+ H 
Sbjct  171  RVNSINMFQMNKVLSKHI  188


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 45/67 (67%), Gaps = 2/67 (3%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI--EKEDVTLVKSTPK  545
            RENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ LSKHI P+  E  D    K    
Sbjct  295  RENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILPLNGEAPDTASRKDKQS  354

Query  544  ERQRKKG  524
            E++ ++G
Sbjct  355  EQEHEEG  361



>ref|XP_007199917.1| hypothetical protein PRUPE_ppa007326mg [Prunus persica]
 gb|EMJ01116.1| hypothetical protein PRUPE_ppa007326mg [Prunus persica]
Length=373

 Score =   149 bits (376),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 82/205 (40%), Positives = 116/205 (57%), Gaps = 35/205 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +ED  +       +
Sbjct  147  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSREDEPV-------K  199

Query  538  QRKKGRDEVYTDSDSDSD-------------------FEPKQEEKRQRGLK-------GG  437
            Q+KKG +  ++ S+ D +                      ++E K++R  K        G
Sbjct  200  QKKKGEESDHSVSEGDVNNVAQEEEEVEEEEEEEEEKVSKQKESKKRRAAKVDKEVKKRG  259

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L KF G  E  L+R +VVK++W YI+EN LQDP+NKR +ICD+ LR 
Sbjct  260  GGGFTKLCSLSPELQKFMGVPE--LARTEVVKKLWSYIRENNLQDPNNKREIICDESLRA  317

Query  256  LLEVDSFEGFTMTKLLTAHFIKTAG  182
            L +VDS   F M K L+ H +   G
Sbjct  318  LFDVDSINMFQMNKALSKHILPLNG  342


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 52/85 (61%), Gaps = 9/85 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ LSKHI P+  E      + P   
Sbjct  296  RENNLQDPNNKREIICDESLRALFDVDSINMFQMNKALSKHILPLNGE------AAPDNA  349

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEE  464
             RK  + E   + DSD   +PKQ E
Sbjct  350  SRKDKQSEQEHEEDSD---DPKQNE  371


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VVKR+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  113  GFNKICSLSPQLQEFVGEPE--MARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLF  170

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K+L+ H 
Sbjct  171  RVNSINMFQMNKVLSKHI  188



>ref|XP_001767040.1| predicted protein [Physcomitrella patens]
 gb|EDQ68206.1| predicted protein [Physcomitrella patens]
Length=380

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 110/181 (61%), Gaps = 20/181 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE+NLQDP+ K++IICD+ L  +    + DMF+MN+ LS+HIWP+   D  + ++  K R
Sbjct  211  REHNLQDPEDKRKIICDDALRNLLGTNSTDMFKMNKLLSRHIWPL---DNGVTEAAAKVR  267

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG-----TGFLAPIQLSDSLVKFFGTG  374
             R               D EPK   K+Q+ +  GG      GFLAP  +SD L KF    
Sbjct  268  DRDT----------DTDDVEPK--PKKQKTVSSGGGKSKTQGFLAPYPISDQLAKFLDVE  315

Query  373  ENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +  +SR +  KRMW YIK++ LQDP+NK++++CD  L++LL+ D F GF ++KLL  HFI
Sbjct  316  DGKVSRAEAAKRMWAYIKDHNLQDPTNKKKILCDQPLQDLLDCDHFVGFDLSKLLKRHFI  375

Query  193  K  191
            K
Sbjct  376  K  376


 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -2

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            GE+ L R  VVK++W YI+E+ LQDP +KR++ICDD LR LL  +S + F M KLL+ H 
Sbjct  193  GESELPRTQVVKQLWAYIREHNLQDPEDKRKIICDDALRNLLGTNSTDMFKMNKLLSRHI  252



>gb|EMT28995.1| hypothetical protein F775_31871 [Aegilops tauschii]
Length=250

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 81/177 (46%), Positives = 108/177 (61%), Gaps = 24/177 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  +++I+CDE L  IF           + ++   W      V+  KSTPK +
Sbjct  97   RENNLQDPSNRRKILCDENLKKIFN-------SCRKIVALLAW--SSGPVSPKKSTPKAK  147

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             +K+ R E                 K++ G  G  +G LAP+ LSD L KF GTGE+ LS
Sbjct  148  PQKRDRSEA---------------NKQKGGSSGSTSGLLAPLVLSDDLAKFIGTGESMLS  192

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
            R DVVKRMW YIKEN LQDPS++R++ICD+KL++L +V+SF GFT++KLL  HF K 
Sbjct  193  RSDVVKRMWVYIKENNLQDPSDRRKIICDEKLKDLFQVESFTGFTVSKLLNPHFTKA  249


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 45/67 (67%), Gaps = 3/67 (4%)
 Frame = -2

Query  451  GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            G K  G GF     +S +L +F G  E A  R +VVK++W YI+EN LQDPSN+R+++CD
Sbjct  57   GKKKAG-GFTKLCSISPALQEFVGASECA--RTEVVKKLWAYIRENNLQDPSNRRKILCD  113

Query  271  DKLRELL  251
            + L+++ 
Sbjct  114  ENLKKIF  120



>ref|XP_010941848.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Elaeis guineensis]
Length=302

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/141 (52%), Positives = 92/141 (65%), Gaps = 10/141 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE--DVTLVKSTPK  545
            R+N+LQDP  +K IICD+TL  IF V TIDMF+MN+ LSKHIWP++ E    T V+S P 
Sbjct  163  RQNSLQDPNNRKNIICDDTLQNIFNVSTIDMFQMNKALSKHIWPLDSEGGSSTTVRSEPT  222

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
                   R        S+   +P ++E+  +  KGG +G L P+ LSD LVKF GTGEN 
Sbjct  223  GGSSTTVR--------SEPKAKPHKKEREVKRQKGGSSGLLVPLPLSDDLVKFIGTGENT  274

Query  364  LSRGDVVKRMWKYIKENELQD  302
            LSR D VKRMW+YIK+N LQD
Sbjct  275  LSRSDAVKRMWEYIKQNNLQD  295


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS +L +F   GE+ L+R +VVK++W YI++N LQDP+N++ +ICDD L+ 
Sbjct  127  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQN  184

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  V + + F M K L+ H 
Sbjct  185  IFNVSTIDMFQMNKALSKHI  204



>ref|XP_009345973.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Pyrus x bretschneideri]
Length=363

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 114/198 (58%), Gaps = 32/198 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +ED  +       +
Sbjct  154  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSREDEPV-------K  206

Query  538  QRKKGRDEVYTDSDSD---------------SDFEPKQEEKRQRGLK--------GGGTG  428
            Q+KK  +  ++ S+ D                    ++E K++R  K        GGG G
Sbjct  207  QKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQKENKKRRSTKVDKEVKKRGGGGG  266

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +
Sbjct  267  FTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFD  324

Query  247  VDSFEGFTMTKLLTAHFI  194
            VD    F M K L+ H +
Sbjct  325  VDCINMFQMNKALSKHIL  342


 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL  563
            RENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ +E + +
Sbjct  300  RENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLSEEGLVI  351


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VVKR+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  120  GFNKICSLSPQLQEFVGVPE--MARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLF  177

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K+L+ H 
Sbjct  178  RVNSINMFQMNKVLSKHI  195



>ref|XP_009345971.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Pyrus x bretschneideri]
Length=369

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 114/198 (58%), Gaps = 32/198 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +ED  +       +
Sbjct  154  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSREDEPV-------K  206

Query  538  QRKKGRDEVYTDSDSD---------------SDFEPKQEEKRQRGLK--------GGGTG  428
            Q+KK  +  ++ S+ D                    ++E K++R  K        GGG G
Sbjct  207  QKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQKENKKRRSTKVDKEVKKRGGGGG  266

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +
Sbjct  267  FTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFD  324

Query  247  VDSFEGFTMTKLLTAHFI  194
            VD    F M K L+ H +
Sbjct  325  VDCINMFQMNKALSKHIL  342


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VVKR+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  120  GFNKICSLSPQLQEFVGVPE--MARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLF  177

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K+L+ H 
Sbjct  178  RVNSINMFQMNKVLSKHI  195


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE  575
            RENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ +E
Sbjct  300  RENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLSEE  347



>ref|XP_009345972.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Pyrus x bretschneideri]
Length=368

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 114/198 (58%), Gaps = 32/198 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +ED  +       +
Sbjct  154  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSREDEPV-------K  206

Query  538  QRKKGRDEVYTDSDSD---------------SDFEPKQEEKRQRGLK--------GGGTG  428
            Q+KK  +  ++ S+ D                    ++E K++R  K        GGG G
Sbjct  207  QKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQKENKKRRSTKVDKEVKKRGGGGG  266

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +
Sbjct  267  FTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFD  324

Query  247  VDSFEGFTMTKLLTAHFI  194
            VD    F M K L+ H +
Sbjct  325  VDCINMFQMNKALSKHIL  342


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VVKR+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  120  GFNKICSLSPQLQEFVGVPE--MARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLF  177

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K+L+ H 
Sbjct  178  RVNSINMFQMNKVLSKHI  195


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE  575
            RENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ +E
Sbjct  300  RENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLSEE  347



>ref|XP_011458329.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011458330.1| PREDICTED: upstream activation factor subunit spp27 isoform X1 
[Fragaria vesca subsp. vesca]
Length=394

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 112/197 (57%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ LSKHIWP+  +D   VK T KE 
Sbjct  160  REKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVLSKHIWPLNSQDGP-VKKTKKE-  217

Query  538  QRKKGRDEVYTDSDSDSDFEP-----------------KQEEKRQRG-----LKGGGTGF  425
               +  D   ++ D  +  E                  KQ +KR+       +K  G GF
Sbjct  218  ---EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNCKQTKKRRSAKVDKEVKKRGGGF  274

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
                 LS  L KF G  E  L+R +VVKR+W YI+EN LQDP+N+R +ICD+  R L +V
Sbjct  275  TKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDV  332

Query  244  DSFEGFTMTKLLTAHFI  194
            DS + F M K L+ H +
Sbjct  333  DSIDMFQMNKALSKHIL  349


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 54/90 (60%), Gaps = 4/90 (4%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+ +E   L  ++  E+
Sbjct  307  RENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPLNQE-AALENASQTEK  365

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  449
            Q +  ++      DSD   E    EKRQ+ 
Sbjct  366  QSEHEQEASIQHPDSD---EADHNEKRQKN  392


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -2

Query  445  KGGGT--GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            KGG    GF     LS  L    G  E  ++R +VVK++W YI+E +LQDP N+R +ICD
Sbjct  119  KGGAKRGGFKTVYSLSPQLQVVVGEPE--MARPEVVKKIWAYIREKDLQDPKNRRNIICD  176

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
            + L  +  V S + F M K+L+ H 
Sbjct  177  ETLHAVFHVKSIDMFKMNKVLSKHI  201



>ref|XP_011458333.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Fragaria vesca subsp. vesca]
 ref|XP_011458334.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Fragaria vesca subsp. vesca]
Length=387

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 112/197 (57%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ LSKHIWP+  +D   VK T KE 
Sbjct  160  REKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVLSKHIWPLNSQDGP-VKKTKKE-  217

Query  538  QRKKGRDEVYTDSDSDSDFEP-----------------KQEEKRQRG-----LKGGGTGF  425
               +  D   ++ D  +  E                  KQ +KR+       +K  G GF
Sbjct  218  ---EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNCKQTKKRRSAKVDKEVKKRGGGF  274

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
                 LS  L KF G  E  L+R +VVKR+W YI+EN LQDP+N+R +ICD+  R L +V
Sbjct  275  TKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDV  332

Query  244  DSFEGFTMTKLLTAHFI  194
            DS + F M K L+ H +
Sbjct  333  DSIDMFQMNKALSKHIL  349


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -2

Query  445  KGGGT--GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            KGG    GF     LS  L    G  E  ++R +VVK++W YI+E +LQDP N+R +ICD
Sbjct  119  KGGAKRGGFKTVYSLSPQLQVVVGEPE--MARPEVVKKIWAYIREKDLQDPKNRRNIICD  176

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
            + L  +  V S + F M K+L+ H 
Sbjct  177  ETLHAVFHVKSIDMFKMNKVLSKHI  201


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 11/90 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+ +E +     T K+ 
Sbjct  307  RENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPLNQEALENASQTEKQS  366

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  449
            +        +   DSD   E    EKRQ+ 
Sbjct  367  E--------HEQEDSD---EADHNEKRQKN  385



>ref|XP_004290311.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Fragaria vesca subsp. vesca]
 ref|XP_011458332.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Fragaria vesca subsp. vesca]
Length=388

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 112/197 (57%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ LSKHIWP+  +D   VK T KE 
Sbjct  160  REKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVLSKHIWPLNSQDGP-VKKTKKE-  217

Query  538  QRKKGRDEVYTDSDSDSDFEP-----------------KQEEKRQRG-----LKGGGTGF  425
               +  D   ++ D  +  E                  KQ +KR+       +K  G GF
Sbjct  218  ---EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNCKQTKKRRSAKVDKEVKKRGGGF  274

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
                 LS  L KF G  E  L+R +VVKR+W YI+EN LQDP+N+R +ICD+  R L +V
Sbjct  275  TKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDV  332

Query  244  DSFEGFTMTKLLTAHFI  194
            DS + F M K L+ H +
Sbjct  333  DSIDMFQMNKALSKHIL  349


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -2

Query  445  KGGGT--GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            KGG    GF     LS  L    G  E  ++R +VVK++W YI+E +LQDP N+R +ICD
Sbjct  119  KGGAKRGGFKTVYSLSPQLQVVVGEPE--MARPEVVKKIWAYIREKDLQDPKNRRNIICD  176

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
            + L  +  V S + F M K+L+ H 
Sbjct  177  ETLHAVFHVKSIDMFKMNKVLSKHI  201


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 10/90 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+ +E   L  ++  E+
Sbjct  307  RENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPLNQE-AALENASQTEK  365

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  449
            Q +      +   DSD   E    EKRQ+ 
Sbjct  366  QSE------HEQEDSD---EADHNEKRQKN  386



>gb|KHN36203.1| Upstream activation factor subunit spp27 [Glycine soja]
Length=354

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 93/138 (67%), Gaps = 20/138 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDP  ++ IICDE L  +F V +I+MF+MN+ LSKHIWP+E +D   + ++    
Sbjct  226  REKNLQDPNNRRNIICDERLRSLFNVNSINMFQMNKALSKHIWPLESDDAYCIITS----  281

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                      TDSD     E K++EKRQ+G  GG +GFLAP+QLSD+LV F GTGE+ L+
Sbjct  282  ---------MTDSD-----EAKKKEKRQKG--GGKSGFLAPLQLSDALVNFLGTGESELA  325

Query  358  RGDVVKRMWKYIKENELQ  305
            R DV+KRMW YIK N LQ
Sbjct  326  RTDVIKRMWDYIKGNNLQ  343


 Score = 73.2 bits (178),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L +F    E  ++R +VVK++W YI+E  LQDP+N+R +ICD++LR 
Sbjct  190  GGGFCKLCSLSPQLQEFMEAPE--MARTEVVKQLWVYIREKNLQDPNNRRNIICDERLRS  247

Query  256  LLEVDSFEGFTMTKLLTAH  200
            L  V+S   F M K L+ H
Sbjct  248  LFNVNSINMFQMNKALSKH  266



>ref|XP_011458331.1| PREDICTED: upstream activation factor subunit spp27 isoform X2 
[Fragaria vesca subsp. vesca]
Length=393

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 112/197 (57%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ LSKHIWP+  +D   VK T KE 
Sbjct  160  REKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVLSKHIWPLNSQDGP-VKKTKKE-  217

Query  538  QRKKGRDEVYTDSDSDSDFEP-----------------KQEEKRQRG-----LKGGGTGF  425
               +  D   ++ D  +  E                  KQ +KR+       +K  G GF
Sbjct  218  ---EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNCKQTKKRRSAKVDKEVKKRGGGF  274

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
                 LS  L KF G  E  L+R +VVKR+W YI+EN LQDP+N+R +ICD+  R L +V
Sbjct  275  TKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDV  332

Query  244  DSFEGFTMTKLLTAHFI  194
            DS + F M K L+ H +
Sbjct  333  DSIDMFQMNKALSKHIL  349


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 53/90 (59%), Gaps = 5/90 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+ +E +     T K+ 
Sbjct  307  RENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPLNQEALENASQTEKQS  366

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRG  449
            + ++     + DSD     E    EKRQ+ 
Sbjct  367  EHEQEASIQHPDSD-----EADHNEKRQKN  391


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -2

Query  445  KGGGT--GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            KGG    GF     LS  L    G  E  ++R +VVK++W YI+E +LQDP N+R +ICD
Sbjct  119  KGGAKRGGFKTVYSLSPQLQVVVGEPE--MARPEVVKKIWAYIREKDLQDPKNRRNIICD  176

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
            + L  +  V S + F M K+L+ H 
Sbjct  177  ETLHAVFHVKSIDMFKMNKVLSKHI  201



>ref|XP_010941846.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
 ref|XP_010941847.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Elaeis guineensis]
Length=323

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 72/140 (51%), Positives = 91/140 (65%), Gaps = 10/140 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE--DVTLVKSTPK  545
            R+N+LQDP  +K IICD+TL  IF V TIDMF+MN+ LSKHIWP++ E    T V+S P 
Sbjct  163  RQNSLQDPNNRKNIICDDTLQNIFNVSTIDMFQMNKALSKHIWPLDSEGGSSTTVRSEPT  222

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
                   R        S+   +P ++E+  +  KGG +G L P+ LSD LVKF GTGEN 
Sbjct  223  GGSSTTVR--------SEPKAKPHKKEREVKRQKGGSSGLLVPLPLSDDLVKFIGTGENT  274

Query  364  LSRGDVVKRMWKYIKENELQ  305
            LSR D VKRMW+YIK+N LQ
Sbjct  275  LSRSDAVKRMWEYIKQNNLQ  294


 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS +L +F   GE+ L+R +VVK++W YI++N LQDP+N++ +ICDD L+ 
Sbjct  127  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRQNSLQDPNNRKNIICDDTLQN  184

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  V + + F M K L+ H 
Sbjct  185  IFNVSTIDMFQMNKALSKHI  204



>ref|XP_011458335.1| PREDICTED: upstream activation factor subunit spp27 isoform X5 
[Fragaria vesca subsp. vesca]
Length=381

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/197 (43%), Positives = 112/197 (57%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ IICDETL  +F VK+IDMF+MN+ LSKHIWP+  +D   VK T KE 
Sbjct  160  REKDLQDPKNRRNIICDETLHAVFHVKSIDMFKMNKVLSKHIWPLNSQDGP-VKKTKKE-  217

Query  538  QRKKGRDEVYTDSDSDSDFEP-----------------KQEEKRQRG-----LKGGGTGF  425
               +  D   ++ D  +  E                  KQ +KR+       +K  G GF
Sbjct  218  ---EDSDHSLSEGDVSNVDEQEVEEEEEDVEKEKGSNCKQTKKRRSAKVDKEVKKRGGGF  274

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
                 LS  L KF G  E  L+R +VVKR+W YI+EN LQDP+N+R +ICD+  R L +V
Sbjct  275  TKLSSLSPELQKFTGASE--LARTEVVKRLWNYIRENNLQDPNNRRVIICDELFRTLFDV  332

Query  244  DSFEGFTMTKLLTAHFI  194
            DS + F M K L+ H +
Sbjct  333  DSIDMFQMNKALSKHIL  349


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -2

Query  445  KGGGT--GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            KGG    GF     LS  L    G  E  ++R +VVK++W YI+E +LQDP N+R +ICD
Sbjct  119  KGGAKRGGFKTVYSLSPQLQVVVGEPE--MARPEVVKKIWAYIREKDLQDPKNRRNIICD  176

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
            + L  +  V S + F M K+L+ H 
Sbjct  177  ETLHAVFHVKSIDMFKMNKVLSKHI  201


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL  563
            RENNLQDP  ++ IICDE    +F V +IDMF+MN+ LSKHI P+ +ED  L
Sbjct  307  RENNLQDPNNRRVIICDELFRTLFDVDSIDMFQMNKALSKHILPLNQEDHLL  358



>ref|XP_010999877.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X5 [Populus euphratica]
Length=407

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 31/194 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  E+ ++       +
Sbjct  154  RENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGENESV-------K  206

Query  538  QRKKGRDEVYTDSDSDSD-----------FEPKQEEKRQRG---------LKGGGTGFLA  419
            Q++K +D    DS S+ D            + +  E+ ++G         +K  G GF  
Sbjct  207  QKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERSKKGRRSAKVDEDVKKRGGGFTK  264

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L +F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR + +VDS
Sbjct  265  LCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDS  322

Query  238  FEGFTMTKLLTAHF  197
             + F M K LT H 
Sbjct  323  IDMFQMNKALTKHI  336


 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 9/89 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L+KHIW + +ED     S+PK++
Sbjct  295  REKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHIWAVSEEDAP-SNSSPKKK  353

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQR  452
              K+GR+E           EPKQ+EKRQ+
Sbjct  354  GIKQGREE--------GPDEPKQKEKRQK  374


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010999905.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X6 [Populus euphratica]
Length=393

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 31/194 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  E+ ++       +
Sbjct  154  RENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGENESV-------K  206

Query  538  QRKKGRDEVYTDSDSDSD-----------FEPKQEEKRQRG---------LKGGGTGFLA  419
            Q++K +D    DS S+ D            + +  E+ ++G         +K  G GF  
Sbjct  207  QKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERSKKGRRSAKVDEDVKKRGGGFTK  264

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L +F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR + +VDS
Sbjct  265  LCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDS  322

Query  238  FEGFTMTKLLTAHF  197
             + F M K LT H 
Sbjct  323  IDMFQMNKALTKHI  336


 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/89 (52%), Positives = 61/89 (69%), Gaps = 9/89 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L+KHIW + +ED     S+PK++
Sbjct  295  REKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHIWAVSEEDAP-SNSSPKKK  353

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQR  452
              K+GR+E           EPKQ+EKRQ+
Sbjct  354  GIKQGREE--------GPDEPKQKEKRQK  374


 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_006393249.1| hypothetical protein EUTSA_v10011568mg [Eutrema salsugineum]
 gb|ESQ30535.1| hypothetical protein EUTSA_v10011568mg [Eutrema salsugineum]
Length=384

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 86/195 (44%), Positives = 113/195 (58%), Gaps = 29/195 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE+ LQDPK ++ IICDE+L  +FRVKTI+MF+MN+ L+KHIWP+  +    V ++ KE 
Sbjct  137  REHELQDPKNRRNIICDESLYSLFRVKTINMFQMNKALAKHIWPLNGDGC--VNNSVKEE  194

Query  538  QRKKG---RDEVYTDSDSDSDFE------------------PKQEEKRQRGLKGGGTGFL  422
               +    RDE   D+  +++ E                   K EEK ++  KGGG  F 
Sbjct  195  NEDESSGERDEQNEDAGKNNEEEESDEEVDRSSRKRKKRKPAKSEEKPKK--KGGG--FT  250

Query  421  APIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVD  242
                LS  L  F GT +  L+R +VVK +W YIKEN LQDPS+KR +ICD+ LR L  VD
Sbjct  251  KICSLSPELQAFTGTPQ--LARTEVVKMLWSYIKENNLQDPSDKRTIICDESLRSLFPVD  308

Query  241  SFEGFTMTKLLTAHF  197
            S   F M KLLT H 
Sbjct  309  SINMFQMNKLLTKHI  323


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 8/96 (8%)
 Frame = -2

Query  469  EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            E K++RG      GF    QLS  L KF GT +  L+R +VVK+MW YI+E+ELQDP N+
Sbjct  96   EAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKMWAYIREHELQDPKNR  147

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            R +ICD+ L  L  V +   F M K L  H     G
Sbjct  148  RNIICDESLYSLFRVKTINMFQMNKALAKHIWPLNG  183


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 57/94 (61%), Gaps = 14/94 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ L+KHIWP+ +E+       PK+ 
Sbjct  282  KENNLQDPSDKRTIICDESLRSLFPVDSINMFQMNKLLTKHIWPLVQEEEVGTAHEPKKG  341

Query  538  QRK--------------KGRDEVYTDSDSDSDFE  479
            ++K              K + E+Y D+D  ++ E
Sbjct  342  KQKMEIDEGTANDPEKGKQKMEIYEDNDEAANEE  375



>ref|XP_010999870.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X4 [Populus euphratica]
Length=428

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 31/194 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  E+ ++       +
Sbjct  154  RENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGENESV-------K  206

Query  538  QRKKGRDEVYTDSDSDSD-----------FEPKQEEKRQRG---------LKGGGTGFLA  419
            Q++K +D    DS S+ D            + +  E+ ++G         +K  G GF  
Sbjct  207  QKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERSKKGRRSAKVDEDVKKRGGGFTK  264

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L +F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR + +VDS
Sbjct  265  LCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDS  322

Query  238  FEGFTMTKLLTAHF  197
             + F M K LT H 
Sbjct  323  IDMFQMNKALTKHI  336


 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 96/177 (54%), Gaps = 45/177 (25%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L+KHIW + +ED     S+PK++
Sbjct  295  REKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHIWAVSEEDAP-SNSSPKKK  353

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K+GR+E           EPKQ+EKRQ+ +         P +      +    G     
Sbjct  354  GIKQGREE--------GPDEPKQKEKRQKKV---------PHEPKKKEKQQKKAG-----  391

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
                                  KRR++CD KL+E+ EVDSF GFT +KLL+ HFIKT
Sbjct  392  ----------------------KRRIVCDKKLKEISEVDSFNGFTASKLLSLHFIKT  426


 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010999862.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Populus euphratica]
Length=438

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 31/194 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  E+ ++       +
Sbjct  154  RENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGENESV-------K  206

