BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038J23

Length=760
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009607849.1|  PREDICTED: protein phosphatase 1 regulatory ...    275   2e-87   Nicotiana tomentosiformis
ref|XP_004239265.1|  PREDICTED: protein phosphatase 1 regulatory ...    274   3e-87   Solanum lycopersicum
ref|XP_010095367.1|  Protein phosphatase 1 regulatory subunit pprA      274   4e-87   Morus notabilis
gb|EYU27278.1|  hypothetical protein MIMGU_mgv1a0098171mg               270   6e-87   Erythranthe guttata [common monkey flower]
ref|XP_009763167.1|  PREDICTED: protein phosphatase 1 regulatory ...    272   1e-86   Nicotiana sylvestris
gb|KJB83106.1|  hypothetical protein B456_013G229800                    268   2e-86   Gossypium raimondii
ref|XP_006338147.1|  PREDICTED: protein phosphatase 1 regulatory ...    271   4e-86   Solanum tuberosum [potatoes]
emb|CAN64835.1|  hypothetical protein VITISV_020599                     270   8e-86   Vitis vinifera
ref|XP_002283839.1|  PREDICTED: protein phosphatase 1 regulatory ...    270   9e-86   Vitis vinifera
emb|CDP03273.1|  unnamed protein product                                269   2e-85   Coffea canephora [robusta coffee]
gb|KJB83108.1|  hypothetical protein B456_013G229800                    269   3e-85   Gossypium raimondii
gb|KJB83105.1|  hypothetical protein B456_013G229800                    269   3e-85   Gossypium raimondii
ref|XP_008387197.1|  PREDICTED: protein phosphatase 1 regulatory ...    268   6e-85   
ref|XP_010049636.1|  PREDICTED: protein phosphatase 1 regulatory ...    268   1e-84   Eucalyptus grandis [rose gum]
ref|XP_007202248.1|  hypothetical protein PRUPE_ppa008819mg             266   2e-84   
ref|XP_006451264.1|  hypothetical protein CICLE_v10008855mg             267   2e-84   Citrus clementina [clementine]
ref|XP_008242516.1|  PREDICTED: protein phosphatase 1 regulatory ...    266   3e-84   Prunus mume [ume]
gb|KJB65013.1|  hypothetical protein B456_010G076100                    265   9e-84   Gossypium raimondii
gb|KHN41663.1|  Protein phosphatase 1 regulatory subunit pprA           264   3e-83   Glycine soja [wild soybean]
ref|NP_001242512.1|  uncharacterized protein LOC100782492               263   4e-83   
gb|KHN16632.1|  Protein phosphatase 1 regulatory subunit 7              263   4e-83   Glycine soja [wild soybean]
ref|NP_001136450.1|  uncharacterized protein LOC100216558               264   6e-83   Zea mays [maize]
ref|XP_004503473.1|  PREDICTED: protein phosphatase 1 regulatory ...    262   1e-82   
ref|NP_001242821.1|  uncharacterized protein LOC100781548               262   1e-82   
ref|XP_008791657.1|  PREDICTED: protein phosphatase 1 regulatory ...    262   1e-82   Phoenix dactylifera
ref|XP_010535961.1|  PREDICTED: protein phosphatase 1 regulatory ...    263   2e-82   Tarenaya hassleriana [spider flower]
ref|XP_011048326.1|  PREDICTED: protein phosphatase 1 regulatory ...    262   2e-82   Populus euphratica
ref|XP_009352536.1|  PREDICTED: protein phosphatase 1 regulatory ...    262   3e-82   Pyrus x bretschneideri [bai li]
ref|NP_197469.1|  leucine-rich repeat-containing protein                261   3e-82   Arabidopsis thaliana [mouse-ear cress]
gb|KFK26188.1|  hypothetical protein AALP_AA8G214000                    261   3e-82   Arabis alpina [alpine rockcress]
ref|XP_010493047.1|  PREDICTED: protein phosphatase 1 regulatory ...    256   4e-82   Camelina sativa [gold-of-pleasure]
gb|AET05214.2|  protein phosphatase 1 regulatory subunit 7              261   5e-82   Medicago truncatula
ref|XP_003630738.1|  Protein phosphatase 1 regulatory subunit           261   5e-82   
ref|XP_006400530.1|  hypothetical protein EUTSA_v10014089mg             260   6e-82   Eutrema salsugineum [saltwater cress]
gb|AAM61087.1|  unknown                                                 260   7e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008458673.1|  PREDICTED: protein phosphatase 1 regulatory ...    260   8e-82   Cucumis melo [Oriental melon]
gb|KHG03391.1|  Protein phosphatase 1 regulatory subunit 7              256   2e-81   Gossypium arboreum [tree cotton]
emb|CDY42285.1|  BnaC02g08910D                                          259   2e-81   Brassica napus [oilseed rape]