Query  538  QRKKGRDEVYTDSDSDSD-----------FEPKQEEKRQRG---------LKGGGTGFLA  419
            Q++K +D    DS S+ D            + +  E+ ++G         +K  G GF  
Sbjct  207  QKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERSKKGRRSAKVDEDVKKRGGGFTK  264

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L +F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR + +VDS
Sbjct  265  LCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDS  322

Query  238  FEGFTMTKLLTAHF  197
             + F M K LT H 
Sbjct  323  IDMFQMNKALTKHI  336


 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 101/191 (53%), Gaps = 47/191 (25%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L+KHIW + +ED     S+PK++
Sbjct  295  REKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHIWAVSEEDAP-SNSSPKKK  353

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K+GR+E           EPKQ+EKRQ+ +         P +      +    G     
Sbjct  354  GIKQGREE--------GPDEPKQKEKRQKKV---------PHEPKKKEKQQKKAG-----  391

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG*  179
                                  KRR++CD KL+E+ EVDSF GFT +KLL+ HFIKT   
Sbjct  392  ----------------------KRRIVCDKKLKEISEVDSFNGFTASKLLSLHFIKTEH-  428

Query  178  CYLTFLAT*KC  146
              LT LA   C
Sbjct  429  -KLTSLACHTC  438


 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010999856.1| PREDICTED: uncharacterized protein PFB0145c-like isoform X2 [Populus 
euphratica]
Length=448

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/193 (41%), Positives = 111/193 (58%), Gaps = 30/193 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  E+ ++       +
Sbjct  154  RENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGENESV-------K  206

Query  538  QRKKGRDEVYTDSDSDSD-----------FEPKQEEKRQRG--------LKGGGTGFLAP  416
            Q++K +D    DS S+ D            + +  E+ ++G        +K  G GF   
Sbjct  207  QKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERSKKGRSAKVDEDVKKRGGGFTKL  264

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L +F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR + +VDS 
Sbjct  265  CSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDSI  322

Query  235  EGFTMTKLLTAHF  197
            + F M K LT H 
Sbjct  323  DMFQMNKALTKHI  335


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 96/177 (54%), Gaps = 45/177 (25%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L+KHIW + +ED     S+PK++
Sbjct  294  REKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHIWAVSEEDAP-SNSSPKKK  352

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K+GR+E           EPKQ+EKRQ+ +         P +      +    G     
Sbjct  353  GIKQGREE--------GPDEPKQKEKRQKKV---------PHEPKKKEKQQKKAG-----  390

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
                                  KRR++CD KL+E+ EVDSF GFT +KLL+ HFIKT
Sbjct  391  ----------------------KRRIVCDKKLKEISEVDSFNGFTASKLLSLHFIKT  425


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_009345974.1| PREDICTED: ABC transporter F family member 4 [Pyrus x bretschneideri]
Length=483

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 114/198 (58%), Gaps = 32/198 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+ +ED  +       +
Sbjct  154  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSREDEPV-------K  206

Query  538  QRKKGRDEVYTDSDSD---------------SDFEPKQEEKRQRGLK--------GGGTG  428
            Q+KK  +  ++ S+ D                    ++E K++R  K        GGG G
Sbjct  207  QKKKVEESDHSISEGDVSNVAEQEEEEEVEVKKVSRQKENKKRRSTKVDKEVKKRGGGGG  266

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +
Sbjct  267  FTKLCSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRGLFD  324

Query  247  VDSFEGFTMTKLLTAHFI  194
            VD    F M K L+ H +
Sbjct  325  VDCINMFQMNKALSKHIL  342


 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 110/167 (66%), Gaps = 7/167 (4%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE---DVTLVKSTP  548
            RENNLQDPK K+ IICDE+L G+F V  I+MF+MN+ LSKHI P+ +E   D T  K   
Sbjct  300  RENNLQDPKNKRDIICDESLRGLFDVDCINMFQMNKALSKHILPLSEEAAPDNTSQKEKQ  359

Query  547  KERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             E + ++G    +  S  ++     ++ K+   +K G +G L+ + LS+S++KF    E 
Sbjct  360  SEEEEEEGEINKFRSSGYETLLMTLRKTKKT--VKNGDSGLLSSLPLSNSVLKFLNNWER  417

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  227
             LSR  V  R W+Y+K+N+LQDP++KRR +CDDKL+EL EVDSF GF
Sbjct  418  LLSRAGV--RDWEYLKQNDLQDPTDKRRTVCDDKLKELFEVDSFNGF  462


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VVKR+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  120  GFNKICSLSPQLQEFVGVPE--MARTEVVKRIWAYIREKDLQDPKNRRNIRCDESLHSLF  177

Query  250  EVDSFEGFTMTKLLTAHF  197
             V+S   F M K+L+ H 
Sbjct  178  RVNSINMFQMNKVLSKHI  195



>ref|XP_010999846.1| PREDICTED: uncharacterized protein PFB0145c-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   141 bits (355),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 111/194 (57%), Gaps = 31/194 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  E+ ++       +
Sbjct  154  RENNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGENESV-------K  206

Query  538  QRKKGRDEVYTDSDSDSD-----------FEPKQEEKRQRG---------LKGGGTGFLA  419
            Q++K +D    DS S+ D            + +  E+ ++G         +K  G GF  
Sbjct  207  QKEKSKD--INDSGSEGDNGGEQEDDEEEVKKESNERSKKGRRSAKVDEDVKKRGGGFTK  264

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L +F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR + +VDS
Sbjct  265  LCSLSPQLQEFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRSIFDVDS  322

Query  238  FEGFTMTKLLTAHF  197
             + F M K LT H 
Sbjct  323  IDMFQMNKALTKHI  336


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 72/177 (41%), Positives = 96/177 (54%), Gaps = 45/177 (25%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  IF V +IDMF+MN+ L+KHIW + +ED     S+PK++
Sbjct  295  REKNLQDPKNKRNIICDESLRSIFDVDSIDMFQMNKALTKHIWAVSEEDAP-SNSSPKKK  353

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K+GR+E           EPKQ+EKRQ+ +         P +      +    G     
Sbjct  354  GIKQGREE--------GPDEPKQKEKRQKKV---------PHEPKKKEKQQKKAG-----  391

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKT  188
                                  KRR++CD KL+E+ EVDSF GFT +KLL+ HFIKT
Sbjct  392  ----------------------KRRIVCDKKLKEISEVDSFNGFTASKLLSLHFIKT  426


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVKR+W YI+EN LQDP 
Sbjct  111  KIEKVRKRG------GFAKLSNLSPQLQAVVGVPE--LARTEVVKRLWAYIRENNLQDPK  162

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  163  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  200



>ref|XP_010229398.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Brachypodium distachyon]
Length=299

 Score =   137 bits (344),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 92/139 (66%), Gaps = 16/139 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED-VTLVKSTPKE  542
            RENNLQDP  K++I+CDETL  +F+V +IDMF+MN+ L+KHIWP+  E   +  KSTPKE
Sbjct  171  RENNLQDPSNKRKILCDETLKKLFKVNSIDMFQMNKALTKHIWPLNSEGPASPKKSTPKE  230

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            + +K+ ++E                +K++ G    GTG  AP+QLSD L  F GTGE+ L
Sbjct  231  KPQKREKNE---------------GKKQKVGSSRPGTGLNAPLQLSDDLANFIGTGESML  275

Query  361  SRGDVVKRMWKYIKENELQ  305
            SR DVVK MW YIKEN LQ
Sbjct  276  SRSDVVKIMWDYIKENNLQ  294


 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 61/97 (63%), Gaps = 9/97 (9%)
 Frame = -2

Query  466  EKRQRGLKGG-------GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENEL  308
             KR+R L  G       G GF     +S +L +F G  E  L+R +VVK++W YI+EN L
Sbjct  118  HKRKRRLDKGNSDGKRKGGGFTKLCSISPTLQEFVGASE--LARTEVVKKLWAYIRENNL  175

Query  307  QDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            QDPSNKR+++CD+ L++L +V+S + F M K LT H 
Sbjct  176  QDPSNKRKILCDETLKKLFKVNSIDMFQMNKALTKHI  212



>gb|KFK36005.1| hypothetical protein AALP_AA4G065400 [Arabis alpina]
Length=371

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 106/201 (53%), Gaps = 39/201 (19%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE+NLQDPK K+ I+CDE L  +FRVK IDMF+MN+ LSKHIWP+   DV +        
Sbjct  128  REHNLQDPKNKRNIVCDELLHSLFRVKKIDMFQMNKALSKHIWPLNDGDVCV------NN  181

Query  538  QRKKGRDEVYTDSDSDSDFE---------------------------PKQEEKRQRGLKG  440
             +++  DE   + D   +                              K EEK ++  KG
Sbjct  182  VKEEDEDETSVEKDVKEEQHEETEENNEEESKEEKEPRVRKRKKRKLAKSEEKPKK--KG  239

Query  439  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  260
            G  GF     LS  L  F G  E  L+R +VVK +WKYIKEN LQDPS+KR +ICD+ LR
Sbjct  240  G--GFTKVCSLSPELQAFTGIPE--LARTEVVKMLWKYIKENNLQDPSDKRTIICDETLR  295

Query  259  ELLEVDSFEGFTMTKLLTAHF  197
             L  V+S   F M K LT H 
Sbjct  296  SLFPVESINMFQMNKFLTKHI  316


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K++RG      GF    QLS  L    GT +  L+R +VVK+MW YI+E+ LQDP NKR 
Sbjct  89   KKRRG------GFNKVSQLSPQLENVLGTSQ--LARTEVVKKMWVYIREHNLQDPKNKRN  140

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            ++CD+ L  L  V   + F M K L+ H 
Sbjct  141  IVCDELLHSLFRVKKIDMFQMNKALSKHI  169


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 61/94 (65%), Gaps = 14/94 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI--EKEDVTLV--KST  551
            +ENNLQDP  K+ IICDETL  +F V++I+MF+MN+ L+KHIWP+  ++E +  V   + 
Sbjct  275  KENNLQDPSDKRTIICDETLRSLFPVESINMFQMNKFLTKHIWPLVPKEEGIARVGCSTI  334

Query  550  PKERQ-----RKKGRDEVYTDSDSDSDFEPKQEE  464
            PKE        +KG+ ++  D+D     EP ++E
Sbjct  335  PKEEAGTSNDPEKGKQKIDEDND-----EPNEKE  363



>gb|KFK36004.1| hypothetical protein AALP_AA4G065400 [Arabis alpina]
Length=370

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/201 (42%), Positives = 106/201 (53%), Gaps = 39/201 (19%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE+NLQDPK K+ I+CDE L  +FRVK IDMF+MN+ LSKHIWP+   DV +        
Sbjct  128  REHNLQDPKNKRNIVCDELLHSLFRVKKIDMFQMNKALSKHIWPLNDGDVCV------NN  181

Query  538  QRKKGRDEVYTDSDSDSDFE---------------------------PKQEEKRQRGLKG  440
             +++  DE   + D   +                              K EEK ++  KG
Sbjct  182  VKEEDEDETSVEKDVKEEQHEETEENNEEESKEEKEPRVRKRKKRKLAKSEEKPKK--KG  239

Query  439  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  260
            G  GF     LS  L  F G  E  L+R +VVK +WKYIKEN LQDPS+KR +ICD+ LR
Sbjct  240  G--GFTKVCSLSPELQAFTGIPE--LARTEVVKMLWKYIKENNLQDPSDKRTIICDETLR  295

Query  259  ELLEVDSFEGFTMTKLLTAHF  197
             L  V+S   F M K LT H 
Sbjct  296  SLFPVESINMFQMNKFLTKHI  316


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 51/89 (57%), Gaps = 8/89 (9%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K++RG      GF    QLS  L    GT +  L+R +VVK+MW YI+E+ LQDP NKR 
Sbjct  89   KKRRG------GFNKVSQLSPQLENVLGTSQ--LARTEVVKKMWVYIREHNLQDPKNKRN  140

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            ++CD+ L  L  V   + F M K L+ H 
Sbjct  141  IVCDELLHSLFRVKKIDMFQMNKALSKHI  169


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 61/93 (66%), Gaps = 13/93 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI--EKEDVTLV--KST  551
            +ENNLQDP  K+ IICDETL  +F V++I+MF+MN+ L+KHIWP+  ++E +  V   + 
Sbjct  275  KENNLQDPSDKRTIICDETLRSLFPVESINMFQMNKFLTKHIWPLVPKEEGIARVGCSTI  334

Query  550  PKE----RQRKKGRDEVYTDSDSDSDFEPKQEE  464
            PKE       +KG+ ++  D+D     EP ++E
Sbjct  335  PKEEGTSNDPEKGKQKIDEDND-----EPNEKE  362



>ref|XP_006384456.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
 gb|ERP62253.1| SWIB complex BAF60b domain-containing family protein [Populus 
trichocarpa]
Length=384

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 77/195 (39%), Positives = 110/195 (56%), Gaps = 24/195 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RENNLQDPK +K+I CDE L  +FRV +IDMF+M++ LSKHIWP+  ED T   +  K++
Sbjct  151  RENNLQDPKNRKKIKCDEALRAVFRVNSIDMFQMSKALSKHIWPLTGEDGTFFNNV-KQK  209

Query  538  QRKKGRDEVYTDSDS------------------DSDFEPKQEEKRQR---GLKGGGTGFL  422
            ++ +  ++   + D+                  +S+   K+  K  +    +K  G GF 
Sbjct  210  EKCEDSNDFGNEGDNGGEEEEEQEEEEEEEVKKESNGRSKKGRKSAKVDENVKKRGGGFT  269

Query  421  APIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVD  242
                LS  L +  G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR L +VD
Sbjct  270  KLCSLSPQLQELVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFDVD  327

Query  241  SFEGFTMTKLLTAHF  197
            S + F M K L+ H 
Sbjct  328  SIDMFQMNKALSKHI  342


 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 9/89 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ LSKHIW + +ED     S+PKE+
Sbjct  301  REKNLQDPKNKRNIICDESLRALFDVDSIDMFQMNKALSKHIWAVCEEDAP-SNSSPKEK  359

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQR  452
              K+GR+E   D D     EPKQ+EKRQ+
Sbjct  360  GAKQGREE---DPD-----EPKQKEKRQK  380


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/93 (40%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = -2

Query  460  RQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  281
            R+RG      GF     LS  L    G  E  L+R +VVK++W YI+EN LQDP N++++
Sbjct  113  RKRG------GFTKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRENNLQDPKNRKKI  164

Query  280  ICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
             CD+ LR +  V+S + F M+K L+ H     G
Sbjct  165  KCDEALRAVFRVNSIDMFQMSKALSKHIWPLTG  197



>ref|XP_009375739.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X3 [Pyrus x bretschneideri]
Length=368

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 109/194 (56%), Gaps = 21/194 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+  ED       K   
Sbjct  151  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSGEDEPVKKKKKVEE  210

Query  547  KERQRKKGRDEVYTDSDSDSDFEP--------KQEEKRQRGLK--------GGGTGFLAP  416
             +    +G +    + +   + E         ++E K+QR  K        GGG GF   
Sbjct  211  SDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKKQRSTKVDKEVKKRGGGGGFTKL  270

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +VD  
Sbjct  271  CSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCI  328

Query  235  EGFTMTKLLTAHFI  194
              F M K L  H +
Sbjct  329  NMFQMNKALCKHIL  342


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  250  EVDSFEGFTMTKLLTAHFIKTAG  182
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE  575
            RENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ +E
Sbjct  300  RENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLNEE  347



>ref|XP_009375738.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X2 [Pyrus x bretschneideri]
Length=368

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 109/194 (56%), Gaps = 21/194 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+  ED       K   
Sbjct  151  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSGEDEPVKKKKKVEE  210

Query  547  KERQRKKGRDEVYTDSDSDSDFEP--------KQEEKRQRGLK--------GGGTGFLAP  416
             +    +G +    + +   + E         ++E K+QR  K        GGG GF   
Sbjct  211  SDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKKQRSTKVDKEVKKRGGGGGFTKL  270

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +VD  
Sbjct  271  CSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCI  328

Query  235  EGFTMTKLLTAHFI  194
              F M K L  H +
Sbjct  329  NMFQMNKALCKHIL  342


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  250  EVDSFEGFTMTKLLTAHFIKTAG  182
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE  575
            RENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ +E
Sbjct  300  RENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLNEE  347



>ref|XP_009375737.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Pyrus x bretschneideri]
Length=369

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 109/194 (56%), Gaps = 21/194 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+  ED       K   
Sbjct  151  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSGEDEPVKKKKKVEE  210

Query  547  KERQRKKGRDEVYTDSDSDSDFEP--------KQEEKRQRGLK--------GGGTGFLAP  416
             +    +G +    + +   + E         ++E K+QR  K        GGG GF   
Sbjct  211  SDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKKQRSTKVDKEVKKRGGGGGFTKL  270

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +VD  
Sbjct  271  CSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCI  328

Query  235  EGFTMTKLLTAHFI  194
              F M K L  H +
Sbjct  329  NMFQMNKALCKHIL  342


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  250  EVDSFEGFTMTKLLTAHFIKTAG  182
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE  575
            RENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ +E
Sbjct  300  RENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLNEE  347



>ref|XP_009375740.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X4 [Pyrus x bretschneideri]
Length=367

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 80/194 (41%), Positives = 109/194 (56%), Gaps = 21/194 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            RE +LQDPK ++ I CDE+L  +FRV +I+MF+MN+ LSKHIWP+  ED       K   
Sbjct  151  REKDLQDPKNRRNIRCDESLHSLFRVNSINMFQMNKVLSKHIWPLSGEDEPVKKKKKVEE  210

Query  547  KERQRKKGRDEVYTDSDSDSDFEP--------KQEEKRQRGLK--------GGGTGFLAP  416
             +    +G +    + +   + E         ++E K+QR  K        GGG GF   
Sbjct  211  SDHSVSEGSNVAEQEEEEVEEKEEVEVERGSRRKETKKQRSTKVDKEVKKRGGGGGFTKL  270

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L KF  TG +AL+R +VVK++W YI+EN LQDP NKR +ICD+ LR L +VD  
Sbjct  271  CSLSPELQKF--TGVSALARTEVVKKLWIYIRENNLQDPKNKRDIICDESLRALFDVDCI  328

Query  235  EGFTMTKLLTAHFI  194
              F M K L  H +
Sbjct  329  NMFQMNKALCKHIL  342


 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 2/83 (2%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L +F G  E  ++R +VV+R+W YI+E +LQDP N+R + CD+ L  L 
Sbjct  117  GFNKICSLSPQLQEFVGEPE--MARTEVVRRIWAYIREKDLQDPKNRRNIRCDESLHSLF  174

Query  250  EVDSFEGFTMTKLLTAHFIKTAG  182
             V+S   F M K+L+ H    +G
Sbjct  175  RVNSINMFQMNKVLSKHIWPLSG  197


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE  575
            RENNLQDPK K+ IICDE+L  +F V  I+MF+MN+ L KHI P+ +E
Sbjct  300  RENNLQDPKNKRDIICDESLRALFDVDCINMFQMNKALCKHILPLNEE  347



>ref|XP_009803137.1| PREDICTED: protein TRI1-like isoform X2 [Nicotiana sylvestris]
Length=319

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 96/144 (67%), Gaps = 13/144 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL------VK  557
            REN+LQ+P  ++ I CD+TL  +F V  IDMF+MN+ L+KHIWP++ + V+       V 
Sbjct  163  RENDLQEPSNRRNINCDDTLRELFGVDKIDMFQMNKALAKHIWPLDSDGVSTITTSGSVN  222

Query  556  STPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGT  377
            ST +E+     +     + D DSD EPK++EKR        +G LAP+QLSD+L+KF GT
Sbjct  223  STAREKNSTAKKKRQKQEEDEDSD-EPKRKEKRH------NSGILAPLQLSDALIKFLGT  275

Query  376  GENALSRGDVVKRMWKYIKENELQ  305
            GE+ L RG+VVKR+W YIK+N LQ
Sbjct  276  GESELPRGNVVKRIWDYIKQNNLQ  299


 Score = 84.3 bits (207),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/78 (54%), Positives = 50/78 (64%), Gaps = 2/78 (3%)
 Frame = -2

Query  430  GFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELL  251
            GF     LS  L KF  TGE  L+R +VVKRMW YI+EN+LQ+PSN+R + CDD LREL 
Sbjct  129  GFTKICSLSPQLQKF--TGEAELARTEVVKRMWNYIRENDLQEPSNRRNINCDDTLRELF  186

Query  250  EVDSFEGFTMTKLLTAHF  197
             VD  + F M K L  H 
Sbjct  187  GVDKIDMFQMNKALAKHI  204



>ref|XP_002891515.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH67774.1| SWIB complex BAF60b domain-containing protein [Arabidopsis lyrata 
subsp. lyrata]
Length=372

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/197 (42%), Positives = 112/197 (57%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI------------EKE  575
            R+++LQDPK ++ I+CD++L  +FRVKTIDMF+MN+ L+KHIWP+            E E
Sbjct  135  RQHDLQDPKNRRNILCDDSLHSLFRVKTIDMFQMNKALAKHIWPLNDGDGCVKNVKGEDE  194

Query  574  DVTLVKSTPKERQRKKGRDEVYTDSDSDSD-----------FEPKQEEKRQRGLKGGGTG  428
            D T  +   KE + ++  +     S  + D              K EEK ++  KGGG  
Sbjct  195  DETSGERYEKEVKIEEAVENNEEVSGEEEDRSVRKRKRKKRKPAKSEEKPKK--KGGG--  250

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VV+ +WKYIKEN LQDPS+KR +ICD+ LR L  
Sbjct  251  FTKVCSLSPELQAFTGTAQ--LARTEVVRMLWKYIKENNLQDPSDKRTIICDESLRSLFP  308

Query  247  VDSFEGFTMTKLLTAHF  197
            V+S   F M K LT H 
Sbjct  309  VESINMFQMNKQLTKHI  325


 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 62/108 (57%), Gaps = 9/108 (8%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVK  341
            DE  +++D D    P + +KR       G GF    QLS  L KF GT +  L+R +VVK
Sbjct  78   DEEGSENDDDKTEPPVKAKKR-------GGGFNKICQLSPQLEKFLGTSQ--LARTEVVK  128

Query  340  RMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +MW YI++++LQDP N+R ++CDD L  L  V + + F M K L  H 
Sbjct  129  KMWAYIRQHDLQDPKNRRNILCDDSLHSLFRVKTIDMFQMNKALAKHI  176


 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L+KHIWP+ +ED     +   E+
Sbjct  284  KENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQLTKHIWPLVQEDEAGT-TNDSEK  342

Query  538  QRKKGRDEVYTDSDSDSD  485
             ++K + E+  D+D  +D
Sbjct  343  GKQKMKMEIDADNDEAND  360



>ref|XP_011001193.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X3 [Populus euphratica]
Length=361

 Score =   133 bits (335),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 104/194 (54%), Gaps = 23/194 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  ED ++ +    E 
Sbjct  151  RDNNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGEDESVKQKEKCED  210

Query  538  QRKKGRD--------------------EVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  419
                G +                    EV  +S+  S  + ++  K    +K  G GF  
Sbjct  211  SNDFGNEGDNGGEEEEEQEEEEEAEEEEVKKESNGRSK-KGRKSTKVDENVKKRGGGFTK  269

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR L  VDS
Sbjct  270  LCSLSPQLQDFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFNVDS  327

Query  238  FEGFTMTKLLTAHF  197
             + F M K L+ H 
Sbjct  328  IDMFQMNKALSKHI  341


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVT  566
            RE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ LSKHIW + +EDV 
Sbjct  300  REKNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKALSKHIWAVCEEDVV  350


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVK++W YI++N LQDP 
Sbjct  108  KTEKVRKRG------GFAKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRDNNLQDPK  159

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  160  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  197



>ref|XP_011001192.1| PREDICTED: protein TRI1-like isoform X2 [Populus euphratica]
Length=383

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 104/194 (54%), Gaps = 23/194 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  ED ++ +    E 
Sbjct  151  RDNNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGEDESVKQKEKCED  210

Query  538  QRKKGRD--------------------EVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  419
                G +                    EV  +S+  S  + ++  K    +K  G GF  
Sbjct  211  SNDFGNEGDNGGEEEEEQEEEEEAEEEEVKKESNGRSK-KGRKSTKVDENVKKRGGGFTK  269

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR L  VDS
Sbjct  270  LCSLSPQLQDFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFNVDS  327

Query  238  FEGFTMTKLLTAHF  197
             + F M K L+ H 
Sbjct  328  IDMFQMNKALSKHI  341


 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 63/89 (71%), Gaps = 9/89 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ LSKHIW + +ED     S+PKE+
Sbjct  300  REKNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKALSKHIWAVCEEDAP-SNSSPKEK  358

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQR  452
              K+GR+E   D D     EPKQ+EKRQ+
Sbjct  359  GAKQGREE---DPD-----EPKQKEKRQK  379


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVK++W YI++N LQDP 
Sbjct  108  KTEKVRKRG------GFAKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRDNNLQDPK  159

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  160  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  197



>ref|XP_011001190.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Populus euphratica]
Length=411

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 87/124 (70%), Gaps = 12/124 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK K+ IICDE+L  +F V +IDMF+MN+ LSKHIW + +ED     S+PKE+
Sbjct  300  REKNLQDPKNKRNIICDESLRALFNVDSIDMFQMNKALSKHIWAVCEEDAP-SNSSPKEK  358

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K+GR+E   D D     EPKQ+EKRQ   K G  G LAP+Q+ D+ VKFFGTGENA S
Sbjct  359  GAKQGREE---DPD-----EPKQKEKRQ---KKGAYGLLAPLQILDAFVKFFGTGENAFS  407

Query  358  RGDV  347
            R DV
Sbjct  408  RSDV  411


 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/194 (40%), Positives = 104/194 (54%), Gaps = 23/194 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDPK +K+I CDE L  +F V +IDMF+MN+ LSKHIWP+  ED ++ +    E 
Sbjct  151  RDNNLQDPKNRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTGEDESVKQKEKCED  210

Query  538  QRKKGRD--------------------EVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  419
                G +                    EV  +S+  S  + ++  K    +K  G GF  
Sbjct  211  SNDFGNEGDNGGEEEEEQEEEEEAEEEEVKKESNGRSK-KGRKSTKVDENVKKRGGGFTK  269

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F G  E  L+R  VVK++W YI+E  LQDP NKR +ICD+ LR L  VDS
Sbjct  270  LCSLSPQLQDFVGVPE--LARTGVVKKLWAYIREKNLQDPKNKRNIICDESLRALFNVDS  327

Query  238  FEGFTMTKLLTAHF  197
             + F M K L+ H 
Sbjct  328  IDMFQMNKALSKHI  341


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 55/98 (56%), Gaps = 8/98 (8%)
 Frame = -2

Query  475  KQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            K E+ R+RG      GF     LS  L    G  E  L+R +VVK++W YI++N LQDP 
Sbjct  108  KTEKVRKRG------GFAKLSSLSPQLQAVVGVPE--LARTEVVKKLWAYIRDNNLQDPK  159

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG  182
            N++++ CD+ LR +  V+S + F M K L+ H     G
Sbjct  160  NRKKIKCDEALRAVFHVNSIDMFQMNKALSKHIWPLTG  197



>ref|XP_010461790.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Camelina sativa]
Length=381

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 108/197 (55%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP----------IEKEDV  569
            R+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP          +++ED 
Sbjct  144  RDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPLNDGDGSVKDVKEEDE  203

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEP-------------KQEEKRQRGLKGGGTG  428
                    E++ +        + +S  +  P             K EEK ++  KGGG  
Sbjct  204  GEASGEKDEKEEQNEEAVENNEEESGEEEGPSLRKRKRKKRKPAKSEEKPKK--KGGG--  259

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +ICD+ LR L  
Sbjct  260  FTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFP  317

Query  247  VDSFEGFTMTKLLTAHF  197
            VDS   F M K L  H 
Sbjct  318  VDSINMFQMNKQLAKHI  334


 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 10/110 (9%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQ--EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDV  347
            D+ Y +    ++ +P++  E K++RG      GF    QLS  L KF GT +  L+R +V
Sbjct  84   DQNYEEGSESNNEKPERPVEAKKRRG------GFNKICQLSPQLDKFLGTCQ--LARTEV  135

Query  346  VKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            VK++W YI++++LQDP N+R ++CD+ L  L  V + + F M K L  H 
Sbjct  136  VKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHI  185


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ L+KHIWP+ +ED     + P++ 
Sbjct  293  KENNLQDPSDKRTIICDESLRSLFPVDSINMFQMNKQLAKHIWPLVQEDEAGTTNDPEKG  352

Query  538  QRK  530
            ++K
Sbjct  353  KQK  355



>ref|XP_010461791.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Camelina sativa]
Length=380

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 108/197 (55%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP----------IEKEDV  569
            R+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP          +++ED 
Sbjct  144  RDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPLNDGDGSVKDVKEEDE  203

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEP-------------KQEEKRQRGLKGGGTG  428
                    E++ +        + +S  +  P             K EEK ++  KGGG  
Sbjct  204  GEASGEKDEKEEQNEEAVENNEEESGEEEGPSLRKRKRKKRKPAKSEEKPKK--KGGG--  259

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +ICD+ LR L  
Sbjct  260  FTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFP  317

Query  247  VDSFEGFTMTKLLTAHF  197
            VDS   F M K L  H 
Sbjct  318  VDSINMFQMNKQLAKHI  334


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 65/110 (59%), Gaps = 10/110 (9%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQ--EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDV  347
            D+ Y +    ++ +P++  E K++RG      GF    QLS  L KF GT +  L+R +V
Sbjct  84   DQNYEEGSESNNEKPERPVEAKKRRG------GFNKICQLSPQLDKFLGTCQ--LARTEV  135

Query  346  VKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            VK++W YI++++LQDP N+R ++CD+ L  L  V + + F M K L  H 
Sbjct  136  VKKIWAYIRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHI  185


 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F V +I+MF+MN+ L+KHIWP+ +ED        K +
Sbjct  293  KENNLQDPSDKRTIICDESLRSLFPVDSINMFQMNKQLAKHIWPLVQEDEGTTNDPEKGK  352

Query  538  QR  533
            Q+
Sbjct  353  QK  354



>emb|CDO97141.1| unnamed protein product [Coffea canephora]
Length=553

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/200 (36%), Positives = 111/200 (56%), Gaps = 28/200 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED-----------  572
            RE NLQ+PK K++IICD+TL GIF+VK I+MF+MN+ LSKH+WPI+ ED           
Sbjct  331  REKNLQNPKDKRKIICDQTLHGIFQVKNINMFQMNKALSKHMWPIDAEDDHQEAEEDSNG  390

Query  571  ---VTLVKSTPKERQRKKGRDEV-----------YTDSDSDSDFEPKQEEKRQRGLKG-G  437
                   +   +E     G +EV             +SD   + + +   +R   ++   
Sbjct  391  EETEEQSEDVKQEENEYSGSNEVDIGGEGEGEGEEEESDGIRNKKKRYRSQRMDAIQNKK  450

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G+GF  P  +S  L +  G  E  ++R +VVK++W YI+E  LQ+P +KR++ICD+ LR 
Sbjct  451  GSGFSKPCAISPQLQELVGVPE--MARTEVVKKVWAYIREKNLQNPKDKRKIICDEALRA  508

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            +  V++   F M K+L+ H 
Sbjct  509  IFRVNTINMFQMNKVLSKHI  528


 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/205 (35%), Positives = 109/205 (53%), Gaps = 33/205 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPK--  545
            RENNLQ+PK K++IICDE L GIF+VK+I+MF+MN+ LSKH+WP++ ED     +T +  
Sbjct  170  RENNLQNPKDKRKIICDENLRGIFQVKSINMFQMNKALSKHMWPVDSEDEPQKHNTQQHQ  229

Query  544  -----------------------ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG  434
                                   +++  +G      D + + +    + +KR R  K   
Sbjct  230  QDQEEAEEEDSNGEEMKQEFENLKQELNEGSVHQEVDVEHEEESHGVRNKKRSRSYKMDN  289

Query  433  ------TGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
                  +GF  P  +S  L K  G   N ++R +VVK+MW YI+E  LQ+P +KR++ICD
Sbjct  290  NDKKKRSGFNKPWAISPQLQKIVGV--NQMARPEVVKKMWVYIREKNLQNPKDKRKIICD  347

Query  271  DKLRELLEVDSFEGFTMTKLLTAHF  197
              L  + +V +   F M K L+ H 
Sbjct  348  QTLHGIFQVKNINMFQMNKALSKHM  372


 Score = 91.7 bits (226),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQ+PK K++IICDE L  IFRV TI+MF+MN+ LSKHIWPI+ E  T +KS+ K+R
Sbjct  487  REKNLQNPKDKRKIICDEALRAIFRVNTINMFQMNKVLSKHIWPIDIEYATPIKSSQKKR  546

Query  538  QRKKGR  521
            QR+K R
Sbjct  547  QREKDR  552


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS  L +  G  E  ++R +VVKRMW YI+EN LQ+P +KR++ICD+ LR 
Sbjct  134  GNGFGKTWALSPQLQEIVGVPE--MARTEVVKRMWAYIRENNLQNPKDKRKIICDENLRG  191

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            + +V S   F M K L+ H 
Sbjct  192  IFQVKSINMFQMNKALSKHM  211



>ref|XP_010500494.1| PREDICTED: upstream activation factor subunit UAF30-like [Camelina 
sativa]
Length=379

 Score =   129 bits (323),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 79/197 (40%), Positives = 108/197 (55%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWP----------IEKEDV  569
            R+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP          +++ED 
Sbjct  142  RDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPLNDGDGSVKDVKEEDE  201

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEP-------------KQEEKRQRGLKGGGTG  428
                    E++ +        + +S  +  P             K EEK ++  KGGG  
Sbjct  202  GEASGEKDEKEEQNEEAVENNEEESGEEEGPSLRKRKRKKRKPAKSEEKPKK--KGGG--  257

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +ICD+ LR L  
Sbjct  258  FTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFP  315

Query  247  VDSFEGFTMTKLLTAHF  197
            V+S   F M K L  H 
Sbjct  316  VESINMFQMNKQLAKHI  332


 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 60/103 (58%), Gaps = 9/103 (9%)
 Frame = -2

Query  502  SDS-DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKY  326
            SDS D   E   E K++RG      GF    QLS  L KF GT +  L+R +VVK++W Y
Sbjct  89   SDSNDEKTERPVEAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKIWAY  140

Query  325  IKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            I++++LQDP N+R ++CD+ L  L  V + + F M K L  H 
Sbjct  141  IRDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHI  183


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L+KHIWP+ +ED     + P++ 
Sbjct  291  KENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQLAKHIWPLVQEDEAATTNDPEKG  350

Query  538  QRK  530
            ++K
Sbjct  351  KQK  353



>ref|XP_010419877.1| PREDICTED: uncharacterized protein LOC104705555 [Camelina sativa]
Length=541

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 111/187 (59%), Gaps = 15/187 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +E +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+KHIWP+ + D    +    E 
Sbjct  155  KEKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTKHIWPLGEGDEYDAEDEASEG  214

Query  538  QRKKG--RDEVYTDSDSDS-DFEPKQEEKRQRGL----------KGGGTGFLAPIQLSDS  398
              KKG   +EV  +   +S D E +   KR+R            KGGG GF     LS  
Sbjct  215  TDKKGEQNEEVGENKVEESEDEEVRNLRKRKRKTPAKSVEKPKRKGGGGGFAKICSLSPE  274

Query  397  LVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMT  218
            L  F G  E  L+R +VVK +WKYIKEN+LQDP++ R +ICD+ LR L   +S   F M 
Sbjct  275  LQAFTGVTE--LARTEVVKLLWKYIKENKLQDPNDGRTIICDESLRSLFPFESINMFQMN  332

Query  217  KLLTAHF  197
            KLLT H 
Sbjct  333  KLLTKHI  339


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF    QLS  L K  GT +  L+R +VV+++W YIKE +LQDP ++R+++CD+ L  
Sbjct  119  GGGFTKVSQLSPQLEKVVGTSQ--LARTEVVRKLWDYIKEKDLQDPKDRRKIVCDELLHS  176

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  V +   F M K LT H 
Sbjct  177  LFRVKTINMFQMNKALTKHI  196


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 36/46 (78%), Gaps = 0/46 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE  581
            +EN LQDP   + IICDE+L  +F  ++I+MF+MN+ L+KHIWP+E
Sbjct  298  KENKLQDPNDGRTIICDESLRSLFPFESINMFQMNKLLTKHIWPLE  343



>ref|XP_006852954.1| hypothetical protein AMTR_s00033p00241730 [Amborella trichopoda]
 gb|ERN14421.1| hypothetical protein AMTR_s00033p00241730 [Amborella trichopoda]
Length=287

 Score =   125 bits (315),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 88/142 (62%), Gaps = 21/142 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKE---DVTLVKSTP  548
            RE+NLQDP  K+ IICDE L  +F V +I MF+MN+ LSKHI P+  E   DV++ K  P
Sbjct  141  REHNLQDPANKRNIICDEQLRSLFDVDSIGMFQMNKVLSKHILPLATENGPDVSVPKVKP  200

Query  547  KERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
                              D      + +K+++G  G G+  LAP+ LSD+L+KF GTGEN
Sbjct  201  ------------------DVSVPKVKRQKQEKGQGGKGSALLAPLPLSDALIKFIGTGEN  242

Query  367  ALSRGDVVKRMWKYIKENELQD  302
            AL R +V+KR+W +IK+NELQD
Sbjct  243  ALPRSEVIKRIWNHIKQNELQD  264


 Score = 88.2 bits (217),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 55/85 (65%), Gaps = 2/85 (2%)
 Frame = -2

Query  439  GGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLR  260
            GG GF  P  LS  L  F G   + L R +VVKR+W +I+E+ LQDP+NKR +ICD++LR
Sbjct  104  GGGGFSKPCGLSPELQAFMGV--SVLPRTEVVKRIWAHIREHNLQDPANKRNIICDEQLR  161

Query  259  ELLEVDSFEGFTMTKLLTAHFIKTA  185
             L +VDS   F M K+L+ H +  A
Sbjct  162  SLFDVDSIGMFQMNKVLSKHILPLA  186



>ref|XP_010479385.1| PREDICTED: upstream activation factor subunit UAF30-like isoform 
X1 [Camelina sativa]
Length=381

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 114/197 (58%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL--VKS---  554
            R+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP+   D ++  VK    
Sbjct  144  RDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPLNDGDGSVKDVKEEDE  203

Query  553  --TPKERQRKKGRDEVYTDSDSDSDFE----------------PKQEEKRQRGLKGGGTG  428
              T  E+  K+ ++E   +++ ++  E                 K E+K ++  KGGG  
Sbjct  204  GETSGEKDEKEEQNEEAVENNEEASGEEEGPSLRKRKRKKRKPAKSEDKPKK--KGGG--  259

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +IC++ LR L  
Sbjct  260  FTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSDKRTIICNESLRSLFP  317

Query  247  VDSFEGFTMTKLLTAHF  197
            V+S   F M K L  H 
Sbjct  318  VESINMFQMNKQLAKHI  334


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = -2

Query  469  EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            E K++RG      GF    QLS  L KF GT +  L+R +VVK++W YI++++LQDP N+
Sbjct  103  EAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKIWAYIRDHDLQDPKNR  154

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R ++CD+ L  L  V + + F M K L  H 
Sbjct  155  RNILCDEALHSLFRVKAIDMFQMNKALAKHI  185


 Score = 71.2 bits (173),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IIC+E+L  +F V++I+MF+MN+ L+KHIWP+ +ED     + P++ 
Sbjct  293  KENNLQDPSDKRTIICNESLRSLFPVESINMFQMNKQLAKHIWPLVQEDEAGTTNDPEKG  352

Query  538  QRK  530
            ++K
Sbjct  353  KQK  355



>ref|XP_010479386.1| PREDICTED: protein TRI1-like isoform X2 [Camelina sativa]
Length=380

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 114/197 (58%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL--VKS---  554
            R+++LQDPK ++ I+CDE L  +FRVK IDMF+MN+ L+KHIWP+   D ++  VK    
Sbjct  144  RDHDLQDPKNRRNILCDEALHSLFRVKAIDMFQMNKALAKHIWPLNDGDGSVKDVKEEDE  203

Query  553  --TPKERQRKKGRDEVYTDSDSDSDFE----------------PKQEEKRQRGLKGGGTG  428
              T  E+  K+ ++E   +++ ++  E                 K E+K ++  KGGG  
Sbjct  204  GETSGEKDEKEEQNEEAVENNEEASGEEEGPSLRKRKRKKRKPAKSEDKPKK--KGGG--  259

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +IC++ LR L  
Sbjct  260  FTKVCSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSDKRTIICNESLRSLFP  317

Query  247  VDSFEGFTMTKLLTAHF  197
            V+S   F M K L  H 
Sbjct  318  VESINMFQMNKQLAKHI  334


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 55/91 (60%), Gaps = 8/91 (9%)
 Frame = -2

Query  469  EEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNK  290
            E K++RG      GF    QLS  L KF GT +  L+R +VVK++W YI++++LQDP N+
Sbjct  103  EAKKRRG------GFNKICQLSPQLDKFLGTSQ--LARTEVVKKIWAYIRDHDLQDPKNR  154

Query  289  RRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            R ++CD+ L  L  V + + F M K L  H 
Sbjct  155  RNILCDEALHSLFRVKAIDMFQMNKALAKHI  185


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IIC+E+L  +F V++I+MF+MN+ L+KHIWP+ +ED        K +
Sbjct  293  KENNLQDPSDKRTIICNESLRSLFPVESINMFQMNKQLAKHIWPLVQEDEGTTNDPEKGK  352

Query  538  QR  533
            Q+
Sbjct  353  QK  354



>ref|NP_175375.2| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AAY25460.1| At1g49520 [Arabidopsis thaliana]
 gb|AEE32438.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=372

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 103/197 (52%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL-------V  560
            RE++LQDP  ++ I+CDE+L  +FRVKTI+MF+MN+ L+KHIW +   D          V
Sbjct  135  REHDLQDPTNRRNILCDESLHSLFRVKTINMFQMNKALAKHIWALNDGDGCFKNVKEEDV  194

Query  559  KSTPKERQRKKGR----------------DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  428
              T  ER  K  +                D              K EEK ++  KGGG  
Sbjct  195  DETSGERDEKDVKIEEALENNEEESREEEDRSVRKRKRKKRKPAKSEEKPKK--KGGG--  250

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +ICD+ LR L  
Sbjct  251  FTKVCSLSPELQAFTGTPQ--LARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFP  308

Query  247  VDSFEGFTMTKLLTAHF  197
            V+S   F M K L  H 
Sbjct  309  VESINMFQMNKQLAKHI  325


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 12/130 (9%)
 Frame = -2

Query  577  EDVTLVKSTPKERQRKKG---RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  407
            E   L++S P++ +        DE  +++D D    P + +KR       G GF    QL
Sbjct  56   ESDALLESKPEQEEEDCNGDQNDEEGSENDDDKTELPVKAKKR-------GGGFNKICQL  108

Query  406  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  227
            S  L KF GT +  L+R +VVK+MW YI+E++LQDP+N+R ++CD+ L  L  V +   F
Sbjct  109  SPQLEKFLGTSQ--LARTEVVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMF  166

Query  226  TMTKLLTAHF  197
             M K L  H 
Sbjct  167  QMNKALAKHI  176


 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 55/78 (71%), Gaps = 5/78 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L+KHIWP+ +ED     + P   
Sbjct  284  KENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQLAKHIWPLVQEDEAGTTNDP---  340

Query  538  QRKKGRDEVYTDSDSDSD  485
              +KG+ ++  ++D D+D
Sbjct  341  --EKGKQKMKMETDEDND  356



>gb|AAD43149.1|AC007504_4 Hypothetical Protein [Arabidopsis thaliana]
Length=386

 Score =   126 bits (316),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 103/197 (52%), Gaps = 29/197 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL-------V  560
            RE++LQDP  ++ I+CDE+L  +FRVKTI+MF+MN+ L+KHIW +   D          V
Sbjct  135  REHDLQDPTNRRNILCDESLHSLFRVKTINMFQMNKALAKHIWALNDGDGCFKNVKEEDV  194

Query  559  KSTPKERQRKKGR----------------DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTG  428
              T  ER  K  +                D              K EEK ++  KGGG  
Sbjct  195  DETSGERDEKDVKIEEALENNEEESREEEDRSVRKRKRKKRKPAKSEEKPKK--KGGG--  250

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F     LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR +ICD+ LR L  
Sbjct  251  FTKVCSLSPELQAFTGTPQ--LARTEVVKMLWKYIKENNLQDPSDKRTIICDESLRSLFP  308

Query  247  VDSFEGFTMTKLLTAHF  197
            V+S   F M K L  H 
Sbjct  309  VESINMFQMNKQLAKHI  325


 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 71/130 (55%), Gaps = 12/130 (9%)
 Frame = -2

Query  577  EDVTLVKSTPKERQRKKG---RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL  407
            E   L++S P++ +        DE  +++D D    P + +KR       G GF    QL
Sbjct  56   ESDALLESKPEQEEEDCNGDQNDEEGSENDDDKTELPVKAKKR-------GGGFNKICQL  108

Query  406  SDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  227
            S  L KF GT +  L+R +VVK+MW YI+E++LQDP+N+R ++CD+ L  L  V +   F
Sbjct  109  SPQLEKFLGTSQ--LARTEVVKKMWAYIREHDLQDPTNRRNILCDESLHSLFRVKTINMF  166

Query  226  TMTKLLTAHF  197
             M K L  H 
Sbjct  167  QMNKALAKHI  176


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F V++I+MF+MN+ L+KHIWP+ +ED     + P++ 
Sbjct  284  KENNLQDPSDKRTIICDESLRSLFPVESINMFQMNKQLAKHIWPLVQEDEAGTTNDPEKG  343

Query  538  QRK  530
            ++K
Sbjct  344  KQK  346



>gb|ABK26533.1| unknown [Picea sitchensis]
Length=299

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 93/176 (53%), Gaps = 31/176 (18%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K+ IIC++ L  +F   + DMF+MN+ L+KHIW ++  D           
Sbjct  154  RANNLQDPSNKRNIICNDALRMVFDTDSTDMFQMNKLLAKHIWALDSRD-----------  202

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                               EP  +    R   G  +    P+ +SDSL  F GT +   S
Sbjct  203  ----------------DGSEPNAKRTANRNTSGPAS----PVPISDSLALFLGTDKIETS  242

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              +VVKR+  YIKENELQDP +K ++ICD KL++L   ++F  F MTKLL  HF+K
Sbjct  243  HEEVVKRLSDYIKENELQDPLDKGKIICDAKLQKLFSCENFVDFEMTKLLAPHFLK  298


 Score = 75.5 bits (184),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 51/90 (57%), Gaps = 5/90 (6%)
 Frame = -2

Query  466  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  287
            E R+RG  GG            ++V     GE AL R  +VK++W YI+ N LQDPSNKR
Sbjct  111  EGRKRGRPGGLNKICGVSPELQAIV-----GEPALPRTQIVKQLWTYIRANNLQDPSNKR  165

Query  286  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
             +IC+D LR + + DS + F M KLL  H 
Sbjct  166  NIICNDALRMVFDTDSTDMFQMNKLLAKHI  195



>ref|XP_002985006.1| hypothetical protein SELMODRAFT_121478 [Selaginella moellendorffii]
 gb|EFJ13881.1| hypothetical protein SELMODRAFT_121478 [Selaginella moellendorffii]
Length=311

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/178 (38%), Positives = 103/178 (58%), Gaps = 11/178 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE+NLQ P+ K++I CDE L  +F    IDMF MNQ L+KH+ P++           +E 
Sbjct  142  REHNLQVPEDKRKIKCDEALKKVFNSDYIDMFSMNQKLTKHVIPLDD----------RET  191

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +            +     E  ++ ++  G     +GF  P+++S  L +F GT E+ LS
Sbjct  192  RAANRLARKRKAEERAEKKEEAKKARKAAGKSPKVSGFTVPMKISPKLREFLGTEESQLS  251

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF-TMTKLLTAHFIKT  188
            R +V K++W YIK N+LQDPS++R+++CD+KL +LL+  SF GF  + KLL AH   T
Sbjct  252  RPEVTKQLWDYIKSNQLQDPSDRRKILCDEKLEKLLDCKSFNGFGGLPKLLQAHLTST  309


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 2/75 (3%)
 Frame = -2

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
            P QLSD L    G  +    R  VVK +W YI+E+ LQ P +KR++ CD+ L+++   D 
Sbjct  112  PCQLSDVLEAIVGIPQAP--RSQVVKSLWAYIREHNLQVPEDKRKIKCDEALKKVFNSDY  169

Query  238  FEGFTMTKLLTAHFI  194
             + F+M + LT H I
Sbjct  170  IDMFSMNQKLTKHVI  184



>ref|XP_006303686.1| hypothetical protein CARUB_v10011771mg [Capsella rubella]
 gb|EOA36584.1| hypothetical protein CARUB_v10011771mg [Capsella rubella]
Length=376

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/193 (38%), Positives = 102/193 (53%), Gaps = 21/193 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +E++LQDP+ ++ I+CDE L  +FRVKTI+MF+MN+ L+KHIWP+   D        ++ 
Sbjct  139  KEHDLQDPENRRNILCDEALHSLFRVKTINMFQMNKALAKHIWPLNDGDGCAKNVKEEDE  198

Query  538  QRKKG-RDE------------------VYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAP  416
                G RDE                      S      + ++  K +   K  G GF   
Sbjct  199  DEASGERDEKEERNEEAVENNEEESGEEEDRSVRKRKSKKRKPAKSEDKPKKKGGGFTKV  258

Query  415  IQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSF  236
              LS  L  F GT +  L+R +VVK +WKYIKEN LQDPS+KR ++CD+ LR L  V+S 
Sbjct  259  CSLSPELQAFTGTSQ--LARTEVVKMLWKYIKENNLQDPSDKRTILCDESLRSLFPVESI  316

Query  235  EGFTMTKLLTAHF  197
              F M K L  H 
Sbjct  317  NMFEMNKQLAKHI  329


 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/126 (37%), Positives = 66/126 (52%), Gaps = 6/126 (5%)
 Frame = -2

Query  568  TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGG--TGFLAPIQLSDSL  395
             L++S P+    K+  DE      +D +      EK +R +K      GF    QLS  L
Sbjct  59   ALLESKPE--VHKEHEDEDCNGDQNDEEGSENDNEKTERPVKAKKRRGGFNKICQLSPQL  116

Query  394  VKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTK  215
             KF GT +  L+R +VVK +W YIKE++LQDP N+R ++CD+ L  L  V +   F M K
Sbjct  117  EKFIGTSQ--LARTEVVKNIWAYIKEHDLQDPENRRNILCDEALHSLFRVKTINMFQMNK  174

Query  214  LLTAHF  197
             L  H 
Sbjct  175  ALAKHI  180


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 52/78 (67%), Gaps = 5/78 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ I+CDE+L  +F V++I+MF MN+ L+KHIWP+ +ED     + P   
Sbjct  288  KENNLQDPSDKRTILCDESLRSLFPVESINMFEMNKQLAKHIWPLVQEDEAGTTNDP---  344

Query  538  QRKKGRDEVYTDSDSDSD  485
              +KG+ ++    D D+D
Sbjct  345  --EKGKQKMDMKIDEDND  360



>ref|XP_006297542.1| hypothetical protein CARUB_v10013568mg [Capsella rubella]
 gb|EOA30440.1| hypothetical protein CARUB_v10013568mg [Capsella rubella]
Length=483

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/195 (41%), Positives = 99/195 (51%), Gaps = 30/195 (15%)
 Frame = -2

Query  706  LQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED----------VTLVK  557
            LQDPK +++I+CDE L  +FRVKTI+MF+MN+ L+KHIWP+   D               
Sbjct  226  LQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALTKHIWPLGDGDGCANNVKEEDEDEDD  285

Query  556  STPKERQRKKGRDE---------------VYTDSDSDSDFEPKQEEKRQRGLKGGGTGFL  422
                E   KKG                  V +          K  EK +R  KGGG GF 
Sbjct  286  DEASEGTDKKGEQNEEVEENKEEENEDEEVRSLRKRKRKKPAKSVEKPKR--KGGG-GFA  342

Query  421  APIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVD  242
                LS  L  F G  E  L+R +VVK +WKYIKEN LQDP++ R +ICD+ L  L  V+
Sbjct  343  KVCSLSPELQAFTGVTE--LARTEVVKMLWKYIKENNLQDPNDGRTIICDESLLSLFPVE  400

Query  241  SFEGFTMTKLLTAHF  197
            S   F M KLLT H 
Sbjct  401  SINMFQMNKLLTKHI  415


 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 84/123 (68%), Gaps = 14/123 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP   + IICDE+LL +F V++I+MF+MN+ L+KHIWP++   V+   ++PK  
Sbjct  374  KENNLQDPNDGRTIICDESLLSLFPVESINMFQMNKLLTKHIWPLDNNAVS--PNSPKN-  430

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                G+ ++ +D D+DS+ EP +++K+ +      T  L  + LSD+LVKF G GE++LS
Sbjct  431  ----GKQKMESDGDTDSE-EPNEKDKKLK------TEDLPSLPLSDALVKFLGNGESSLS  479

Query  358  RGD  350
            R D
Sbjct  480  RAD  482


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 47/80 (59%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF    QLS  L K  GT +  L+R +VVK++W YIK   LQDP ++R+++CD+ L  
Sbjct  186  GGGFTKVCQLSPQLEKLVGTSQ--LARTEVVKKIWAYIKGKGLQDPKDRRKIVCDELLHS  243

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  V +   F M K LT H 
Sbjct  244  LFRVKTINMFQMNKALTKHI  263



>ref|XP_006480142.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X2 [Citrus sinensis]
Length=365

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (53%), Gaps = 28/194 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKE-  542
            +EN LQDP  K++I+CDE+L  +F V +IDMF+MN+ LSKHIWP+  ED  + +    E 
Sbjct  142  KENKLQDPNNKRKILCDESLQALFGVNSIDMFKMNRALSKHIWPLGAEDENVKQKIGVED  201

Query  541  -------------------RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  419
                                + ++    +   S  +   +  ++ K++RG      GF  
Sbjct  202  FKNSEEEEEKEQEQEQEHEEEEEEEETSIEQQSKENRSTKADKDVKKRRG------GFTK  255

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F G  E  L+R +VVK++W YI+E  LQDP N+R +ICD+ L+ L  V+S
Sbjct  256  LCSLSPDLQTFVGVSE--LARTEVVKKLWAYIREKNLQDPKNRRNIICDEALQVLFRVNS  313

Query  238  FEGFTMTKLLTAHF  197
               F M K LT H 
Sbjct  314  INMFQMNKALTRHI  327


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = -2

Query  460  RQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  281
            RQ   +GGG GF     LS  L K  G  E  L+R +VVK++W YIKEN+LQDP+NKR++
Sbjct  99   RQVKRRGGG-GFNKLCSLSTQLQKVVGAPE--LARTEVVKKLWVYIKENKLQDPNNKRKI  155

Query  280  ICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +CD+ L+ L  V+S + F M + L+ H 
Sbjct  156  LCDESLQALFGVNSIDMFKMNRALSKHI  183


 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 59/89 (66%), Gaps = 12/89 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK ++ IICDE L  +FRV +I+MF+MN+ L++HIWP+++ D    KS  KE+
Sbjct  286  REKNLQDPKNRRNIICDEALQVLFRVNSINMFQMNKALTRHIWPLDEAD---AKSKEKEK  342

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQR  452
            Q     ++V   +D     EPK + KRQ+
Sbjct  343  Q----CEQVEEGTD-----EPKHKAKRQK  362



>ref|XP_010489932.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104767632 
[Camelina sativa]
Length=437

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/188 (40%), Positives = 106/188 (56%), Gaps = 16/188 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI-EKEDVTLVKSTPKE  542
            +E +LQDPK +++I+CDE L  +FRVKTI+MF+MN+ LSKHIWP+ E ++    +    E
Sbjct  151  KEKDLQDPKDRRKIVCDELLHSLFRVKTINMFQMNKALSKHIWPLGEGDEEYDAEDKASE  210

Query  541  RQRKKG-RDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAP------------IQLSD  401
               KKG ++E   ++  +   + +    R+R  K        P              LS 
Sbjct  211  GTDKKGEQNEQVGENKEEESEDEEVRNLRKRKRKTPAKSVEKPKRKGGGGGFAKICSLSP  270

Query  400  SLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTM  221
             L  F G  E  L+R +VVK +WKYIKEN+LQDP++ R +ICD+ LR L   +S   F M
Sbjct  271  ELQSFTGVTE--LARTEVVKLLWKYIKENKLQDPNDGRTIICDESLRSLFPFESINMFQM  328

Query  220  TKLLTAHF  197
             KLLT H 
Sbjct  329  NKLLTKHI  336


 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/179 (39%), Positives = 98/179 (55%), Gaps = 40/179 (22%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +EN LQDP   + IICDE+L  +F  ++I+MF+MN+ L+KHIWP+E      + S     
Sbjct  295  KENKLQDPNDGRTIICDESLRSLFPFESINMFQMNKLLTKHIWPLEDNAGESISSNSP--  352

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              K G+ ++ +D DS+   EP +++KR +      T  LAP+ LSD++VK          
Sbjct  353  --KNGKQKMESDGDSE---EPDEQDKRXK------TEVLAPLPLSDAVVKLE--------  393

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV--DSFEGFTMTKLLTAHFIKT  188
                              DPS KRRVICD+KL EL EV   S E  +++K LT HFIKT
Sbjct  394  -----------------TDPSGKRRVICDEKLLELFEVGTXSLEDASVSKHLTNHFIKT  435


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF    QLS  L K  GT +  L+R +VV+++W YIKE +LQDP ++R+++CD+ L  
Sbjct  115  GGGFAKVSQLSPQLEKVVGTSQ--LARTEVVRKLWDYIKEKDLQDPKDRRKIVCDELLHS  172

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L  V +   F M K L+ H 
Sbjct  173  LFRVKTINMFQMNKALSKHI  192



>ref|XP_006423075.1| hypothetical protein CICLE_v10028659mg [Citrus clementina]
 gb|ESR36315.1| hypothetical protein CICLE_v10028659mg [Citrus clementina]
Length=378

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 69/192 (36%), Positives = 102/192 (53%), Gaps = 26/192 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKE-  542
            +EN LQDP  K++I+CDE+L  +F V +IDMF+MN+ LSKHIWP+  ED  + +    E 
Sbjct  157  KENKLQDPTNKRKILCDESLQALFGVNSIDMFKMNRALSKHIWPLGAEDENVKQKIGVED  216

Query  541  -----------------RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPI  413
                              + ++    +   S  +   +  ++ K++RG      GF    
Sbjct  217  FKNLEEEEEKEQEQEHEEEEEEEETSIEQQSKENRSTKADKDVKKRRG------GFTKLC  270

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
             LS  L  F G  E  L+R +VVK++W YI+E  LQDP N++ +ICD+ L+ L  V+S  
Sbjct  271  SLSPDLQTFVGVSE--LARTEVVKKLWAYIREKNLQDPKNRQNIICDEALQVLFRVNSIN  328

Query  232  GFTMTKLLTAHF  197
             F M K LT H 
Sbjct  329  MFQMNKALTGHI  340


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/98 (43%), Positives = 60/98 (61%), Gaps = 9/98 (9%)
 Frame = -2

Query  469  EEKRQRGLK-------GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  311
            E KR++ +K        GG GF     LS  L K  G  E  L+R +VVK++W YIKEN+
Sbjct  103  ERKREKSIKVGREVKRRGGGGFNKICSLSTQLQKVVGAPE--LARTEVVKKLWVYIKENK  160

Query  310  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            LQDP+NKR+++CD+ L+ L  V+S + F M + L+ H 
Sbjct  161  LQDPTNKRKILCDESLQALFGVNSIDMFKMNRALSKHI  198


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 55/89 (62%), Gaps = 12/89 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK ++ IICDE L  +FRV +I+MF+MN+ L+ HIWP+++ D    ++  +  
Sbjct  299  REKNLQDPKNRQNIICDEALQVLFRVNSINMFQMNKALTGHIWPLDEADAKSKETEKQCE  358

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQR  452
            Q ++G D            EPK + KRQ+
Sbjct  359  QVEEGTD------------EPKHKAKRQK  375



>ref|XP_003635018.1| PREDICTED: uncharacterized protein LOC100853436 [Vitis vinifera]
 emb|CBI33113.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 96/175 (55%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F   + DMF+MN+ L+KHI P+E          P   
Sbjct  193  RKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHIIPLE----------PSRE  242

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  +S ++S                      +P+ +SD+L  FFGTGE  + 
Sbjct  243  SSQAKRLKVDVESATES-----------------SEASPSPVMISDALATFFGTGEREML  285

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + + ++R+W+YIK N+L+DP N   ++CD KLREL   +S     ++++L  H +
Sbjct  286  QEEALRRVWEYIKVNQLEDPLNSMAILCDAKLRELFGCESISALGVSEMLARHHL  340


 Score = 79.3 bits (194),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        +GG  G      +S  L      GE  + R  +VK++W YI++N LQDP
Sbjct  143  PKESAPAAPKRRGGSGGLNKVCGVSTELQAV--VGEPTMPRTQIVKQLWAYIRKNNLQDP  200

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E DS + F M KLL  H I
Sbjct  201  SNKRKIICDDALRLVFETDSTDMFKMNKLLAKHII  235



>ref|XP_006480141.1| PREDICTED: upstream activation factor subunit spp27-like isoform 
X1 [Citrus sinensis]
Length=394

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 102/194 (53%), Gaps = 28/194 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKE-  542
            +EN LQDP  K++I+CDE+L  +F V +IDMF+MN+ LSKHIWP+  ED  + +    E 
Sbjct  142  KENKLQDPNNKRKILCDESLQALFGVNSIDMFKMNRALSKHIWPLGAEDENVKQKIGVED  201

Query  541  -------------------RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLA  419
                                + ++    +   S  +   +  ++ K++RG      GF  
Sbjct  202  FKNSEEEEEKEQEQEQEHEEEEEEEETSIEQQSKENRSTKADKDVKKRRG------GFTK  255

Query  418  PIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS  239
               LS  L  F G  E  L+R +VVK++W YI+E  LQDP N+R +ICD+ L+ L  V+S
Sbjct  256  LCSLSPDLQTFVGVSE--LARTEVVKKLWAYIREKNLQDPKNRRNIICDEALQVLFRVNS  313

Query  238  FEGFTMTKLLTAHF  197
               F M K LT H 
Sbjct  314  INMFQMNKALTRHI  327


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 57/88 (65%), Gaps = 3/88 (3%)
 Frame = -2

Query  460  RQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRV  281
            RQ   +GGG GF     LS  L K  G  E  L+R +VVK++W YIKEN+LQDP+NKR++
Sbjct  99   RQVKRRGGG-GFNKLCSLSTQLQKVVGAPE--LARTEVVKKLWVYIKENKLQDPNNKRKI  155

Query  280  ICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +CD+ L+ L  V+S + F M + L+ H 
Sbjct  156  LCDESLQALFGVNSIDMFKMNRALSKHI  183


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 46/61 (75%), Gaps = 3/61 (5%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE NLQDPK ++ IICDE L  +FRV +I+MF+MN+ L++HIWP+++ D    KS  KE+
Sbjct  286  REKNLQDPKNRRNIICDEALQVLFRVNSINMFQMNKALTRHIWPLDEAD---AKSKEKEK  342

Query  538  Q  536
            Q
Sbjct  343  Q  343



>ref|XP_008806342.1| PREDICTED: uncharacterized protein LOC103719054 [Phoenix dactylifera]
Length=360

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 97/176 (55%), Gaps = 24/176 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E          P+ +
Sbjct  207  RKNNLQDPNNKRKIICNDELRMVFETDCTDMFKMNKLLAKHIIPLESTR----DPGPESK  262

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + K    E+ + ++ D+D                      P+ +SD+L  FFGTGE+ + 
Sbjct  263  KLKATTTELVSATEPDAD--------------------QYPVVISDALANFFGTGESEML  302

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + + ++R+W YIK N+L+DP N   ++CD KL++L    S     ++++L+ H  K
Sbjct  303  QSEALRRVWDYIKNNQLEDPMNGMMILCDSKLQQLFGCKSLSALGISEMLSHHLFK  358


 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 56/95 (59%), Gaps = 4/95 (4%)
 Frame = -2

Query  472  QEEKRQRGLK--GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            Q+E    G+K  GG  G      +S  L      GE  ++R  +VK++W YI++N LQDP
Sbjct  157  QKESAPAGVKRRGGPGGLSKVCGVSPQLQAI--VGEPTMARTQIVKQLWAYIRKNNLQDP  214

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +NKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  215  NNKRKIICNDELRMVFETDCTDMFKMNKLLAKHII  249



>ref|XP_003574734.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
15 [Brachypodium distachyon]
Length=416

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 99/178 (56%), Gaps = 24/178 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E       K + ++ 
Sbjct  260  RRNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIRPLEP-----AKDSNRDS  314

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++ K  D   ++  S ++ +P Q                 P+ +SD+L  FFGTGE  + 
Sbjct  315  KKLKPVD---SEPISPAESDPNQ----------------LPVIVSDALASFFGTGEREMP  355

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTA  185
              + VKR+W +IK N L+DPSN   ++CD KL++L   +S     +++LL+ H  K A
Sbjct  356  HSEAVKRVWDHIKSNNLEDPSNPTLILCDSKLKDLFGCESLTALGVSELLSDHLFKQA  413


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = -2

Query  523  RDEVYTDSDSDSDFEPKQEEKRQRGLK--GGGTGFLAPIQLSDSLVKFFGTGENALSRGD  350
            R  V  +S   +     ++E    G+K  GG  G      +S  L      GE  ++R +
Sbjct  193  RGAVVAESPRGAASAKPKKESASTGVKRRGGPGGLNKVCGVSPELQVI--VGEPTMARTE  250

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +VK++W YI+ N LQDP+NKR++IC+D+LR + E D  + F M KLL  H 
Sbjct  251  IVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHI  301



>gb|ABK24867.1| unknown [Picea sitchensis]
Length=297

 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 94/141 (67%), Gaps = 10/141 (7%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPK--  545
            REN+LQDP+ +++I+CD+ L  +FR  +IDMF MN+ LS HI  +E  +V    S PK  
Sbjct  159  RENDLQDPQNRRKILCDDKLRSVFRKDSIDMFEMNKVLSNHILRLENGNVVSEDSEPKSK  218

Query  544  -ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             ++Q KKG      DS+S S    +Q+++++ G +   +GF +P+ LSD+LV F GTGE+
Sbjct  219  RQKQEKKG----LEDSESKS---KRQKQEKKDGGRVKSSGFCSPLPLSDALVTFLGTGES  271

Query  367  ALSRGDVVKRMWKYIKENELQ  305
             LSR +VVKR+W YIK+  LQ
Sbjct  272  QLSRAEVVKRIWGYIKDKNLQ  292


 Score = 81.3 bits (199),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 53/84 (63%), Gaps = 2/84 (2%)
 Frame = -2

Query  442  GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKL  263
            G G GF     LS  L    G  E  LSR  VVK++W YI+EN+LQDP N+R+++CDDKL
Sbjct  121  GTGGGFNKLCGLSPELQSVLGVSE--LSRTQVVKQLWVYIRENDLQDPQNRRKILCDDKL  178

Query  262  RELLEVDSFEGFTMTKLLTAHFIK  191
            R +   DS + F M K+L+ H ++
Sbjct  179  RSVFRKDSIDMFEMNKVLSNHILR  202



>ref|XP_010439338.1| PREDICTED: uncharacterized protein LOC104722801 [Camelina sativa]
Length=384

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 97/176 (55%), Gaps = 20/176 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  227  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSG  278

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + EV T +++  +  P                  + I LS+SL KFFGTGE  ++
Sbjct  279  QAKRAKAEVETKTET-PELTPV-----------SSAPVSSTITLSESLSKFFGTGETEMT  326

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP N   + CD+KLR+LL  DS     + ++L  H  K
Sbjct  327  DEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGCDSISAVGINEMLRRHMYK  382


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = -2

Query  490  SDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  311
            ++  PK+        KGG  G     ++S  L      GE AL R ++V+++W YI++N 
Sbjct  173  ANASPKESAPAGTKRKGGPGGLNKVCRVSPELQVV--VGEPALPRTEIVRQLWAYIRKNN  230

Query  310  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            LQDPSNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  231  LQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  269



>ref|XP_010434052.1| PREDICTED: uncharacterized protein LOC104718075 [Camelina sativa]
Length=386

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/176 (36%), Positives = 97/176 (55%), Gaps = 20/176 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  229  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSG  280

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + EV T +++  +  P                  + I LS+SL KFFGTGE  ++
Sbjct  281  QAKRAKAEVETKTET-PELTPV-----------SSAPVSSTITLSESLSKFFGTGETEMT  328

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP N   + CD+KLR+LL  DS     + ++L  H  K
Sbjct  329  DEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGCDSISAVGINEMLRRHMYK  384


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = -2

Query  490  SDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  311
            ++  PK+        KGG  G     ++S  L      GE AL R ++V+++W YI++N 
Sbjct  175  ANASPKESAPAGTKRKGGPGGLNKVCRVSPELQVV--VGEPALPRTEIVRQLWAYIRKNN  232

Query  310  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            LQDPSNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  233  LQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  271



>ref|XP_010448893.1| PREDICTED: uncharacterized protein LOC104731266 [Camelina sativa]
Length=388

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 98/176 (56%), Gaps = 20/176 (11%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  231  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSG  282

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + EV T +++  +  P                  + I LS+SL KFFGTGE  ++
Sbjct  283  QAKRAKAEVETKTET-PELTPV-----------SSAPVSSTITLSESLSKFFGTGETEMT  330

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP+N   + CD+KLR+LL  +S     + ++L  H  K
Sbjct  331  DEEIIRRVWEYIKLNNLEDPANPMAIQCDEKLRDLLGCESISAVGINEMLRRHMYK  386


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 57/99 (58%), Gaps = 2/99 (2%)
 Frame = -2

Query  490  SDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENE  311
            ++  PK+        KGG  G     ++S  L      GE AL R ++V+++W YI++N 
Sbjct  177  ANASPKESAPAGTKRKGGPGGLNKVCRVSPELQVV--VGEPALPRTEIVRQLWAYIRKNN  234

Query  310  LQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            LQDPSNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  235  LQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  273



>ref|NP_001062171.1| Os08g0502800 [Oryza sativa Japonica Group]
 dbj|BAD08918.1| parathymosin-like [Oryza sativa Japonica Group]
 dbj|BAD09270.1| parathymosin-like [Oryza sativa Japonica Group]
 dbj|BAF24085.1| Os08g0502800 [Oryza sativa Japonica Group]
Length=406

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 92/176 (52%), Gaps = 24/176 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F   + DMF+MN+ L+KHI P+E              
Sbjct  250  RRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKHIRPLEA-------------  296

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++   RD             P + +  Q            PI LSD+L  FFGTGE  + 
Sbjct  297  KKDSNRDSKKLKPVDSEPISPAETDVNQ-----------LPIILSDALASFFGTGEKEMP  345

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              + VKR+W +IK N L+DP+N   ++CD KL++L   +S    ++++LL+ H  K
Sbjct  346  SSEAVKRVWDHIKSNNLEDPANPTMILCDSKLKQLFGCESLTAVSVSELLSQHLFK  401


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE  ++R ++VK++W YI+ N LQDP+NKR++IC+D+LR + E DS + F M KLL  H
Sbjct  231  VGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKH  290

Query  199  F  197
             
Sbjct  291  I  291



>ref|XP_010928509.1| PREDICTED: uncharacterized protein LOC105050254 [Elaeis guineensis]
Length=361

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 96/176 (55%), Gaps = 24/176 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E    +     P  +
Sbjct  208  RKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLE----STRDPGPDSK  263

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + K    EV + ++ D D                      P+ +SD+L  FFGTGE  + 
Sbjct  264  KLKAPATEVVSATEPDVD--------------------QYPLVISDALANFFGTGEREML  303

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + + ++R+W YIK N+L+DP+N   ++CD KL++L   +S     ++ +L+ H  K
Sbjct  304  QSEALRRIWDYIKHNQLEDPANTMVILCDTKLQQLFGCESLSALGISDMLSRHLFK  359


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            +GG  G      +S  L      GE  ++R  +VK++W YI++N LQDP+NKR++IC+D+
Sbjct  169  RGGPGGLSKVCGVSPQLQAI--VGEPTMARTQIVKQLWAYIRKNNLQDPNNKRKIICNDE  226

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E D  + F M KLL  H I
Sbjct  227  LRLVFETDCTDMFKMNKLLAKHII  250



>ref|XP_002278125.1| PREDICTED: uncharacterized protein LOC100267408 [Vitis vinifera]
 emb|CBI33108.3| unnamed protein product [Vitis vinifera]
Length=347

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 96/175 (55%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F   + DMF+MN+ L+KHI P+E          P   
Sbjct  196  RKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHIIPLE----------PSRE  245

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  +S ++S                      +P+ +SD+L  FFGTGE  + 
Sbjct  246  SSQAKRLKVDVESATES-----------------SEASPSPVMISDALATFFGTGEREML  288

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + + ++R+W+YIK N+L+DP N   ++CD KL+EL   +S     ++++L  H +
Sbjct  289  QEEALRRVWEYIKVNQLEDPLNSMAILCDAKLQELFGCESISALGVSEMLARHHL  343


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        +GG  G      +S  L      GE  + R  +VK++W YI++N LQDP
Sbjct  146  PKESAPAAAKRRGGSGGLNKVCGVSTELQAV--VGEPTMPRTQIVKQLWAYIRKNNLQDP  203

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E DS + F M KLL  H I
Sbjct  204  SNKRKIICDDALRLVFETDSTDMFKMNKLLAKHII  238



>ref|XP_006406538.1| hypothetical protein EUTSA_v10020944mg [Eutrema salsugineum]
 gb|ESQ47991.1| hypothetical protein EUTSA_v10020944mg [Eutrema salsugineum]
Length=378

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/196 (38%), Positives = 108/196 (55%), Gaps = 24/196 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKS---  554
            +E +LQDPK +++I+CDE+L  +FRVK+I+MF+M++ L+KHIWP+   D  V  VK    
Sbjct  153  KEKDLQDPKDRRKILCDESLHSLFRVKSINMFQMSKALTKHIWPLGDGDGCVNSVKEEDE  212

Query  553  ------TPKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQ-----------RGLKGGGTGF  425
                     ER +K   +E   + + +   E  +   R+           +  + GG GF
Sbjct  213  DEDEDEASGERDKKGEENEEVEEENEEESEEEVRRTLRKRKRKKPVKSVDKPKRKGGGGF  272

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
                 LS  L  F G  E  L+R +V K +W YIKEN LQDP++KR +ICD+ LR L   
Sbjct  273  AKVCSLSPELQAFTGVTE--LARTEVTKMLWSYIKENNLQDPNDKRTIICDESLRSLFTF  330

Query  244  DSFEGFTMTKLLTAHF  197
            +S   F M+KLLT H 
Sbjct  331  ESVNMFQMSKLLTKHI  346


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 4/93 (4%)
 Frame = -2

Query  469  EEKRQRGLKGG--GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPS  296
            E+K +R +K     +GF    QLS  L KF GT +  L+R +V K++W YIKE +LQDP 
Sbjct  104  EDKEERPVKAKKRASGFTKVCQLSPQLEKFLGTSQ--LARTEVTKKLWAYIKEKDLQDPK  161

Query  295  NKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            ++R+++CD+ L  L  V S   F M+K LT H 
Sbjct  162  DRRKILCDESLHSLFRVKSINMFQMSKALTKHI  194


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 48/72 (67%), Gaps = 4/72 (6%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQDP  K+ IICDE+L  +F  ++++MF+M++ L+KHIWP++      V S    +
Sbjct  305  KENNLQDPNDKRTIICDESLRSLFTFESVNMFQMSKLLTKHIWPLQDNAGESVGS----K  360

Query  538  QRKKGRDEVYTD  503
              K G+ E+ TD
Sbjct  361  SPKNGKQEMETD  372



>ref|XP_006660252.1| PREDICTED: uncharacterized protein LOC102711373 [Oryza brachyantha]
Length=345

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 91/176 (52%), Gaps = 24/176 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F   + DMF+MN+ L+KHI P+E              
Sbjct  188  RRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKHIRPLEAA------------  235

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             +   RD             P + +  Q            PI +SD+L  FFGTGE  + 
Sbjct  236  -KHSNRDSKKLKPVDSEPISPAETDVNQ-----------LPIIVSDALASFFGTGEKEMP  283

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              + VKR+W +IK N L+DP+N   ++CD KL++L   +S    ++++LL+ H  K
Sbjct  284  SSEAVKRVWDHIKSNNLEDPANPAMILCDSKLKQLFGCESLTTVSVSELLSHHLFK  339


 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            +GG  G      +S  L      GE  ++R ++VK++W YI+ N LQDP+NKR++IC+D+
Sbjct  149  RGGPGGLNKVCGVSPELQAI--VGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDE  206

Query  265  LRELLEVDSFEGFTMTKLLTAHF  197
            LR + E DS + F M KLL  H 
Sbjct  207  LRLVFETDSTDMFKMNKLLAKHI  229



>ref|XP_010539556.1| PREDICTED: uncharacterized protein LOC104813595 [Tarenaya hassleriana]
Length=361

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 66/176 (38%), Positives = 96/176 (55%), Gaps = 26/176 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++          P + 
Sbjct  210  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLD----------PTKE  259

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V        D E K EE  +           + I LS+SL KFF TGE  + 
Sbjct  260  TGQAKRVKV--------DVESKTEETTE--------AVSSTIVLSESLAKFFATGETEMV  303

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              +V+KR+W++IK N L+DPSN   + CD+KLR+LL  +S     + ++L  H  K
Sbjct  304  ETEVMKRVWEHIKLNHLEDPSNPMAIQCDEKLRDLLGCESISAVGINEMLRRHMYK  359


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        KGG  G      +S  L      GE  L R ++VK++W YI++N LQDP
Sbjct  160  PKESAPAGSKRKGGPGGLNKVCGVSPELQAI--VGEPDLPRTEIVKQLWAYIRKNNLQDP  217

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  218  SNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  252



>ref|XP_010913182.1| PREDICTED: uncharacterized protein LOC105038945 isoform X2 [Elaeis 
guineensis]
Length=359

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 96/179 (54%), Gaps = 30/179 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E              
Sbjct  206  RKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLEST------------  253

Query  538  QRKKGRDEV---YTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             R  GRD      T ++  S  EP  ++                + +SD+L  FFGTGE 
Sbjct  254  -RDPGRDSKKLKTTATEVVSATEPDADQYS--------------VVISDALANFFGTGER  298

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             + + + ++R+W YIK N+L+DP N   ++CD KL++L E +S     ++++L+ H  K
Sbjct  299  EMLQSEALRRVWDYIKNNQLEDPMNTMIILCDSKLQQLFECESLSALGLSEMLSRHLFK  357


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 57/97 (59%), Gaps = 4/97 (4%)
 Frame = -2

Query  478  PKQEEKRQRGLK--GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  305
            P Q+E    G+K  GG  G      +S  L      GE  ++R  +VK++W YI++N LQ
Sbjct  154  PSQKESAPAGVKRRGGPGGLSKVCGVSPQLQAI--VGEPTMARTQIVKQLWAYIRKNNLQ  211

Query  304  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            DP+NKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  212  DPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHII  248



>ref|XP_010913181.1| PREDICTED: uncharacterized protein LOC105038945 isoform X1 [Elaeis 
guineensis]
Length=385

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 61/179 (34%), Positives = 96/179 (54%), Gaps = 30/179 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E              
Sbjct  232  RKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLEST------------  279

Query  538  QRKKGRDEV---YTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             R  GRD      T ++  S  EP  ++                + +SD+L  FFGTGE 
Sbjct  280  -RDPGRDSKKLKTTATEVVSATEPDADQYS--------------VVISDALANFFGTGER  324

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             + + + ++R+W YIK N+L+DP N   ++CD KL++L E +S     ++++L+ H  K
Sbjct  325  EMLQSEALRRVWDYIKNNQLEDPMNTMIILCDSKLQQLFECESLSALGLSEMLSRHLFK  383


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 2/84 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            +GG  G      +S  L      GE  ++R  +VK++W YI++N LQDP+NKR++IC+D+
Sbjct  193  RGGPGGLSKVCGVSPQLQAI--VGEPTMARTQIVKQLWAYIRKNNLQDPNNKRKIICNDE  250

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E D  + F M KLL  H I
Sbjct  251  LRLVFETDCTDMFKMNKLLAKHII  274



>ref|XP_006449863.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
 ref|XP_006449864.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
 gb|ESR63103.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
 gb|ESR63104.1| hypothetical protein CICLE_v10015752mg [Citrus clementina]
Length=355

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 95/177 (54%), Gaps = 30/177 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P+E              
Sbjct  206  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLEP-------------  252

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                         +S   F+P  E   + G++ G +    P+ +S++L KF GTG   + 
Sbjct  253  -----------TKESSKRFKPDAESTTE-GMESGPS----PVIISEALAKFLGTGGREML  296

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT-AHFIK  191
            + +  KR+W+YIK N L+DP N   ++CD KLRELL  +S     + ++L   HF++
Sbjct  297  QAEATKRVWEYIKVNHLEDPLNSMVILCDAKLRELLGCESISALGIQEMLARNHFLR  353


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             G+ A+ R ++VK++W YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H
Sbjct  187  VGQPAMPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKH  246

Query  199  FI  194
             I
Sbjct  247  II  248



>ref|XP_010529474.1| PREDICTED: uncharacterized protein LOC104806331 [Tarenaya hassleriana]
Length=365

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/178 (37%), Positives = 96/178 (54%), Gaps = 29/178 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIE--KEDVTLVKSTPK  545
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++  KE V        
Sbjct  213  RKNNLQDPNNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPTKESV--------  264

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENA  365
            + +R K   E  T++   +D EP                    I LS+ L KFFGTGE  
Sbjct  265  QAKRVKADAECKTET---TDTEPVSST----------------IVLSEPLAKFFGTGETE  305

Query  364  LSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            +   +V +R+W+Y+K N L+DP N   + CD+KLR+LL  +S     + ++L  H  K
Sbjct  306  MEGTEVTQRVWEYVKLNHLEDPLNPMAIHCDEKLRDLLGCESISAVGINEMLRRHMYK  363


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 56/100 (56%), Gaps = 4/100 (4%)
 Frame = -2

Query  487  DFEPKQEEKRQRGLK--GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  314
            D  P ++E    G K  GG  G      +S  L    G    AL R ++VK++W YI++N
Sbjct  158  DQAPARKESAPAGSKRKGGPGGLNKVCGVSPELQVVVGGP--ALPRTEIVKQLWAYIRKN  215

Query  313  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             LQDP+NKR++ICDD LR + E D  + F M KLL  H +
Sbjct  216  NLQDPNNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  255



>ref|XP_008792594.1| PREDICTED: upstream activation factor subunit spp27 isoform X4 
[Phoenix dactylifera]
Length=266

 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 75/117 (64%), Gaps = 22/117 (19%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED--VTLVKSTPK  545
            REN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ LSKHIWP+  ED  VT VKS PK
Sbjct  168  RENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKALSKHIWPLTSEDGPVTTVKSKPK  227

Query  544  ERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTG  374
            ++Q KK R                 E KRQ   KGG +G L P+ LSD LVKF GTG
Sbjct  228  DKQHKKER-----------------EGKRQ---KGGSSGLLVPLPLSDDLVKFIGTG  264


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N++++ICD++L+ 
Sbjct  132  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQN  189

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L +V++ + F M K L+ H 
Sbjct  190  LFKVNTIDMFQMNKALSKHI  209



>ref|XP_008792593.1| PREDICTED: upstream activation factor subunit spp27 isoform X3 
[Phoenix dactylifera]
Length=267

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 75/118 (64%), Gaps = 23/118 (19%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKED---VTLVKSTP  548
            REN+LQDP  +K+IICDE L  +F+V TIDMF+MN+ LSKHIWP+  ED   VT VKS P
Sbjct  168  RENSLQDPNNRKKIICDERLQNLFKVNTIDMFQMNKALSKHIWPLTSEDAGPVTTVKSKP  227

Query  547  KERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTG  374
            K++Q KK R                 E KRQ   KGG +G L P+ LSD LVKF GTG
Sbjct  228  KDKQHKKER-----------------EGKRQ---KGGSSGLLVPLPLSDDLVKFIGTG  265


 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 56/80 (70%), Gaps = 2/80 (3%)
 Frame = -2

Query  436  GTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRE  257
            G GF     LS +L +F   GE+ L+R +VVK++W YI+EN LQDP+N++++ICD++L+ 
Sbjct  132  GGGFTKLCSLSPALQQF--VGESELARTEVVKKLWAYIRENSLQDPNNRKKIICDERLQN  189

Query  256  LLEVDSFEGFTMTKLLTAHF  197
            L +V++ + F M K L+ H 
Sbjct  190  LFKVNTIDMFQMNKALSKHI  209



>ref|XP_002445921.1| hypothetical protein SORBIDRAFT_07g028070 [Sorghum bicolor]
 gb|EES15416.1| hypothetical protein SORBIDRAFT_07g028070 [Sorghum bicolor]
Length=427

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 98/176 (56%), Gaps = 24/176 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F   + DMF+MN+ LSKHI P+E ++ +       +R
Sbjct  270  RRNNLQDPNNKRKIICNDELRLVFETDSTDMFQMNKLLSKHIRPLESKNDS-------KR  322

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + KK + E         +  PK E    +           P+ +SD+L  FFGTGE  + 
Sbjct  323  EAKKLKPE-------GGEQIPKVETDVNQ----------LPLTVSDALATFFGTGEREMV  365

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              + VKR+W++IK N L+DP N   ++CD KL++L   +S     +++LL+ H  K
Sbjct  366  HSEAVKRVWEHIKSNNLEDPENPTVILCDSKLKQLFGCESLAAHGVSELLSDHLYK  421


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE A++R ++VK++W YI+ N LQDP+NKR++IC+D+LR + E DS + F M KLL+ H
Sbjct  251  VGEPAMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFQMNKLLSKH  310

Query  199  F  197
             
Sbjct  311  I  311



>ref|XP_006467332.1| PREDICTED: alpha/beta-gliadin A-III-like isoform X1 [Citrus sinensis]
 ref|XP_006467333.1| PREDICTED: alpha/beta-gliadin A-III-like isoform X2 [Citrus sinensis]
 gb|KDO78454.1| hypothetical protein CISIN_1g018463mg [Citrus sinensis]
 gb|KDO78455.1| hypothetical protein CISIN_1g018463mg [Citrus sinensis]
Length=355

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 94/177 (53%), Gaps = 30/177 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P+E              
Sbjct  206  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLE--------------  251

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                         +S   F+P  E   + G++ G +  +    +S++L KF GTG   + 
Sbjct  252  ----------PTKESSKRFKPDAESTTE-GMESGPSSVI----ISEALAKFLGTGGREML  296

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT-AHFIK  191
            + +  KR+W+YIK N L+DP N   ++CD KLRELL  +S     + ++L   HF++
Sbjct  297  QAEATKRVWEYIKVNHLEDPLNSMVILCDAKLRELLGCESISALGIQEMLARNHFLR  353


 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             G+ A+ R ++VK++W YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H
Sbjct  187  VGQPAMPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKH  246

Query  199  FI  194
             I
Sbjct  247  II  248



>ref|XP_010538758.1| PREDICTED: uncharacterized protein LOC104812994 [Tarenaya hassleriana]
Length=372

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/176 (36%), Positives = 94/176 (53%), Gaps = 27/176 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ LSKHI P++          P + 
Sbjct  216  RKNNLQDPSNKRKIICDDPLRVVFETDCTDMFKMNKLLSKHILPLD----------PTKE  265

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  +S +++  EP                    + LS+ + KFFGTGE  + 
Sbjct  266  SGQAKRVKVDAESTTET-VEPVSST----------------VVLSEPIAKFFGTGETEMV  308

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              +VV+R+W YIK N L+DP N   + CD+KLR+LL  +S     + ++L  H  K
Sbjct  309  ETEVVQRVWDYIKLNHLEDPVNPMAIQCDEKLRDLLGCESISAVGINEMLRRHMYK  364


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+    +   KGG  G      +S  L      GE  L R ++VK++W YI++N LQDP
Sbjct  166  PKESAPARTKRKGGSGGLNKVCGVSPELQAV--VGEPFLPRTEIVKQLWAYIRKNNLQDP  223

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E D  + F M KLL+ H +
Sbjct  224  SNKRKIICDDPLRVVFETDCTDMFKMNKLLSKHIL  258



>ref|XP_004973841.1| PREDICTED: centrosomal and chromosomal factor-like isoform X1 
[Setaria italica]
Length=427

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 97/176 (55%), Gaps = 21/176 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F   + DMF+MN+ LSKHI P+E  + +       +R
Sbjct  268  RKNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLSKHIRPLETTNDS-------KR  320

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + KK + E     +  S   P + + +Q            P  +SD+L  F GTGE  + 
Sbjct  321  ESKKLKSE---GGEPISPVSPVETDVKQ-----------LPFVISDALATFLGTGEREMP  366

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              + VKR+W +IK N L+DP N   ++CD KL++L   +S     +++L++ H  K
Sbjct  367  HSEAVKRVWDHIKSNNLEDPENSTVILCDSKLKQLFGCESLTAQGVSELVSDHLFK  422


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE A++R ++VK++W YI++N LQDP+NKR++IC+D+LR + E DS + F M KLL+ H
Sbjct  249  VGEPAMARTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLSKH  308

Query  199  F  197
             
Sbjct  309  I  309



>ref|XP_004973842.1| PREDICTED: centrosomal and chromosomal factor-like isoform X2 
[Setaria italica]
Length=426

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 97/176 (55%), Gaps = 21/176 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F   + DMF+MN+ LSKHI P+E  + +       +R
Sbjct  267  RKNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLSKHIRPLETTNDS-------KR  319

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + KK + E     +  S   P + + +Q            P  +SD+L  F GTGE  + 
Sbjct  320  ESKKLKSE---GGEPISPVSPVETDVKQ-----------LPFVISDALATFLGTGEREMP  365

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              + VKR+W +IK N L+DP N   ++CD KL++L   +S     +++L++ H  K
Sbjct  366  HSEAVKRVWDHIKSNNLEDPENSTVILCDSKLKQLFGCESLTAQGVSELVSDHLFK  421


 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE A++R ++VK++W YI++N LQDP+NKR++IC+D+LR + E DS + F M KLL+ H
Sbjct  248  VGEPAMARTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLSKH  307

Query  199  F  197
             
Sbjct  308  I  308



>gb|KDO35066.1| hypothetical protein SPRG_01130 [Saprolegnia parasitica CBS 223.65]
Length=355

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 71/200 (36%), Positives = 101/200 (51%), Gaps = 38/200 (19%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++ LQDP  K+ I+ D+TL G+F+  +  MF MN+ L +H+               KE 
Sbjct  138  RDHGLQDPSDKRTILLDDTLKGVFKRDSFTMFSMNKFLKRHV--------------KKES  183

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEK-RQRGLKGG---------------------GTGF  425
            +   G D++  D +S  + E K  EK R++ +K                        TG 
Sbjct  184  EVVNGWDDIIRDGESSEEDEAKTAEKERKKAVKAARKSAAAGKEKGEKPKRAAPAPNTGI  243

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
             AP++LS  L    G  E+ LSR  VVKR+W YIKENELQ+P NK+ +IC++ L  L   
Sbjct  244  NAPLELSKELGAILG--ESVLSRPQVVKRLWAYIKENELQNPENKQEIICNELLTSLFGE  301

Query  244  DSFEGFTMTKLLTAHFIKTA  185
             S   F+M KLL  HF+  A
Sbjct  302  PSVTMFSMNKLLKPHFLGKA  321


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -2

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F + + LS  L +  G  ++  SR  +VK+MW YI+++ LQDPS+KR ++ DD L+ + +
Sbjct  105  FASEMVLSPELAQVLGVDKS--SRPQLVKKMWDYIRDHGLQDPSDKRTILLDDTLKGVFK  162

Query  247  VDSFEGFTMTKLLTAHFIK  191
             DSF  F+M K L  H  K
Sbjct  163  RDSFTMFSMNKFLKRHVKK  181



>ref|XP_010252656.1| PREDICTED: formin-G [Nelumbo nucifera]
 ref|XP_010252657.1| PREDICTED: formin-G [Nelumbo nucifera]
Length=348

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/177 (34%), Positives = 94/177 (53%), Gaps = 28/177 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++NLQDP  K++I+CD+ L  +F     DMF+MN+ L+KHI P+E              
Sbjct  197  RKHNLQDPSNKRKIVCDDALRLVFETDCTDMFKMNKLLAKHIIPLEPT------------  244

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL-SDSLVKFFGTGENAL  362
             ++ G+D      +++S  E               T    P+ + SD+L  FFGT E  +
Sbjct  245  -KEPGQDSKRVKLEAESTIE--------------STEAAPPLLIISDALAMFFGTEEREM  289

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             + + +KR+W YIK N L+DP N   ++CD KL+EL   +SF    ++++L  HF K
Sbjct  290  LQSEALKRVWDYIKLNHLEDPLNSMVILCDAKLQELFGCESFSALGISEMLAHHFFK  346


 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        +GG  G      +S  L      GE ++ R  +VK++W YI+++ LQDP
Sbjct  147  PKESAPAGTKRRGGPGGLNKVCGVSPELQAI--VGEPSMPRTQIVKQLWAYIRKHNLQDP  204

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR+++CDD LR + E D  + F M KLL  H I
Sbjct  205  SNKRKIVCDDALRLVFETDCTDMFKMNKLLAKHII  239



>gb|KDP26953.1| hypothetical protein JCGZ_22250 [Jatropha curcas]
Length=383

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 96/175 (55%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P+E          P + 
Sbjct  232  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLE----------PSKE  281

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  +S ++ + EP                  + + +SD+L KF GTG   ++
Sbjct  282  ASQAKRVKVDVESTTE-NTEP----------------VASAVVISDALAKFLGTGVREMT  324

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  +R+W+YIK N+L+DP N   ++CD KLRELL  +S     + ++L  H +
Sbjct  325  QVEASRRVWEYIKVNQLEDPLNSMVILCDAKLRELLGCESISAVGVEEMLARHHL  379


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 62/112 (55%), Gaps = 3/112 (3%)
 Frame = -2

Query  526  GRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPI-QLSDSLVKFFGTGENALSRGD  350
             + EVY  + +    E  +E       + GG G L  +  +S  L      GE AL R +
Sbjct  165  AKPEVYAQNAAAVPSELSKESAPVGAKRRGGPGGLNKVCGVSPELQAV--VGEPALPRTE  222

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +VK++W YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H I
Sbjct  223  IVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHII  274



>ref|XP_008604916.1| hypothetical protein SDRG_01178 [Saprolegnia diclina VS20]
 gb|EQC41202.1| hypothetical protein SDRG_01178 [Saprolegnia diclina VS20]
Length=356

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 69/200 (35%), Positives = 98/200 (49%), Gaps = 38/200 (19%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++ LQDP  K+ I+ D+TL G+F+  +  MF MN+ L +H+               KE 
Sbjct  139  RDHGLQDPSDKRTILLDDTLKGVFKRDSFTMFSMNKFLKRHV--------------KKES  184

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKR----------------------QRGLKGGGTGF  425
            +   G D++  D +S  + E K  EK                       +R      TG 
Sbjct  185  EVVNGWDDIIRDGESSEEDEAKTAEKERKKAVKAARKVAAAGKEKGEKPKRAAPAPNTGI  244

Query  424  LAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEV  245
             AP++LS  L    G  E+ LSR  VVKR+W YIKENELQ+P NK+ ++C++ L  L   
Sbjct  245  NAPLELSKELGAILG--ESVLSRPQVVKRLWAYIKENELQNPENKQEIVCNELLTSLFGE  302

Query  244  DSFEGFTMTKLLTAHFIKTA  185
             S   F+M KLL  HF+  A
Sbjct  303  PSVTMFSMNKLLKPHFLGKA  322


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 2/79 (3%)
 Frame = -2

Query  427  FLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLE  248
            F + + LS  L +  G  ++  SR  +VK+MW YI+++ LQDPS+KR ++ DD L+ + +
Sbjct  106  FASEMVLSPELAQVLGVEKS--SRPQLVKKMWDYIRDHGLQDPSDKRTILLDDTLKGVFK  163

Query  247  VDSFEGFTMTKLLTAHFIK  191
             DSF  F+M K L  H  K
Sbjct  164  RDSFTMFSMNKFLKRHVKK  182



>ref|XP_006352354.1| PREDICTED: uncharacterized protein LOC102595561 [Solanum tuberosum]
Length=363

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 97/176 (55%), Gaps = 27/176 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++NLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI  ++          P ++
Sbjct  214  RKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHITALD----------PSKQ  263

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  DS + +  +P                    + +SD+L KFFG+ E  + 
Sbjct  264  ADQAKRLKVEADSVATNVEQPVSST----------------VTISDALAKFFGSEEKEIL  307

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTA-HFI  194
            + D VKR+W+YIK N+L+DP N   ++CD KL+ELL+ +S     + ++L   HF+
Sbjct  308  QTDAVKRIWEYIKLNQLEDPVNSSMIVCDAKLQELLQCESVSATELPEMLAGRHFV  363


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 2/102 (2%)
 Frame = -2

Query  502  SDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYI  323
            + S+    PK+        +GG  G      +S  L    G  +  + R ++VK++W YI
Sbjct  156  ASSNVASAPKESATSGTKRRGGPGGLNKVCGVSPELQAIVG--QPTMPRTEIVKQLWVYI  213

Query  322  KENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +++ LQDP NKR++IC+D LR L E D  + F M KLL  H 
Sbjct  214  RKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHI  255



>gb|EMT17610.1| Upstream activation factor subunit UAF30 [Aegilops tauschii]
Length=429

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 98/177 (55%), Gaps = 25/177 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R N+LQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E       K + ++ 
Sbjct  272  RRNDLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIKPLEP-----TKDSNRDM  326

Query  538  QRKKGRDEVYTDSDSD-SDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            ++ K  ++V      D +  +P                   P+ +SD+L  FFGTGE  +
Sbjct  327  KKLKPVEDVPVPLAEDVATNQP-------------------PLNVSDALASFFGTGEREM  367

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            S+ +VVK +W +IK N L+DPSN   ++CD KL++L   +S     +++LL+ H  K
Sbjct  368  SQSEVVKCVWDHIKSNNLEDPSNPTMILCDSKLKDLFGCESVTASAVSELLSDHLFK  424


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE  ++R ++VK++W YI+ N+LQDP+NKR++IC+D+LR + E D  + F M KLL  H
Sbjct  253  VGEPTMARTEIVKQLWAYIRRNDLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKH  312

Query  199  F  197
             
Sbjct  313  I  313



>ref|XP_010270124.1| PREDICTED: uncharacterized protein LOC104606552 [Nelumbo nucifera]
 ref|XP_010270125.1| PREDICTED: uncharacterized protein LOC104606552 [Nelumbo nucifera]
Length=344

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/176 (34%), Positives = 92/176 (52%), Gaps = 26/176 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++NLQDP  K++IICD+ L  +F   + DMF+MN+ L+KHI P+E              
Sbjct  193  RKHNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHIIPLEP-------------  239

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             ++ G+D      D +S  E  +           G   +    +SD+L KFFGTGE  + 
Sbjct  240  TKESGQDSKRIKLDVESTTESAE----------AGQSLVV---ISDALAKFFGTGEREMI  286

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + + ++ +W+YIK N L+DP N   ++CD KL+EL    S     + ++L  H  K
Sbjct  287  QAEALRCLWEYIKLNHLEDPLNSMVILCDAKLQELFGCASLAAMGIPEMLAHHLFK  342


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVK  341
            D    +S + +   PK+    +   +GG  G      +S  L      GE A+ R  +VK
Sbjct  129  DAFVQNSAAPAPEVPKESAPSRAKRRGGPGGLNKVCGVSPELQAI--VGEPAMPRTQIVK  186

Query  340  RMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            ++W YI+++ LQDPSNKR++ICDD LR + E DS + F M KLL  H I
Sbjct  187  QLWAYIRKHNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHII  235



>ref|XP_006283894.1| hypothetical protein CARUB_v10005012mg [Capsella rubella]
 gb|EOA16792.1| hypothetical protein CARUB_v10005012mg [Capsella rubella]
Length=388

 Score =   112 bits (281),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 97/176 (55%), Gaps = 21/176 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++          P + 
Sbjct  232  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLD----------PTKD  281

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +   ++ +++  EP         + G          LS+SL KFFGTGE  ++
Sbjct  282  SGQAKRAKAEVETKTETTTEPLST------VAGSSNA-----TLSESLSKFFGTGETEMT  330

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP N   + CD+KLRELL  +S     + ++L  H  K
Sbjct  331  DEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRELLGCESISAVGINEMLRRHMYK  386


 Score = 79.7 bits (195),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDP
Sbjct  182  PKESAPAGTKRKGGPGGLNKVCRVSPELQVV--VGEPALPRTEIVRQLWAYIRKNNLQDP  239

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  240  SNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  274



>emb|CDX98747.1| BnaA03g45320D [Brassica napus]
Length=365

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 92/184 (50%), Gaps = 37/184 (20%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P+               
Sbjct  213  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPL---------------  257

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQ------LSDSLVKFFGT  377
                       D   DS      + KR +      T    P+       LS+ L KFFGT
Sbjct  258  -----------DPSKDSG-----QAKRAKAEVETKTETTEPVSSTSAVALSEPLAKFFGT  301

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            GE  ++   +++R+W+YIK N L+DP+N   + CD+KLR+LL  +S     + ++L  H 
Sbjct  302  GETEMTEEAIIRRVWEYIKLNNLEDPANPMAIQCDEKLRDLLGCESISAVGINEMLRRHM  361

Query  196  IKTA  185
             K +
Sbjct  362  YKPS  365


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDPSNKR++ICDD 
Sbjct  174  KGGPGGLNKVCRVSPELEVV--VGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDA  231

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E D  + F M KLL  H +
Sbjct  232  LRVVFETDCTDMFKMNKLLAKHIL  255



>ref|XP_009137258.1| PREDICTED: formin-like protein 4 [Brassica rapa]
Length=364

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/184 (34%), Positives = 92/184 (50%), Gaps = 37/184 (20%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P+               
Sbjct  212  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPL---------------  256

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQ------LSDSLVKFFGT  377
                       D   DS      + KR +      T    P+       LS+ L KFFGT
Sbjct  257  -----------DPSKDSG-----QAKRAKAEVETKTETTEPVSSTSAVALSEPLAKFFGT  300

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            GE  ++   +++R+W+YIK N L+DP+N   + CD+KLR+LL  +S     + ++L  H 
Sbjct  301  GETEMTEEAIIRRVWEYIKLNNLEDPANPMAIQCDEKLRDLLGCESISAVGINEMLRRHM  360

Query  196  IKTA  185
             K +
Sbjct  361  YKPS  364


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDPSNKR++ICDD 
Sbjct  173  KGGPGGLNKVCRVSPELEVV--VGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDA  230

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E D  + F M KLL  H +
Sbjct  231  LRVVFETDCTDMFKMNKLLAKHIL  254



>gb|AFW65191.1| hypothetical protein ZEAMMB73_350137 [Zea mays]
Length=802

 Score =   115 bits (287),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 62/173 (36%), Positives = 94/173 (54%), Gaps = 33/173 (19%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F   + DMF+MN+ LSKHI P+E ++     S P+ +
Sbjct  634  RRNNLQDPNNKRKIICNDELRLVFETDSTDMFQMNKLLSKHIRPLESKN----DSKPEAK  689

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + K   DE  +  ++D +                      P+ +SD+L  FFGTGE  + 
Sbjct  690  KLKPQGDEPISSVETDVN--------------------QLPLMVSDALATFFGTGEREMV  729

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
              + VKR+W +IK N+L+DP N   ++CD KL++L   +S         LTAH
Sbjct  730  HSEAVKRVWDHIKSNDLEDPENPTVILCDSKLKQLFGRES---------LTAH  773


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/59 (53%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = -2

Query  376  GENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
            GE A++R ++VK++W YI+ N LQDP+NKR++IC+D+LR + E DS + F M KLL+ H
Sbjct  616  GEPAMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFQMNKLLSKH  674



>ref|XP_002520558.1| brg-1 associated factor, putative [Ricinus communis]
 gb|EEF41791.1| brg-1 associated factor, putative [Ricinus communis]
Length=397

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 96/175 (55%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P+E         T +  
Sbjct  246  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLE--------PTKESA  297

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + +V + ++   + EP           G        I +S++L KF GTG   ++
Sbjct  298  QAKRAKVDVESTTE---NAEP-----------GASV-----IVISEALAKFLGTGGREMT  338

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  +R+W+YIK N L+DP N   ++CD KLRELL  +S     + ++L  H +
Sbjct  339  QLEASRRVWEYIKVNRLEDPLNSMVILCDAKLRELLGCESISAVGVEEMLARHHL  393


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 63/112 (56%), Gaps = 3/112 (3%)
 Frame = -2

Query  526  GRDEVYTDSDSDSDFE-PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGD  350
             ++EV++ + +    E PK+        +GG  G      +S  L      GE AL R +
Sbjct  179  AKNEVFSQNATPVPSELPKESAPVGAKRRGGPGGLNKVCGVSPELQAI--VGEPALPRTE  236

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +VK++W YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H I
Sbjct  237  IVKQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHII  288



>ref|XP_011095959.1| PREDICTED: uncharacterized protein LOC105175270 [Sesamum indicum]
Length=331

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/175 (34%), Positives = 95/175 (54%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++NLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++           +  
Sbjct  181  RKHNLQDPGNKRKIICDDALRMVFETDCTDMFKMNKLLAKHILPLDPMK--------QSS  232

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q KK + E   D+  + + +P                 L P+ +SD+L KFFGTG   + 
Sbjct  233  QAKKSKLE---DASPNQNSDPS----------------LLPVIISDALAKFFGTGVREML  273

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + + + R+W+YIK N+L+DP +   + CD KL+ELL  +S     + ++L  H +
Sbjct  274  QSEALGRVWEYIKVNQLEDPLSSMVIHCDAKLQELLGCESISALGIQEMLVRHHL  328


 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++VK++W YI+++ LQDP NKR++ICDD LR + E D  + F M KLL  H
Sbjct  162  VGEPALPRTEIVKQLWAYIRKHNLQDPGNKRKIICDDALRMVFETDCTDMFKMNKLLAKH  221

Query  199  FI  194
             +
Sbjct  222  IL  223



>ref|XP_011095484.1| PREDICTED: uncharacterized protein LOC105174926 [Sesamum indicum]
 ref|XP_011095486.1| PREDICTED: uncharacterized protein LOC105174926 [Sesamum indicum]
Length=358

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 94/171 (55%), Gaps = 21/171 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E       K T +  
Sbjct  201  RKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHILPLEP-----TKQTAENA  255

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +R K        + SDS                 G   +  + +S++L  FFGT E  +S
Sbjct  256  KRLKVAAVKVDVAGSDSK----------------GDDPVPIVLISEALASFFGTEEREMS  299

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT  206
            + +V+++MW+YIK N+L+DP N   ++CD KL+ELL  +S     + ++L 
Sbjct  300  QAEVLRQMWEYIKVNQLEDPLNPAAIVCDAKLQELLGCESISALGIPEMLA  350


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 60/107 (56%), Gaps = 7/107 (7%)
 Frame = -2

Query  514  VYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRM  335
            V T S S  +  P  +++R     GG  G      +S  L      G+  L R ++VK++
Sbjct  144  VTTASVSAKESVPTAKKRR-----GGPGGLNKLCGVSPELQTI--VGQPTLPRTEIVKQL  196

Query  334  WKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            W YI++N LQDP+NKR++IC+D+LR + E D  + F M KLL  H +
Sbjct  197  WAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIL  243



>ref|XP_002869827.1| hypothetical protein ARALYDRAFT_492627 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46086.1| hypothetical protein ARALYDRAFT_492627 [Arabidopsis lyrata subsp. 
lyrata]
Length=370

 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 94/176 (53%), Gaps = 17/176 (10%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  210  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSG  261

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q KK + EV T +++                        + + LS+ L KFFGTGE  ++
Sbjct  262  QAKKAKAEVETKTETTEPVN---------STAVSSAAVSSTVALSEPLAKFFGTGEAEMT  312

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP N   + CD+KLR+LL  +S     + ++L  H  K
Sbjct  313  DKEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGCESISAVGINEMLRRHMYK  368


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = -2

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +V+++W YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  201  IVRQLWAYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  252



>ref|XP_010042645.1| PREDICTED: uncharacterized protein LOC104431786, partial [Eucalyptus 
grandis]
Length=227

 Score =   109 bits (272),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 94/175 (54%), Gaps = 28/175 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ LSKHI P++          P + 
Sbjct  77   RKNNLQDPSNKRKIICDDALRLVFETDCTDMFKMNKLLSKHIIPLQ----------PTKE  126

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  +S + S          Q G         A + +S++L KF GTGE  + 
Sbjct  127  SGQAKRLKVSAESPNISS---------QTG---------ASVIISEALAKFLGTGEREML  168

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  +R+W+YIK ++L+DP N   + CD +LRELL  +S     + +LL  H +
Sbjct  169  QTEAHRRVWEYIKIHQLEDPLNPMGIHCDARLRELLGCESISALGVPELLERHHL  223


 Score = 80.9 bits (198),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++VK++W YI++N LQDPSNKR++ICDD LR + E D  + F M KLL+ H
Sbjct  58   VGEPALPRTEIVKQLWAYIRKNNLQDPSNKRKIICDDALRLVFETDCTDMFKMNKLLSKH  117

Query  199  FI  194
             I
Sbjct  118  II  119



>emb|CDY27449.1| BnaC03g64890D [Brassica napus]
Length=324

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 91/174 (52%), Gaps = 26/174 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  176  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSS  227

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + EV T +      EP                      LS+ L KFFGTGE  ++
Sbjct  228  QSKRAKAEVETKTK-----EPVSSTSSTV-------------SLSEPLAKFFGTGEMVMT  269

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
              +++ R+W+YIK N L+DP+N   + CD+KLRELL  +S     + ++L  H 
Sbjct  270  DEEIICRVWEYIKLNHLEDPANPMAIQCDEKLRELLGCESISAVGINEMLRRHI  323


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDPSNKR++ICDD 
Sbjct  137  KGGPGGLNKVCRVSPELQVV--VGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDA  194

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E D  + F M KLL  H +
Sbjct  195  LRVVFETDCTDMFKMNKLLAKHIL  218



>ref|XP_010448899.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily D member 1-like [Camelina sativa]
 ref|XP_010448900.1| PREDICTED: SWI/SNF-related matrix-associated actin-dependent 
regulator of chromatin subfamily D member 1-like [Camelina sativa]
Length=246

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/207 (33%), Positives = 110/207 (53%), Gaps = 35/207 (17%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++         +    
Sbjct  51   RKNNLQDPSNKRKIICDDALRVVFET---DMFKMNKLLAKHILPLD--------PSKDSG  99

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + EV T +++ ++  P                  + + LS+SL KFFGTGE  ++
Sbjct  100  QAKRAKAEVDTKNET-TELTPV-----------SSAPVSSTVTLSESLSKFFGTGETEMT  147

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTAG*  179
              +++ R+W+YIK N L+D  N   + CD+KLR+LL  +S     + ++L  H  K +  
Sbjct  148  DEEIILRVWEYIKLNNLEDLVNPMAIQCDEKLRDLLGCESIAAAGINEMLRRHMYKQS--  205

Query  178  CYLTFLAT*KCL-------LSCFSFPL  119
            C ++++    CL       L C + PL
Sbjct  206  CSVSYVF---CLSMIYVITLRCLANPL  229


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 5/84 (6%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            KGG  G      +S  L      GE AL R ++V+++W YI++N LQDPSNKR++ICDD 
Sbjct  12   KGGPGGLNKVCWVSPELQVV--VGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDA  69

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E D F+   M KLL  H +
Sbjct  70   LRVVFETDMFK---MNKLLAKHIL  90



>gb|ACN26234.1| unknown [Zea mays]
Length=70

 Score =   104 bits (259),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 59/69 (86%), Gaps = 0/69 (0%)
 Frame = -2

Query  394  VKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTK  215
            +KF GTGE+ LSR DVVKRMW YIKEN LQDPS++R++ICD+KL++LL V++F GFT++K
Sbjct  1    MKFIGTGESMLSRSDVVKRMWDYIKENNLQDPSDRRKIICDEKLKDLLGVETFTGFTVSK  60

Query  214  LLTAHFIKT  188
            LL  HF KT
Sbjct  61   LLAPHFTKT  69



>ref|NP_567661.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
 gb|AAL24145.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14205.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84600.1| SWIB complex BAF60b domain-containing protein [Arabidopsis thaliana]
Length=385

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 95/176 (54%), Gaps = 22/176 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  230  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSG  281

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q KK + EV T +++                    T   + + LS+ L KFFGTGE  ++
Sbjct  282  QAKKAKTEVETKTETTEPIS--------------STAISSTVTLSEPLGKFFGTGETEMA  327

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP N   + CD+KLR+LL  +S     + ++L  H  K
Sbjct  328  DEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGCESISAVGINEMLRRHMYK  383


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDP
Sbjct  180  PKESAPAGTKRKGGPGGLNKVCRVSPELEVV--VGEPALPRTEIVRQLWAYIRKNNLQDP  237

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  238  SNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  272



>ref|XP_009770617.1| PREDICTED: uncharacterized protein LOC104221287 [Nicotiana sylvestris]
 ref|XP_009770618.1| PREDICTED: uncharacterized protein LOC104221287 [Nicotiana sylvestris]
Length=371

 Score =   110 bits (276),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 99/176 (56%), Gaps = 7/176 (4%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++NLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI  +   D +  +   + +
Sbjct  202  RKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHITAL---DPSKAEQADQAK  258

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + K   D +    ++ S     +       +K   +  +A   +SD+L KFFG+ E  + 
Sbjct  259  RLKVEADPMAAKVEAHSVAAKVEVHSTAAKVKQPDSSTVA---ISDALAKFFGSEEKEIP  315

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT-AHFI  194
            + +  KR+W+YIK N+L+DP N   ++CD KL+ELLE +S     + ++L   HF+
Sbjct  316  QTEAFKRIWEYIKLNQLEDPVNSMVIVCDAKLQELLECESISALEIPQMLARRHFV  371


 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 2/100 (2%)
 Frame = -2

Query  496  SDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKE  317
            S++   PK+        +GG  G      +S  L      G+ A+ R ++VK++W YI++
Sbjct  146  SNAASAPKESATSGTKRRGGPGGLNKVCGVSPELQAI--VGQPAMPRTEIVKQLWVYIRK  203

Query  316  NELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            + LQDP NKR++IC+D LR L E D  + F M KLL  H 
Sbjct  204  HNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHI  243



>emb|CAN72895.1| hypothetical protein VITISV_022315 [Vitis vinifera]
Length=339

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 92/175 (53%), Gaps = 32/175 (18%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F   + DMF+MN+ L+KHI P+E          P   
Sbjct  193  RKNNLQDPSNKRKIICDDALRLVFETDSTDMFKMNKLLAKHIIPLE----------PSRE  242

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  +S ++S                      +P+ +SD+L  FFGTGE  + 
Sbjct  243  SSQAKRLKVDVESATES-----------------SEASPSPVMISDALATFFGTGEREML  285

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + + ++R+W+YIK     DP N   ++CD KLREL   +S     ++++L  H +
Sbjct  286  QEEALRRVWEYIK-----DPLNSMAILCDAKLRELFGCESISALGVSEMLARHHL  335


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        +GG  G      +S  L      GE  + R  +VK++W YI++N LQDP
Sbjct  143  PKESAPAAXKRRGGSGGLNKVCGVSTELQAV--VGEPTMPRTQIVKQLWAYIRKNNLQDP  200

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E DS + F M KLL  H I
Sbjct  201  SNKRKIICDDALRLVFETDSTDMFKMNKLLAKHII  235



>ref|XP_009411861.1| PREDICTED: formin-like protein 18 [Musa acuminata subsp. malaccensis]
Length=369

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 96/176 (55%), Gaps = 25/176 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F   + DMF+MN+ L+KHI P++       K T  E 
Sbjct  217  RQNNLQDPNNKRKIICNDELRRVFETDSTDMFKMNKLLAKHIIPLDDP-----KDTGPEP  271

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++ K  D   T+       EP  +E               P+ +SD+LVKFFG+ E  + 
Sbjct  272  KKLKAADVAATEVT-----EPASDEY--------------PLFISDALVKFFGSDEREML  312

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + + + R+W YIK N+L+D SN   ++CD KL+EL   +S     ++ +L  H  K
Sbjct  313  QSEALSRIWDYIKANQLEDSSNT-SILCDSKLQELFGCESLPISGISDMLANHLFK  367


 Score = 82.0 bits (201),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+    +   +GG  G      +S  L      GE A+SR  +VK++W YI++N LQDP
Sbjct  167  PKESAPPRAKRRGGPGGLNKVCGVSPELQPI--VGEAAMSRTQIVKQLWAYIRQNNLQDP  224

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +NKR++IC+D+LR + E DS + F M KLL  H I
Sbjct  225  NNKRKIICNDELRRVFETDSTDMFKMNKLLAKHII  259



>gb|AAM61516.1| unknown [Arabidopsis thaliana]
Length=385

 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 62/176 (35%), Positives = 95/176 (54%), Gaps = 22/176 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  230  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSG  281

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q KK + EV T +++                    T   + + LS+ L KFFGTGE  ++
Sbjct  282  QAKKAKTEVETKTETTEPVS--------------STAISSTVTLSEPLGKFFGTGETEMA  327

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP N   + CD+KLR+LL  +S     + ++L  H  K
Sbjct  328  DEEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRDLLGCESISAVGINEMLRRHMYK  383


 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDP
Sbjct  180  PKESAPAGTKRKGGPGGLNKVCRVSPELEVV--VGEPALPRTEIVRQLWAYIRKNNLQDP  237

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  238  SNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  272



>emb|CDP13762.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/177 (33%), Positives = 96/177 (54%), Gaps = 28/177 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E    T        +
Sbjct  208  RKNNLQDPNNKRKIICNDELRVVFETDCTDMFKMNKLLAKHIIPLEPTKQT-------AQ  260

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KK + EV + S+S +                     +  + +S++L  FFGT E  +S
Sbjct  261  NAKKAKIEVESGSESANT--------------------VPVVVISEALANFFGTDEREMS  300

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT-AHFIK  191
            + +V++++W+YIK N+L+DP N   ++CD KL+EL    S     + ++L   H +K
Sbjct  301  QAEVLRQVWEYIKVNQLEDPLNSMAIMCDAKLQELFGCQSISALGIPEMLARLHLLK  357


 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             G+  + R ++VK++W YI++N LQDP+NKR++IC+D+LR + E D  + F M KLL  H
Sbjct  189  VGQATMPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRVVFETDCTDMFKMNKLLAKH  248

Query  199  FI  194
             I
Sbjct  249  II  250



>gb|EYU27400.1| hypothetical protein MIMGU_mgv1a008947mg [Erythranthe guttata]
Length=357

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 61/172 (35%), Positives = 94/172 (55%), Gaps = 28/172 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI       + L  + PK +
Sbjct  205  RKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHI-------IALEPTKPKAQ  257

Query  538  QRKKGR-DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
              KK + D V + S  D D  P                    + +S++L  FFG  E  +
Sbjct  258  SAKKPKVDAVESGSKVD-DPVPH-------------------VIISEALASFFGIDEREM  297

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT  206
            S+ +V+++MW+YIK N L+DPSN   +ICD KL+ELL  ++     + ++L 
Sbjct  298  SQAEVLRQMWEYIKVNHLEDPSNPTAIICDAKLQELLGCENISALGIPEMLA  349


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 55/90 (61%), Gaps = 5/90 (6%)
 Frame = -2

Query  463  KRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRR  284
            K++RG  GG         L   +V     G+  L+R ++VK++W YI++N LQDP+NKR+
Sbjct  163  KKRRGGPGGLNKLCGVSPLLQPIV-----GQPTLARTEIVKQLWAYIRKNNLQDPNNKRK  217

Query  283  VICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +IC+D+LR + E D  + F M KLL  H I
Sbjct  218  IICNDELRLVFETDCTDMFKMNKLLAKHII  247



>gb|EEC83834.1| hypothetical protein OsI_29784 [Oryza sativa Indica Group]
Length=394

 Score =   109 bits (273),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 83/164 (51%), Gaps = 24/164 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F   + DMF+MN+ L+KHI P+E              
Sbjct  249  RRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKHIRPLEA-------------  295

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++   RD             P + +  Q            PI LSD+L  FFGTGE  + 
Sbjct  296  KKDSNRDSKKLKPVDSEPISPAETDVNQ-----------LPIILSDALASFFGTGEKEMP  344

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  227
              + VKR+W +IK N L+DP+N   ++CD KL++L   +S    
Sbjct  345  SSEAVKRVWDHIKSNNLEDPANPTMILCDSKLKQLFGCESLTAM  388


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE  ++R ++VK++W YI+ N LQDP+NKR++IC+D+LR + E DS + F M KLL  H
Sbjct  230  VGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKH  289

Query  199  F  197
             
Sbjct  290  I  290



>gb|EEE68957.1| hypothetical protein OsJ_27851 [Oryza sativa Japonica Group]
Length=333

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/164 (35%), Positives = 83/164 (51%), Gaps = 24/164 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F   + DMF+MN+ L+KHI P+E              
Sbjct  188  RRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKHIRPLEA-------------  234

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++   RD             P + +  Q            PI LSD+L  FFGTGE  + 
Sbjct  235  KKDSNRDSKKLKPVDSEPISPAETDVNQ-----------LPIILSDALASFFGTGEKEMP  283

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGF  227
              + VKR+W +IK N L+DP+N   ++CD KL++L   +S    
Sbjct  284  SSEAVKRVWDHIKSNNLEDPANPTMILCDSKLKQLFGCESLTAM  327


 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE  ++R ++VK++W YI+ N LQDP+NKR++IC+D+LR + E DS + F M KLL  H
Sbjct  169  VGEPTMARTEIVKQLWAYIRRNNLQDPNNKRKIICNDELRLVFETDSTDMFKMNKLLAKH  228

Query  199  F  197
             
Sbjct  229  I  229



>ref|XP_006413663.1| hypothetical protein EUTSA_v10025487mg [Eutrema salsugineum]
 gb|ESQ55116.1| hypothetical protein EUTSA_v10025487mg [Eutrema salsugineum]
Length=375

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 61/176 (35%), Positives = 95/176 (54%), Gaps = 23/176 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++              
Sbjct  221  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSK--------DSG  272

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + EV T +++ ++                     + I LS+ L  FFGTGE  ++
Sbjct  273  QAKRAKAEVETKTETQTETT---------------EPVSSAIALSEPLANFFGTGETEMA  317

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              ++++R+W+YIK N L+DP N   + CD+KLRELL  +S     + ++L  H  K
Sbjct  318  DDEIIRRVWEYIKLNNLEDPVNPMAIQCDEKLRELLGCESISAVGINEMLRRHMYK  373


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 55/95 (58%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDP
Sbjct  171  PKESAPAGTKRKGGPGGLNKVCRVSPELQVV--VGEPALPRTEIVRQLWAYIRKNNLQDP  228

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            SNKR++ICDD LR + E D  + F M KLL  H +
Sbjct  229  SNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIL  263



>gb|EYU27702.1| hypothetical protein MIMGU_mgv1a010230mg [Erythranthe guttata]
Length=318

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 96/175 (55%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++NLQDP  +++IICD+ L  +F + + DMF+MN+ L+KHI P++    +      ++ 
Sbjct  168  RKHNLQDPGNRRKIICDDALRLVFEIDSTDMFKMNKLLAKHILPLDPTKQS------EQA  221

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
             + K  DE  T  + DS                     L P+ +S+ L  FFGTGE  + 
Sbjct  222  MKLKNEDE-STKQNQDSS--------------------LVPVVISEPLSNFFGTGEKEML  260

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + + ++R+W+Y+K N+L+DP +   + CD KL+ELL  +S     + ++L  H +
Sbjct  261  QSEALERVWEYVKVNQLEDPLSSMVIHCDAKLQELLGCESISALGIQEMLIRHHL  315


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            +GG  G      +S  L      GE AL R ++VK++W YI+++ LQDP N+R++ICDD 
Sbjct  129  RGGPGGLNKVCGVSPELQAI--VGEPALPRTEIVKQLWAYIRKHNLQDPGNRRKIICDDA  186

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E+DS + F M KLL  H +
Sbjct  187  LRLVFEIDSTDMFKMNKLLAKHIL  210



>ref|XP_004150254.1| PREDICTED: uncharacterized protein LOC101217066 [Cucumis sativus]
 gb|KGN59077.1| hypothetical protein Csa_3G758990 [Cucumis sativus]
Length=342

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 87/175 (50%), Gaps = 25/175 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E           K  
Sbjct  189  RKNNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLEPT---------KPS  239

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KK R                 E +    +K         + +S++L  FFG     + 
Sbjct  240  SSKKAR----------------VENESAVSVKSAEPSICPSVIISEALANFFGVDGREML  283

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +V++R+W+YIK N L+DP N   V+CD KLREL   +S     + ++L  H I
Sbjct  284  QSEVLRRIWEYIKVNHLEDPLNPMAVLCDAKLRELFGCESISALGIPEVLGRHHI  338


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 3/109 (3%)
 Frame = -2

Query  520  DEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVK  341
            D V   +   SD  PK+  + +   +GG  G      +S  L    G  E  L R ++VK
Sbjct  126  DSVVAPTVPGSD-PPKESTQTKTKRRGGPGGLNKLCGVSPELQAIVGQPE--LPRTEIVK  182

Query  340  RMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            ++W YI++N LQDPSNKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  183  QLWAYIRKNNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHII  231



>ref|XP_008447697.1| PREDICTED: uncharacterized protein LOC103490111 [Cucumis melo]
 ref|XP_008447700.1| PREDICTED: uncharacterized protein LOC103490111 [Cucumis melo]
Length=343

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 87/175 (50%), Gaps = 25/175 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E           K  
Sbjct  190  RKNNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLEPT---------KPS  240

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KK R                 E +    +K         + +S++L  FFG     + 
Sbjct  241  SSKKAR----------------VENESAVSVKSAEPSICPSVIISEALANFFGVDGREML  284

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +V++R+W+YIK N L+DP N   V+CD KLREL   +S     + ++L  H I
Sbjct  285  QSEVLRRIWEYIKVNHLEDPLNPMAVLCDAKLRELFGCESISALGIPEVLGRHHI  339


 Score = 79.7 bits (195),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 73/148 (49%), Gaps = 10/148 (7%)
 Frame = -2

Query  631  DMFRMNQTLSKHIWPIEKEDV--TLVKSTPKERQRKKGRDEVYTDSDSDSDFEPKQEEKR  458
            D+F ++Q+ +    P        T     P  +      D V   +   SD  PK+  + 
Sbjct  93   DLFALHQSPNFQSAPSPTSSAFHTFTAQPPTAKA-----DSVVAPTVPGSD-PPKESTQT  146

Query  457  QRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVI  278
            +   +GG  G      +S  L    G  E  L R ++VK++W YI++N LQDPSNKR++I
Sbjct  147  KTKRRGGPGGLNKLCGVSPELQAIVGQPE--LPRTEIVKQLWAYIRKNNLQDPSNKRKII  204

Query  277  CDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            C+D+LR + E D  + F M KLL  H I
Sbjct  205  CNDELRLVFETDCTDMFKMNKLLAKHII  232



>ref|XP_004163283.1| PREDICTED: uncharacterized LOC101217066, partial [Cucumis sativus]
Length=341

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 87/175 (50%), Gaps = 25/175 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E           K  
Sbjct  188  RKNNLQDPSNKRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLEPT---------KPS  238

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              KK R                 E +    +K         + +S++L  FFG     + 
Sbjct  239  SSKKAR----------------VENESAVSVKSAEPSICPSVIISEALANFFGVDGREML  282

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +V++R+W+YIK N L+DP N   V+CD KLREL   +S     + ++L  H I
Sbjct  283  QSEVLRRIWEYIKVNHLEDPLNPMAVLCDAKLRELFGCESISALGIPEVLGRHHI  337


 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 70/146 (48%), Gaps = 19/146 (13%)
 Frame = -2

Query  589  PIEKEDVTLVKSTPKERQRKKGRDE-------VYTDSDSDSDF-------EPKQEEKRQR  452
            P  K D  +  + P     K+G          ++  S    DF       E  Q + ++R
Sbjct  90   PPAKPDSVVAPTVPGSDPPKEGSASFSSGLRSLFRISGQKCDFLLLSWLLENTQTKTKRR  149

Query  451  GLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICD  272
            G  GG         +S  L    G  E  L R ++VK++W YI++N LQDPSNKR++IC+
Sbjct  150  GGPGGLNKLCG---VSPELQAIVGQPE--LPRTEIVKQLWAYIRKNNLQDPSNKRKIICN  204

Query  271  DKLRELLEVDSFEGFTMTKLLTAHFI  194
            D+LR + E D  + F M KLL  H I
Sbjct  205  DELRLVFETDCTDMFKMNKLLAKHII  230



>ref|XP_009623786.1| PREDICTED: protein TRI1 [Nicotiana tomentosiformis]
 ref|XP_009623787.1| PREDICTED: protein TRI1 [Nicotiana tomentosiformis]
Length=371

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 59/180 (33%), Positives = 98/180 (54%), Gaps = 14/180 (8%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPI----EKEDVTLVKST  551
            R++NLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI  +    + E     K  
Sbjct  201  RKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHITALDPSKQAEQADQAKRL  260

Query  550  PKERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGE  371
              E +    + E ++ +         + E      K     F + + +SD+L KFFG+ E
Sbjct  261  KVEAEPMAAKVEAHSVA--------AKVETHSMAAKVEQPVF-STVTISDALAKFFGSEE  311

Query  370  NALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT-AHFI  194
              + + + +KR+W+YIK N+L+DP N   ++CD KL+ELLE +S     + ++L   HF+
Sbjct  312  KEIPQTEALKRIWEYIKLNQLEDPVNSMVIMCDAKLQELLECESISASEIPQMLARRHFV  371


 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 2/102 (2%)
 Frame = -2

Query  502  SDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYI  323
            + S+    PK+        +GG  G      +S  L      G+ A+ R ++VK++W YI
Sbjct  143  ATSNVASAPKESATSGTKRRGGPGGLNKVCGVSPELQAI--VGQPAMPRTEIVKQLWVYI  200

Query  322  KENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +++ LQDP NKR++IC+D LR L E D  + F M KLL  H 
Sbjct  201  RKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHI  242



>gb|KHG15356.1| Upstream activation factor subunit spp27 [Gossypium arboreum]
Length=373

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+N+LQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++           +  
Sbjct  222  RKNSLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHITPLDPSK--------ESS  273

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q +KG+ +V               E    G++ G      P+ +S++L KF GTG   + 
Sbjct  274  QTRKGKVKV---------------ESTTEGVEPGPK----PVIISEALAKFLGTGGREML  314

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
              +   R+W+YIK N L+DPSN   V+CD  LRELL  +S     + + L  H +
Sbjct  315  ATEAENRVWEYIKANHLEDPSNSMVVLCDANLRELLGCESISVVGVRETLLRHHL  369


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 51/83 (61%), Gaps = 2/83 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            +GG  G      +S +L    G  E AL R ++VK++W YI++N LQDPSNKR++ICDD 
Sbjct  183  RGGSGGLNKVCSVSPALQAIVG--EPALPRTEIVKQLWAYIRKNSLQDPSNKRKIICDDA  240

Query  265  LRELLEVDSFEGFTMTKLLTAHF  197
            LR + E D  + F M KLL  H 
Sbjct  241  LRVVFETDCTDMFKMNKLLAKHI  263



>ref|XP_011097816.1| PREDICTED: uncharacterized protein LOC105176645 [Sesamum indicum]
Length=347

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 99/176 (56%), Gaps = 29/176 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI  +E           K+ 
Sbjct  196  RKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKHITALEPT---------KQT  246

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQL-SDSLVKFFGTGENAL  362
             + K + +V  +S+ ++D +P                   PI + S++L  FFGT E  +
Sbjct  247  TQNKKKLKVDVESEKNTD-DP------------------VPIVIISEALANFFGTDEREM  287

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            S+ +V+++MW+YIK ++L+DP N   ++C+ KL+ELL  +S     + ++L  H +
Sbjct  288  SQAEVLRQMWEYIKVHQLEDPLNSTTILCNAKLQELLGCESISALGIPEMLAQHHL  343


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             G+  L R ++VK++W YI++N LQDP+NKR++IC+D+LR + E D  + F M KLL  H
Sbjct  177  VGQPTLPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRLVFETDCTDMFKMNKLLAKH  236

Query  199  F  197
             
Sbjct  237  I  237



>gb|KJB68547.1| hypothetical protein B456_010G249800 [Gossypium raimondii]
Length=369

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 91/175 (52%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+N+LQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++           +  
Sbjct  218  RKNSLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHITPLDPSK--------ESS  269

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q +KG+ +V               E    G++ G      P+ LS++L KF GTG   + 
Sbjct  270  QTRKGKVKV---------------ESTTEGVEPGPK----PVILSEALAKFLGTGGREML  310

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
              +   R+W+YIK N L+DPSN   V+CD  LRELL  +S     + + L  H +
Sbjct  311  ATEAENRVWEYIKVNRLEDPSNSMVVLCDANLRELLGCESISVMGVRETLLRHHL  365


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 50/94 (53%), Gaps = 6/94 (6%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        +GG  G      +S +L      GE AL R +    +W YI++N LQDP
Sbjct  172  PKESAPVGPKRRGGSGGLNKVCSVSPALQAI--VGEPALPRTE----LWAYIRKNSLQDP  225

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            SNKR++ICDD LR + E D  + F M KLL  H 
Sbjct  226  SNKRKIICDDALRVVFETDCTDMFKMNKLLAKHI  259



>ref|XP_004293361.1| PREDICTED: uncharacterized protein LOC101314347 [Fragaria vesca 
subsp. vesca]
Length=367

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 93/178 (52%), Gaps = 28/178 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTL-VKSTPKE  542
            R++NLQDP  K++IICD+ L  +F     DMF+MN+ LSKHI       +TL  K  P +
Sbjct  214  RKHNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLSKHI-------ITLGPKKEPPQ  266

Query  541  RQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
             +R K   E  TD+DS                 G  T     + +S++L KF G     +
Sbjct  267  AKRVKLDVESATDTDSTQ--------------PGSST-----VTISEALAKFLGLEGREM  307

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLT-AHFIK  191
             + + ++ +W+Y+K N L+DP N   ++CD KL ELL  DS     + ++L   HFIK
Sbjct  308  LKSEAIRLVWEYVKANNLEDPVNSMVIVCDPKLHELLGCDSISALGVQEMLDRYHFIK  365


 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++VK++W YI+++ LQDPSNKR++ICDD LR + E D  + F M KLL+ H
Sbjct  195  VGEPALPRTEIVKQLWAYIRKHNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLSKH  254

Query  199  FI  194
             I
Sbjct  255  II  256



>ref|XP_004250267.1| PREDICTED: uncharacterized protein LOC101256830 [Solanum lycopersicum]
Length=359

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 94/176 (53%), Gaps = 27/176 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R++NLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI  ++          P ++
Sbjct  210  RKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHITALD----------PSKQ  259

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  DS +    +P                    + +SD+L KFF + E  + 
Sbjct  260  VDQAKRLKVEADSVATKVEQPVSST----------------VTISDALAKFFESEEKEIL  303

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTA-HFI  194
            + D VKR+W YIK N+L+DP N   ++CD KL+ELL+ +S     + ++L   HF+
Sbjct  304  QTDAVKRIWDYIKLNQLEDPVNSTMIVCDPKLQELLQCESVSATELPEMLAGRHFV  359


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 2/102 (2%)
 Frame = -2

Query  502  SDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYI  323
            + S+    PK+        +GG  G      +S  L      G+ A+ R ++VK++W YI
Sbjct  152  ASSNVPSAPKESATSGTKRRGGPGGLNKVCGVSPELQAI--VGQPAMPRTEIVKQLWVYI  209

Query  322  KENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            +++ LQDP NKR++IC+D LR L E D  + F M KLL  H 
Sbjct  210  RKHNLQDPGNKRKIICNDALRALFETDCTDMFKMNKLLAKHI  251



>gb|KJB68546.1| hypothetical protein B456_010G249800 [Gossypium raimondii]
 gb|KJB68548.1| hypothetical protein B456_010G249800 [Gossypium raimondii]
 gb|KJB68549.1| hypothetical protein B456_010G249800 [Gossypium raimondii]
Length=373

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 91/175 (52%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+N+LQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++           +  
Sbjct  222  RKNSLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHITPLDPSK--------ESS  273

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q +KG+ +V               E    G++ G      P+ LS++L KF GTG   + 
Sbjct  274  QTRKGKVKV---------------ESTTEGVEPGPK----PVILSEALAKFLGTGGREML  314

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
              +   R+W+YIK N L+DPSN   V+CD  LRELL  +S     + + L  H +
Sbjct  315  ATEAENRVWEYIKVNRLEDPSNSMVVLCDANLRELLGCESISVMGVRETLLRHHL  369


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        +GG  G      +S +L      GE AL R ++VK++W YI++N LQDP
Sbjct  172  PKESAPVGPKRRGGSGGLNKVCSVSPALQAI--VGEPALPRTEIVKQLWAYIRKNSLQDP  229

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            SNKR++ICDD LR + E D  + F M KLL  H 
Sbjct  230  SNKRKIICDDALRVVFETDCTDMFKMNKLLAKHI  263



>ref|XP_002979058.1| hypothetical protein SELMODRAFT_418723 [Selaginella moellendorffii]
 gb|EFJ20015.1| hypothetical protein SELMODRAFT_418723 [Selaginella moellendorffii]
Length=292

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 95/178 (53%), Gaps = 32/178 (18%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICD-ETLLGIFRVKTIDMFRMNQTLSKHIWPIEK--EDVTLVKSTP  548
            RENNLQDP  +K I+C    L+ IF+V +I+MF +N+ L  H+ P+E+  ED+ + K   
Sbjct  133  RENNLQDPSDRKMILCAGNKLVDIFKVDSINMFTINKVLQDHLLPLEEGYEDIDMPKKKK  192

Query  547  KERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             +R                SD  P++            + FL P  +S++L  F GT   
Sbjct  193  LDR----------------SDDRPRR------------SNFLTPYPISEALQSFLGTDRT  224

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             +SR + V R+W+YI + +LQ+P N   VICDDKLREL +        +++L+  HFI
Sbjct  225  TMSRAEAVDRVWEYILDKDLQEPGN-HNVICDDKLRELFKKSHCSHSKVSQLVNRHFI  281


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/94 (36%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = -2

Query  472  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  293
            Q  +R +    G   FL   +LS  L     TG + L R + V+ +W+YI+EN LQDPS+
Sbjct  85   QSNRRSQAGTPGNNSFLKAFRLSPELRAV--TGHHILRRHEAVQCLWRYIRENNLQDPSD  142

Query  292  KRRVICD-DKLRELLEVDSFEGFTMTKLLTAHFI  194
            ++ ++C  +KL ++ +VDS   FT+ K+L  H +
Sbjct  143  RKMILCAGNKLVDIFKVDSINMFTINKVLQDHLL  176



>emb|CDX94096.1| BnaC07g37300D [Brassica napus]
Length=373

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 58/178 (33%), Positives = 89/178 (50%), Gaps = 23/178 (13%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++    +      K  
Sbjct  219  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHILPLDPSKDSGQAKRAKAE  278

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
               K   E      S S                        + LS+ L +FFGTGE  + 
Sbjct  279  VETKTETETTEPVSSSST-----------------------VALSEPLARFFGTGETEMK  315

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIKTA  185
              ++++R+W+YIK N L+DP N   + C++KLR+LL  +S     + ++L  H  K +
Sbjct  316  DEEIIRRVWEYIKLNNLEDPENPMAIQCNEKLRDLLGCESISAVGINEMLRRHMYKPS  373


 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            KGG  G     ++S  L      GE AL R ++V+++W YI++N LQDPSNKR++ICDD 
Sbjct  180  KGGPGGLNKVCRVSPELEVV--VGEPALPRTEIVRQLWAYIRKNNLQDPSNKRKIICDDA  237

Query  265  LRELLEVDSFEGFTMTKLLTAHFI  194
            LR + E D  + F M KLL  H +
Sbjct  238  LRVVFETDCTDMFKMNKLLAKHIL  261



>ref|XP_002176898.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC51361.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=294

 Score =   105 bits (262),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/175 (35%), Positives = 95/175 (54%), Gaps = 21/175 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            RE+NLQ+P+ KK II D+ +  +F      MF MN+ +  H+ P +  D+    +  K R
Sbjct  120  REHNLQNPENKKEIILDDAMRDVFGCDRFTMFTMNKYIGAHVSPFKAVDLNTNSTPSKPR  179

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +RK     V T +         +++KRQ G +        P +LS  L +   TGE  L 
Sbjct  180  KRK-----VSTKASG-------EKKKRQPGTQ-------PPYRLSAELAEI--TGEAILP  218

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            R  VV ++W+YIK NELQ+PS+KR ++CD+KLR +++      F M K ++ H +
Sbjct  219  RPQVVSKIWEYIKANELQNPSDKREILCDEKLRAVMKKPKVTMFNMNKYISPHIL  273


 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 55/83 (66%), Gaps = 2/83 (2%)
 Frame = -2

Query  445  KGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDK  266
            KGGG G  A  ++SD+L  F G G+  ++R D+VK +W+YI+E+ LQ+P NK+ +I DD 
Sbjct  81   KGGG-GLSAKKEISDALANFLGKGKE-MARTDIVKSLWEYIREHNLQNPENKKEIILDDA  138

Query  265  LRELLEVDSFEGFTMTKLLTAHF  197
            +R++   D F  FTM K + AH 
Sbjct  139  MRDVFGCDRFTMFTMNKYIGAHV  161



>ref|XP_009391890.1| PREDICTED: uncharacterized protein LOC103977949 [Musa acuminata 
subsp. malaccensis]
Length=365

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 94/177 (53%), Gaps = 27/177 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F   + DMF+MN+ LSKHI P++       K T  E 
Sbjct  213  RKNNLQDPNNKRKIICNDELRRVFETDSTDMFKMNKLLSKHIIPLDYP-----KDTGAES  267

Query  538  QRKKGRDEVYTD-SDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
            ++ K  D   T+ +  DSD                      P+ +SDSL KFFG  E  +
Sbjct  268  KKLKAADVSATEITKPDSDEY--------------------PMVISDSLAKFFGREEREI  307

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
             +   + R+W YIK N+L+D +N   ++CD KL+EL   +S     ++ LL  H +K
Sbjct  308  LKSVALSRVWDYIKANQLEDSANS-SILCDPKLQELFGCESLPVSGISDLLANHLLK  363


 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 58/95 (61%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+    +   KGG  G      +S  L      GE A+SR  +VK++W YI++N LQDP
Sbjct  163  PKESAPPRAKRKGGPGGLNKVCGVSPELQPI--VGEAAMSRTQIVKQLWAYIRKNNLQDP  220

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +NKR++IC+D+LR + E DS + F M KLL+ H I
Sbjct  221  NNKRKIICNDELRRVFETDSTDMFKMNKLLSKHII  255



>ref|XP_002288942.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED94378.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=304

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/177 (35%), Positives = 100/177 (56%), Gaps = 21/177 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            +ENNLQ+P+ K+ I+ D  +  +F V   +MF MN+ +S HI P +  D+T   STPK+R
Sbjct  114  KENNLQNPENKREIMLDAKMQAVFGVDCFNMFTMNKYVSAHIEPYKAVDLT-TNSTPKKR  172

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +               ++ E  +++KR+R  +  G+   AP +LSD L     TG+  L 
Sbjct  173  K---------------AEGEGGKKKKRERAKQAPGSQ--APYRLSDDLTAV--TGKRILP  213

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDS-FEGFTMTKLLTAHFIK  191
            R  V + +WKYI+EN LQ+P +KR + CD+ L  ++  +S    F+M K +T H ++
Sbjct  214  RPQVTQALWKYIRENGLQNPEDKREINCDELLSRVMGGESKVTMFSMNKYITPHLVE  270


 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 48/72 (67%), Gaps = 1/72 (1%)
 Frame = -2

Query  412  QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFE  233
            ++S+ L  F GTG   ++R ++VK +W YIKEN LQ+P NKR ++ D K++ +  VD F 
Sbjct  85   EISEDLANFLGTGRQ-MARTEIVKALWSYIKENNLQNPENKREIMLDAKMQAVFGVDCFN  143

Query  232  GFTMTKLLTAHF  197
             FTM K ++AH 
Sbjct  144  MFTMNKYVSAHI  155



>ref|XP_007146548.1| hypothetical protein PHAVU_006G049900g [Phaseolus vulgaris]
 gb|ESW18542.1| hypothetical protein PHAVU_006G049900g [Phaseolus vulgaris]
Length=336

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 58/176 (33%), Positives = 88/176 (50%), Gaps = 31/176 (18%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC+E L  +F     DMF+MN+ L+KHI P+E     + K      
Sbjct  187  RKNNLQDPSNKRKIICNEELRVVFETDCTDMFKMNKLLAKHIIPLEPTKKPVPKKQ----  242

Query  538  QRKKGRDEVYTDSDSDSDF-EPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENAL  362
                       D DS     EP                    + +SD+L  FFG  E  +
Sbjct  243  ---------KVDVDSGKRIAEPTPS-----------------VVISDALANFFGVTEREM  276

Query  361  SRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             + +V++R+W+YIK N+L+DP N   ++CD KL+E+   +S     + ++L  H I
Sbjct  277  LQSEVLRRIWEYIKVNQLEDPMNPMAILCDAKLQEIFGCESISALGIPEVLGGHHI  332


 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/101 (42%), Positives = 62/101 (61%), Gaps = 5/101 (5%)
 Frame = -2

Query  496  SDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKE  317
            +D+  E  Q + ++RG  GG T       +S  L      G+ ALSR ++VK++W YI++
Sbjct  134  NDAPKESTQTKAKRRGGPGGLTKLCG---VSPELQVI--VGQPALSRTEIVKQLWAYIRK  188

Query  316  NELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            N LQDPSNKR++IC+++LR + E D  + F M KLL  H I
Sbjct  189  NNLQDPSNKRKIICNEELRVVFETDCTDMFKMNKLLAKHII  229



>ref|XP_007026264.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 ref|XP_007026265.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY28886.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
 gb|EOY28887.1| SWIB complex BAF60b domain-containing protein, putative isoform 
1 [Theobroma cacao]
Length=373

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 60/175 (34%), Positives = 91/175 (52%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+N+LQDP  K++IICDE L  +F     DMF+MN+ L+KHI P+E          P + 
Sbjct  222  RKNSLQDPSNKRKIICDEALRLVFETDCTDMFKMNKLLAKHITPLE----------PSKE  271

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V  +S ++S          +RG          P+ +S++L KF G G   + 
Sbjct  272  SSQAKRVKVDVESTTES---------VERGPN--------PVIISEALAKFLGAGGREML  314

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
              +  +R+W+YI+ N L+DP N   V+CD KLRELL  +S     +   L  H +
Sbjct  315  ATEAKRRVWEYIEVNRLEDPLNSTVVLCDAKLRELLGCESIPVMGIDDTLLRHHL  369


 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 54/94 (57%), Gaps = 2/94 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+        +GG  G      +S +L      GE AL R ++VK++W YI++N LQDP
Sbjct  172  PKESAPVGAKRRGGPGGLNKVCSVSPALQAI--VGEPALPRTEIVKQLWAYIRKNSLQDP  229

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            SNKR++ICD+ LR + E D  + F M KLL  H 
Sbjct  230  SNKRKIICDEALRLVFETDCTDMFKMNKLLAKHI  263



>ref|XP_008366453.1| PREDICTED: uncharacterized protein LOC103430100 [Malus domestica]
Length=246

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 88/175 (50%), Gaps = 26/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+E        + PK+ 
Sbjct  95   RKNNLQDPGNKRKIICNDELRVVFETDCTDMFKMNKLLAKHIIPLEPSK----PAVPKKP  150

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +  K   E  T S   S                        + +S++L  FFG G   + 
Sbjct  151  KVPKNAVESATKSTEPS----------------------PSLIISEALANFFGAGVREMI  188

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +VV R+W+YIK + L+DP N+  + CD KL+E+   ++     +  +L  H I
Sbjct  189  QSEVVMRIWEYIKVHHLEDPQNQMAIHCDAKLQEIFGCETINALEIPDILEXHHI  243


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             G   L R ++VK++W YI++N LQDP NKR++IC+D+LR + E D  + F M KLL  H
Sbjct  76   VGHPTLPRTEIVKQLWAYIRKNNLQDPGNKRKIICNDELRVVFETDCTDMFKMNKLLAKH  135

Query  199  FI  194
             I
Sbjct  136  II  137



>ref|XP_008798760.1| PREDICTED: formin-like protein 18 [Phoenix dactylifera]
 ref|XP_008798761.1| PREDICTED: formin-like protein 18 [Phoenix dactylifera]
Length=339

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/176 (31%), Positives = 91/176 (52%), Gaps = 27/176 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  +++IIC++ L  +F     DMF+MN+ L+KHI P+E       K+   + 
Sbjct  189  RKNNLQDPNNRRKIICNDELRLVFETDCTDMFKMNKLLAKHIIPLET-----TKAAEPDS  243

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++ K  D V         +                     P+ +SD+L KFFG+ E  + 
Sbjct  244  KKLKTEDVVAATEPDAGQY---------------------PVVISDALFKFFGSEEKEMP  282

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
              +  +R+W YIK N+L+D  N   ++CD KL+EL   +S     ++++L +H +K
Sbjct  283  EIEAFRRVWDYIKSNQLEDSENT-LIVCDPKLQELFGCESLPTSGLSEMLASHVVK  337


 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 56/97 (58%), Gaps = 4/97 (4%)
 Frame = -2

Query  478  PKQEEKRQRGLK--GGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  305
            P  +E    G+K  GG  G      +S  L      GE  + R ++V+++W YI++N LQ
Sbjct  137  PAPKESASTGVKRRGGPGGLNKLCGVSPELQAI--VGEATMPRTEIVRQLWAYIRKNNLQ  194

Query  304  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            DP+N+R++IC+D+LR + E D  + F M KLL  H I
Sbjct  195  DPNNRRKIICNDELRLVFETDCTDMFKMNKLLAKHII  231



>ref|XP_003600192.1| Upstream activation factor subunit UAF30 [Medicago truncatula]
Length=350

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/175 (31%), Positives = 89/175 (51%), Gaps = 21/175 (12%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            ++NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI  +E     L    P  +
Sbjct  193  KKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHIIALEPTSKCLGYEKPAPK  252

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                                 KQ+ + + G +         + +SDSL  FFG     + 
Sbjct  253  ---------------------KQKVEVEVGTRSAEPAPTPSVIISDSLANFFGVTGREML  291

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +V++R+W+YIK N+L+DP N   ++CD KL+E+   +S     + ++L  H I
Sbjct  292  QTEVLRRIWEYIKVNQLEDPVNPMAIMCDAKLQEIFGCESISALGIPEVLGRHHI  346


 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 2/100 (2%)
 Frame = -2

Query  493  DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  314
             ++  PK+  + +   +GG  G      +S  L      G+ A+ R ++VK++W YIK+N
Sbjct  138  SANVLPKESAQPKPKRRGGPGGLNKLCGVSPELQVI--VGQPAMPRTEIVKQLWAYIKKN  195

Query  313  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             LQDPSNKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  196  NLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHII  235



>ref|XP_008384272.1| PREDICTED: upstream activation factor subunit spp27-like [Malus 
domestica]
Length=213

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/170 (34%), Positives = 93/170 (55%), Gaps = 16/170 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ LSKHI P+E          P + 
Sbjct  51   RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLSKHIIPLE----------PNKE  100

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V   S ++ + E + ++ + +   G  T     + +S++L KF G G + + 
Sbjct  101  SSQAKRLKVEAKSTTE-NTEXQPQQPQPQPQPGSLT-----VGISEALAKFLGFGGSEML  154

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLL  209
              +  + +W+Y+K N L+DP N   ++CD KL ELL  +S     M ++L
Sbjct  155  LSEATRLVWEYVKVNRLEDPLNSTVILCDTKLHELLGCESISAAGMHEIL  204


 Score = 80.9 bits (198),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 57/97 (59%), Gaps = 6/97 (6%)
 Frame = -2

Query  484  FEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQ  305
            F P    KR    +GG  G      ++  L      GE AL+R ++VK++W YI++N LQ
Sbjct  3    FAPSSGTKR----RGGPGGLNKVCGVTPELQAV--VGEPALARTEIVKQLWAYIRKNNLQ  56

Query  304  DPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            DPSNKR++ICDD LR + E D  + F M KLL+ H I
Sbjct  57   DPSNKRKIICDDALRVVFETDCTDMFKMNKLLSKHII  93



>ref|XP_009339387.1| PREDICTED: uncharacterized protein LOC103931595 [Pyrus x bretschneideri]
 ref|XP_009339388.1| PREDICTED: uncharacterized protein LOC103931595 [Pyrus x bretschneideri]
Length=335

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 88/175 (50%), Gaps = 26/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K+RIIC++ L  +F     DMF+MN+ L+KHI P+E     +    P++ 
Sbjct  184  RKNNLQDPGNKRRIICNDELRVVFETDCTDMFKMNKLLAKHIIPLEPSKPVV----PRKP  239

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +  K   E  T S   S                        + +S++L  FFG G   + 
Sbjct  240  KVPKNAVESATKSTEPSPS----------------------LIISEALANFFGVGVREMI  277

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +VV R+W+YIK + L+DP N+  + CD KL+E+   ++     +  +L  H I
Sbjct  278  QSEVVTRIWEYIKVHHLEDPQNQMAIHCDAKLQEIFGCETINALEIPDILERHHI  332


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+  K +   KGG  G      +S  L      G   L R ++VK++W YI++N LQDP
Sbjct  134  PKESPKPKAKRKGGPGGLNKLCGVSPELQAI--VGHPTLPRTEIVKQLWAYIRKNNLQDP  191

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             NKRR+IC+D+LR + E D  + F M KLL  H I
Sbjct  192  GNKRRIICNDELRVVFETDCTDMFKMNKLLAKHII  226



>ref|XP_009335440.1| PREDICTED: uncharacterized protein LOC103928154 [Pyrus x bretschneideri]
Length=317

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 88/175 (50%), Gaps = 26/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K+RIIC++ L  +F     DMF+MN+ L+KHI P+E     +    P++ 
Sbjct  166  RKNNLQDPGNKRRIICNDELRVVFETDCTDMFKMNKLLAKHIIPLEPSKPVV----PRKP  221

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +  K   E  T S   S                        + +S++L  FFG G   + 
Sbjct  222  KVPKNAVESATKSTEPSPS----------------------LIISEALANFFGVGVREMI  259

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +VV R+W+YIK + L+DP N+  + CD KL+E+   ++     +  +L  H I
Sbjct  260  QSEVVTRIWEYIKVHHLEDPQNQMAIHCDAKLQEIFGCETINALEIPDILERHHI  314


 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+  K +   KGG  G      +S  L      G   L R ++VK++W YI++N LQDP
Sbjct  116  PKESPKPKAKRKGGPGGLNKLCGVSPELQAI--VGHPTLPRTEIVKQLWAYIRKNNLQDP  173

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             NKRR+IC+D+LR + E D  + F M KLL  H I
Sbjct  174  GNKRRIICNDELRVVFETDCTDMFKMNKLLAKHII  208



>ref|XP_009361076.1| PREDICTED: upstream activation factor subunit spp27-like, partial 
[Pyrus x bretschneideri]
Length=271

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (50%), Gaps = 26/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI       +TL  S P   
Sbjct  120  RKNNLQDPGNKRKIICNDELRVVFETDCTDMFKMNKLLAKHI-------ITLEPSKPAVP  172

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++ K        +   ++  P                    + +S++L  FFG G   + 
Sbjct  173  KKPKVPKNAMESATKSTEPSPS-------------------LIISEALANFFGAGVREMI  213

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + DV+ R+W+YIK + L+DP N+  + CD KL+E+   ++     +  +L  H I
Sbjct  214  QSDVIMRIWEYIKAHHLEDPQNQMAIHCDAKLQEIFGCETINALEIPDILERHHI  268


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK   K +   KGG  G      +S  L      G   L R ++VK++W YI++N LQDP
Sbjct  70   PKDSAKPKAKRKGGPGGLNKLCGVSPELQAI--VGHPTLPRTEIVKQLWAYIRKNNLQDP  127

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             NKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  128  GNKRKIICNDELRVVFETDCTDMFKMNKLLAKHII  162



>ref|XP_002991531.1| hypothetical protein SELMODRAFT_429825 [Selaginella moellendorffii]
 gb|EFJ07453.1| hypothetical protein SELMODRAFT_429825 [Selaginella moellendorffii]
Length=292

 Score =   102 bits (254),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/178 (33%), Positives = 94/178 (53%), Gaps = 32/178 (18%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICD-ETLLGIFRVKTIDMFRMNQTLSKHIWPIEK--EDVTLVKSTP  548
            R+NNLQDP  +K I+C    L  +F+V +I+MF +N+ L  H+ P+E+  ED+ + K   
Sbjct  133  RDNNLQDPSDRKMILCAGNKLFDVFKVDSINMFTINKVLQDHLLPLEEGYEDIDMPKKKK  192

Query  547  KERQRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGEN  368
             +R                SD  P++            + FL P  +S++L  F GT   
Sbjct  193  LDR----------------SDDRPRR------------SNFLTPYPISEALQSFLGTDRT  224

Query  367  ALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             +SR + V R+W+YI + +LQ+P N   V+CDDKLREL +        +++L+  HF+
Sbjct  225  TMSRAEAVDRVWEYILDKDLQEPGN-HNVMCDDKLRELFKKSHCSHSKVSQLVNRHFV  281


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 55/94 (59%), Gaps = 3/94 (3%)
 Frame = -2

Query  472  QEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSN  293
            Q  ++ +    G   FL   +LS  L     TG + L R + V+ +W+YI++N LQDPS+
Sbjct  85   QSNRKSQAGAPGNNSFLKAFRLSPELRAV--TGHHILRRHEAVQCLWRYIRDNNLQDPSD  142

Query  292  KRRVICD-DKLRELLEVDSFEGFTMTKLLTAHFI  194
            ++ ++C  +KL ++ +VDS   FT+ K+L  H +
Sbjct  143  RKMILCAGNKLFDVFKVDSINMFTINKVLQDHLL  176



>ref|XP_007154015.1| hypothetical protein PHAVU_003G083900g [Phaseolus vulgaris]
 gb|ESW26009.1| hypothetical protein PHAVU_003G083900g [Phaseolus vulgaris]
Length=338

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 57/175 (33%), Positives = 90/175 (51%), Gaps = 28/175 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            ++NNLQDP  K++IICD+ L  +F     DMF+MNQ L+KHI P+            KE 
Sbjct  178  KKNNLQDPGNKRKIICDDALRLVFETDCTDMFKMNQLLAKHIIPLGPT---------KES  228

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + +V T  +S    EP                    + +S++L KF GT    + 
Sbjct  229  QAKRVKVDVETKIESA---EPASST----------------VVISEALAKFLGTEGKEMQ  269

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  + +W+YIK + L+DP N   ++CD KL+ELL  +S     + ++L  H +
Sbjct  270  QSEANRLVWEYIKHHHLEDPLNAMVILCDAKLQELLGCESISALGIPEMLARHHL  324


 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/62 (52%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++V+++W YIK+N LQDP NKR++ICDD LR + E D  + F M +LL  H
Sbjct  159  VGEPALPRTEIVRQLWAYIKKNNLQDPGNKRKIICDDALRLVFETDCTDMFKMNQLLAKH  218

Query  199  FI  194
             I
Sbjct  219  II  220



>ref|XP_009348467.1| PREDICTED: upstream activation factor subunit spp27-like [Pyrus 
x bretschneideri]
Length=310

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 87/175 (50%), Gaps = 26/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI       +TL  S P   
Sbjct  159  RKNNLQDPGNKRKIICNDELRVVFETDCTDMFKMNKLLAKHI-------ITLEPSKPAVP  211

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++ K        +   ++  P                    + +S++L  FFG G   + 
Sbjct  212  KKPKVPKNAMESATKSTEPSPS-------------------LIISEALANFFGAGVREMI  252

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + DV+ R+W+YIK + L+DP N+  + CD KL+E+   ++     +  +L  H I
Sbjct  253  QSDVIMRIWEYIKAHHLEDPQNQMAIHCDAKLQEIFGCETINALEIPDILERHHI  307


 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (56%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK   K +   KGG  G      +S  L      G   L R ++VK++W YI++N LQDP
Sbjct  109  PKDSAKPKAKRKGGPGGLNKLCGVSPELQAI--VGHPTLPRTEIVKQLWAYIRKNNLQDP  166

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             NKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  167  GNKRKIICNDELRVVFETDCTDMFKMNKLLAKHII  201



>gb|EPS66203.1| hypothetical protein M569_08575, partial [Genlisea aurea]
Length=197

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 88/173 (51%), Gaps = 25/173 (14%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI P+               
Sbjct  50   RKNNLQDPNNKRKIICNDELRSVFETDCTDMFKMNKLLAKHILPLGSAH-----------  98

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                        S+ D+  +PK EE  +             + +S++L  FF   E  +S
Sbjct  99   -----------SSNDDAKKKPKVEEASESSKTDDRVTV---VIISEALASFFECEEKEMS  144

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
              +V+++MW+YI  ++L+DP N   + CD KL++LL  ++     + ++L+ H
Sbjct  145  EAEVLRQMWEYINVHQLEDPMNPTTISCDAKLKDLLGCETVSALGIPEMLSKH  197


 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             G   L R ++VK++W YI++N LQDP+NKR++IC+D+LR + E D  + F M KLL  H
Sbjct  31   VGHPTLPRTEIVKQLWAYIRKNNLQDPNNKRKIICNDELRSVFETDCTDMFKMNKLLAKH  90

Query  199  FI  194
             +
Sbjct  91   IL  92



>gb|AEV40987.1| SWIB/MDM2 domain-containing protein [Oryza minuta]
Length=389

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 93/176 (53%), Gaps = 29/176 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F   T DMF+MN+ L+KHI P++ +D        + R
Sbjct  241  RQNNLQDPDDKRKIICNDELRVVFGTDTTDMFKMNKLLAKHITPLDPKD--------QIR  292

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + KK     Y  SD  +   P   +                + +SD+L KF G  E  + 
Sbjct  293  EAKK-----YKPSDVATQPMPPINQPS--------------VVISDALAKFIGM-EGTVP  332

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + D ++ +W YIK N+L+D      ++CD KL+EL   +S     +++LL  HFIK
Sbjct  333  QDDALRYLWDYIKANQLED-VIAGSILCDSKLQELFGCESIPSSGLSELLAHHFIK  387


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = -2

Query  466  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  287
             KR+RG  GG     A   +S  L      GE  +SR  +VK++W+YI++N LQDP +KR
Sbjct  198  SKRKRGGPGGLNKVCA---ISPELQTI--VGETVMSRTQIVKQLWQYIRQNNLQDPDDKR  252

Query  286  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            ++IC+D+LR +   D+ + F M KLL  H 
Sbjct  253  KIICNDELRVVFGTDTTDMFKMNKLLAKHI  282



>gb|AEV40937.1| SWIB/MDM2 domain-containing protein [Oryza punctata]
Length=391

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 93/176 (53%), Gaps = 29/176 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IIC++ L  +F   T DMF+MN+ L+KHI P++ +D        + R
Sbjct  243  RQNNLQDPDDKRKIICNDELRVVFGTDTTDMFKMNKLLAKHITPLDPKD--------QIR  294

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            + KK     Y  SD  +   P   +                + +SD+L KF G  E  + 
Sbjct  295  EAKK-----YKPSDVATQPTPPINQPS--------------VVISDALAKFIGM-EGTVP  334

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFIK  191
            + D ++ +W YIK N+L+D      ++CD KL+EL   +S     +++LL  HFIK
Sbjct  335  QDDALRYLWDYIKANQLED-VITGSILCDSKLQELFGCESIPSSGLSELLAHHFIK  389


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/90 (41%), Positives = 54/90 (60%), Gaps = 5/90 (6%)
 Frame = -2

Query  466  EKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDPSNKR  287
             KR+RG  GG     A   +S  L      GE  +SR  +VK++W+YI++N LQDP +KR
Sbjct  200  SKRKRGGPGGLNKVCA---ISPELQTI--VGETVMSRTQIVKQLWQYIRQNNLQDPDDKR  254

Query  286  RVICDDKLRELLEVDSFEGFTMTKLLTAHF  197
            ++IC+D+LR +   D+ + F M KLL  H 
Sbjct  255  KIICNDELRVVFGTDTTDMFKMNKLLAKHI  284



>gb|ABK94708.1| unknown [Populus trichocarpa]
Length=385

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 93/175 (53%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++           +  
Sbjct  234  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLQPSK--------ESS  285

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + +V T ++   + EP             G   +    +S+ L +F GT E  ++
Sbjct  286  QAKRAKVDVETPTE---NTEP-------------GASLVG---ISERLAEFLGTTEREMT  326

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  +R+W+YIK  +L+DP N   + CD KLR+LL  +S     + ++L  H +
Sbjct  327  QTEASRRVWEYIKLKQLEDPLNSMAIQCDTKLRDLLGCESISAVGVGEVLARHHL  381


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++VK++W+YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H
Sbjct  215  VGEPALPRTEIVKQLWQYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKH  274

Query  199  FI  194
             I
Sbjct  275  II  276



>ref|XP_008385810.1| PREDICTED: formin-like protein 13, partial [Malus domestica]
Length=319

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 87/175 (50%), Gaps = 26/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K+RIIC++ L  +F     DMF+MN+ L+KHI P+E        + PK+ 
Sbjct  168  RKNNLQDPGNKRRIICNDELRVVFETDCTDMFKMNKLLAKHIIPLEPSK----PAVPKKP  223

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            +  K   E  T S   S                        + +S++L  FFG G   + 
Sbjct  224  KVPKNAVESATKSTEPSPS----------------------LIISEALANFFGVGVREMI  261

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +V+ R+W+YI  + L+DP N+  + CD KL+E+   ++     +  +L  H I
Sbjct  262  QSEVLMRIWEYINVHHLEDPQNQMAIHCDAKLQEIFGCETINALEIPDILERHHI  316


 Score = 79.7 bits (195),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+  K +   KGG  G      +S  L      G   L R ++VK++W YI++N LQDP
Sbjct  118  PKESPKPKSKRKGGPGGLNKLCGVSPELQAI--VGHPTLPRTEIVKQLWAYIRKNNLQDP  175

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             NKRR+IC+D+LR + E D  + F M KLL  H I
Sbjct  176  GNKRRIICNDELRVVFETDCTDMFKMNKLLAKHII  210



>gb|AES70443.2| SWIB/MDM2 domain protein [Medicago truncatula]
Length=344

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/175 (31%), Positives = 89/175 (51%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            ++NNLQDP  K++IIC++ L  +F     DMF+MN+ L+KHI  +E       K  PK  
Sbjct  193  KKNNLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHIIALEPTK----KPAPK--  246

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
                                 KQ+ + + G +         + +SDSL  FFG     + 
Sbjct  247  ---------------------KQKVEVEVGTRSAEPAPTPSVIISDSLANFFGVTGREML  285

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +V++R+W+YIK N+L+DP N   ++CD KL+E+   +S     + ++L  H I
Sbjct  286  QTEVLRRIWEYIKVNQLEDPVNPMAIMCDAKLQEIFGCESISALGIPEVLGRHHI  340


 Score = 79.3 bits (194),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 2/100 (2%)
 Frame = -2

Query  493  DSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKEN  314
             ++  PK+  + +   +GG  G      +S  L      G+ A+ R ++VK++W YIK+N
Sbjct  138  SANVLPKESAQPKPKRRGGPGGLNKLCGVSPELQVI--VGQPAMPRTEIVKQLWAYIKKN  195

Query  313  ELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             LQDPSNKR++IC+D+LR + E D  + F M KLL  H I
Sbjct  196  NLQDPSNKRKIICNDELRVVFETDCTDMFKMNKLLAKHII  235



>ref|XP_008355916.1| PREDICTED: uncharacterized protein LOC103419593 [Malus domestica]
Length=366

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/170 (33%), Positives = 90/170 (53%), Gaps = 15/170 (9%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ LSKHI P+E          P + 
Sbjct  203  RKNNLQDPTNKRKIICDDALRVVFETDCTDMFKMNKLLSKHIIPLE----------PNKE  252

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
              +  R +V   S ++S     Q + + +   G  T     + +S++L  F G G   + 
Sbjct  253  PSQAKRLKVEAKSTTESTQPQPQPQPQAQAQPGSPT-----VGISEALANFLGFGGREML  307

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLL  209
              +  + +W+Y+K N L+DPSN   ++CD KL +LL  +S     + ++L
Sbjct  308  LSEARRLLWEYVKVNRLEDPSNSTVILCDAKLHKLLGCESISALGIHEML  357


 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 61/112 (54%), Gaps = 4/112 (4%)
 Frame = -2

Query  523  RDEVYTDSDSDSDFEPKQEEKRQRGLK--GGGTGFLAPIQLSDSLVKFFGTGENALSRGD  350
            + E +  +   S  E  +E     G K  GG  G      +S  L      GE AL R +
Sbjct  136  KTEAFPQNAPTSAPETPKESAPSSGTKRRGGPGGLNKVCGVSPELEAV--VGEPALPRTE  193

Query  349  VVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            +VK++W YI++N LQDP+NKR++ICDD LR + E D  + F M KLL+ H I
Sbjct  194  IVKQLWAYIRKNNLQDPTNKRKIICDDALRVVFETDCTDMFKMNKLLSKHII  245



>ref|XP_002275854.1| PREDICTED: uncharacterized protein LOC100264067 [Vitis vinifera]
 emb|CBI26717.3| unnamed protein product [Vitis vinifera]
Length=331

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 90/175 (51%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R NNLQDP  K++IIC++ L  +F   + DMF+MN+ L+KHI P+E       K + ++ 
Sbjct  180  RRNNLQDPSNKRKIICNDELRLVFETDSTDMFKMNKLLAKHIIPLEP-----TKQSGEQS  234

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            ++ K      T S     +                      + +S++L  FFGT    + 
Sbjct  235  KKLKVDAGAGTKSSESGPY----------------------VVISEALANFFGTSGREML  272

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +V++R+W+YIK N L+DP N   ++CD KL+E+   +S     + ++L  H +
Sbjct  273  QSEVLRRVWEYIKVNHLEDPLNSMVILCDAKLQEIFGCESISALGIPEILMRHHL  327


 Score = 81.3 bits (199),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 58/96 (60%), Gaps = 3/96 (3%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPI-QLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQD  302
            P QE  R    + GG G L  +  +S  L      G+ AL R ++VK++W YI+ N LQD
Sbjct  129  PPQESARAGTKRRGGPGGLNKVCGVSPELQTI--VGQPALPRTEIVKQLWAYIRRNNLQD  186

Query  301  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            PSNKR++IC+D+LR + E DS + F M KLL  H I
Sbjct  187  PSNKRKIICNDELRLVFETDSTDMFKMNKLLAKHII  222



>ref|XP_011008625.1| PREDICTED: uncharacterized protein LOC105113949 isoform X2 [Populus 
euphratica]
Length=387

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 94/175 (54%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++         + +  
Sbjct  236  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLQ--------PSKESS  287

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + +V T ++   + EP             G   +    +S+ L +F GT E  ++
Sbjct  288  QAKRAKVDVETPTE---NTEP-------------GASLVV---ISERLAEFLGTTEREMT  328

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  +R+W+YIK  +L+DP N   + CD KLR+LL  +S     + ++L  H +
Sbjct  329  QTEASRRVWEYIKLKQLEDPLNSMAIQCDTKLRDLLGCESISAVGVGEVLARHHL  383


 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++VK++W+YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H
Sbjct  217  VGEPALPRTEIVKQLWQYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKH  276

Query  199  FI  194
             I
Sbjct  277  II  278



>ref|XP_002308782.2| hypothetical protein POPTR_0006s01230g [Populus trichocarpa]
 gb|EEE92305.2| hypothetical protein POPTR_0006s01230g [Populus trichocarpa]
Length=385

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 93/175 (53%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++           +  
Sbjct  234  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLQPSK--------ESS  285

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + +V T ++   + EP             G   +    +S+ L +F GT E  ++
Sbjct  286  QTKRAKVDVETPTE---NTEP-------------GASLVG---ISERLAEFLGTTEREMT  326

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  +R+W+YIK  +L+DP N   + CD KLR+LL  +S     + ++L  H +
Sbjct  327  QTEASRRVWEYIKLKQLEDPLNSMAIQCDTKLRDLLGCESISAVGVGEVLARHHL  381


 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++VK++W+YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H
Sbjct  215  VGEPALPRTEIVKQLWQYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKH  274

Query  199  FI  194
             I
Sbjct  275  II  276



>gb|KHN03519.1| Upstream activation factor subunit UAF30 [Glycine soja]
Length=330

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 92/175 (53%), Gaps = 28/175 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            ++NNLQDP  K++IICD+ L  +F     DMF+MNQ L+KHI P+            KE 
Sbjct  177  KKNNLQDPGNKRKIICDDALRLVFETDCTDMFKMNQLLAKHIIPLGPT---------KES  227

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K  R +V T+  ++S  EP                    + +S++L KF GT    + 
Sbjct  228  QAK--RVKVDTEIKTESA-EPAPST----------------VAISEALAKFLGTEGREMQ  268

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + + ++ +W+YIK + L+DP N   ++CD KL+ELL  +S     + ++L  H +
Sbjct  269  QSEAIRLVWEYIKLHHLEDPLNSMVILCDAKLQELLGCESISALGIPEMLARHHL  323


 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 54/96 (56%), Gaps = 3/96 (3%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDV-VKRMWKYIKENELQD  302
            PK+  +     +GG  G      +S  L      GE A+ R +V V+++W YIK+N LQD
Sbjct  126  PKESVQTGSKRRGGAGGLNKVCGVSPELQAV--VGEPAMPRTEVIVRQLWAYIKKNNLQD  183

Query  301  PSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            P NKR++ICDD LR + E D  + F M +LL  H I
Sbjct  184  PGNKRKIICDDALRLVFETDCTDMFKMNQLLAKHII  219



>ref|XP_003549577.1| PREDICTED: uncharacterized protein LOC100804281 [Glycine max]
Length=329

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 58/175 (33%), Positives = 92/175 (53%), Gaps = 28/175 (16%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            ++NNLQDP  K++IICD+ L  +F     DMF+MNQ L+KHI P+            KE 
Sbjct  176  KKNNLQDPGNKRKIICDDALRLVFETDCTDMFKMNQLLAKHIIPLGPT---------KES  226

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K  R +V T+  ++S  EP                    + +S++L KF GT    + 
Sbjct  227  QAK--RVKVDTEIKTESA-EPAPST----------------VAISEALAKFLGTEGREMQ  267

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + + ++ +W+YIK + L+DP N   ++CD KL+ELL  +S     + ++L  H +
Sbjct  268  QSEAIRLVWEYIKLHHLEDPLNSMVILCDAKLQELLGCESISALGIPEMLARHHL  322


 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 54/95 (57%), Gaps = 2/95 (2%)
 Frame = -2

Query  478  PKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALSRGDVVKRMWKYIKENELQDP  299
            PK+  +     +GG  G      +S  L      GE A+ R ++V+++W YIK+N LQDP
Sbjct  126  PKESVQTGSKRRGGAGGLNKVCGVSPELQAV--VGEPAMPRTEIVRQLWAYIKKNNLQDP  183

Query  298  SNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
             NKR++ICDD LR + E D  + F M +LL  H I
Sbjct  184  GNKRKIICDDALRLVFETDCTDMFKMNQLLAKHII  218



>ref|XP_011008623.1| PREDICTED: uncharacterized protein LOC105113949 isoform X1 [Populus 
euphratica]
 ref|XP_011008624.1| PREDICTED: uncharacterized protein LOC105113949 isoform X1 [Populus 
euphratica]
Length=388

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/175 (32%), Positives = 94/175 (54%), Gaps = 27/175 (15%)
 Frame = -2

Query  718  RENNLQDPKTKKRIICDETLLGIFRVKTIDMFRMNQTLSKHIWPIEKEDVTLVKSTPKER  539
            R+NNLQDP  K++IICD+ L  +F     DMF+MN+ L+KHI P++         + +  
Sbjct  237  RKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKHIIPLQ--------PSKESS  288

Query  538  QRKKGRDEVYTDSDSDSDFEPKQEEKRQRGLKGGGTGFLAPIQLSDSLVKFFGTGENALS  359
            Q K+ + +V T ++   + EP             G   +    +S+ L +F GT E  ++
Sbjct  289  QAKRAKVDVETPTE---NTEP-------------GASLVV---ISERLAEFLGTTEREMT  329

Query  358  RGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAHFI  194
            + +  +R+W+YIK  +L+DP N   + CD KLR+LL  +S     + ++L  H +
Sbjct  330  QTEASRRVWEYIKLKQLEDPLNSMAIQCDTKLRDLLGCESISAVGVGEVLARHHL  384


 Score = 80.1 bits (196),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 45/62 (73%), Gaps = 0/62 (0%)
 Frame = -2

Query  379  TGENALSRGDVVKRMWKYIKENELQDPSNKRRVICDDKLRELLEVDSFEGFTMTKLLTAH  200
             GE AL R ++VK++W+YI++N LQDPSNKR++ICDD LR + E D  + F M KLL  H
Sbjct  218  VGEPALPRTEIVKQLWQYIRKNNLQDPSNKRKIICDDALRVVFETDCTDMFKMNKLLAKH  277

Query  199  FI  194
             I
Sbjct  278  II  279



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410