emb|CDX92510.1|  BnaA10g15490D                                          259   2e-81   
ref|XP_010420782.1|  PREDICTED: protein phosphatase 1 regulatory ...    259   2e-81   Camelina sativa [gold-of-pleasure]
ref|XP_004951389.1|  PREDICTED: protein phosphatase 1 regulatory ...    259   3e-81   Setaria italica
ref|XP_010925562.1|  PREDICTED: protein phosphatase 1 regulatory ...    258   4e-81   
ref|XP_004139355.1|  PREDICTED: protein phosphatase 1 regulatory ...    258   4e-81   Cucumis sativus [cucumbers]
ref|XP_004287462.1|  PREDICTED: protein phosphatase 1 regulatory ...    258   5e-81   Fragaria vesca subsp. vesca
ref|XP_003571803.1|  PREDICTED: protein phosphatase 1 regulatory ...    258   7e-81   Brachypodium distachyon [annual false brome]
ref|XP_010493045.1|  PREDICTED: protein phosphatase 1 regulatory ...    258   7e-81   Camelina sativa [gold-of-pleasure]
ref|XP_006288189.1|  hypothetical protein CARUB_v10001424mg             258   8e-81   Capsella rubella
ref|XP_002324444.1|  hypothetical protein POPTR_0018s09320g             258   9e-81   
ref|XP_009405606.1|  PREDICTED: protein phosphatase 1 regulatory ...    258   9e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871899.1|  leucine-rich repeat family protein                 258   9e-81   
ref|XP_010454252.1|  PREDICTED: protein phosphatase 1 regulatory ...    257   1e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008794123.1|  PREDICTED: protein phosphatase 1 regulatory ...    257   1e-80   
ref|XP_006853636.1|  hypothetical protein AMTR_s00056p00073840          257   2e-80   Amborella trichopoda
gb|EPS60921.1|  hypothetical protein M569_13879                         257   2e-80   Genlisea aurea
gb|KDP42237.1|  hypothetical protein JCGZ_02967                         257   2e-80   Jatropha curcas
emb|CDY44934.1|  BnaA02g04390D                                          256   2e-80   Brassica napus [oilseed rape]
emb|CDY58975.1|  BnaC09g38010D                                          256   3e-80   Brassica napus [oilseed rape]
ref|XP_002451818.1|  hypothetical protein SORBIDRAFT_04g008200          257   3e-80   Sorghum bicolor [broomcorn]
ref|XP_010249563.1|  PREDICTED: protein phosphatase 1 regulatory ...    256   4e-80   Nelumbo nucifera [Indian lotus]
ref|XP_007160299.1|  hypothetical protein PHAVU_002G310000g             255   1e-79   Phaseolus vulgaris [French bean]
ref|XP_009120865.1|  PREDICTED: protein phosphatase 1 regulatory ...    254   1e-79   Brassica rapa
ref|XP_007160300.1|  hypothetical protein PHAVU_002G310000g             255   1e-79   Phaseolus vulgaris [French bean]
ref|XP_009126382.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    253   4e-79   Brassica rapa
gb|EEC72782.1|  hypothetical protein OsI_06455                          252   1e-78   Oryza sativa Indica Group [Indian rice]
ref|XP_008364658.1|  PREDICTED: protein phosphatase 1 regulatory ...    252   2e-78   
ref|XP_008356664.1|  PREDICTED: protein phosphatase 1 regulatory ...    252   2e-78   
ref|XP_011008944.1|  PREDICTED: protein phosphatase 1 regulatory ...    251   2e-78   Populus euphratica
ref|XP_006647096.1|  PREDICTED: protein phosphatase 1 regulatory ...    251   3e-78   Oryza brachyantha
ref|XP_006381757.1|  hypothetical protein POPTR_0006s17720g             250   6e-78   Populus trichocarpa [western balsam poplar]
ref|NP_001046364.1|  Os02g0230100                                       250   1e-77   
ref|XP_010253998.1|  PREDICTED: protein phosphatase 1 regulatory ...    248   6e-77   Nelumbo nucifera [Indian lotus]
ref|XP_011093997.1|  PREDICTED: protein phosphatase 1 regulatory ...    246   4e-76   
ref|XP_010688296.1|  PREDICTED: protein phosphatase 1 regulatory ...    236   2e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO66519.1|  hypothetical protein CISIN_1g018662mg                   226   1e-68   Citrus sinensis [apfelsine]
ref|XP_002514241.1|  protein phosphatases pp1 regulatory subunit,...    226   1e-68   
gb|KHG22032.1|  Protein phosphatase 1 regulatory subunit pprA           225   3e-68   Gossypium arboreum [tree cotton]
ref|XP_004503472.1|  PREDICTED: protein phosphatase 1 regulatory ...    223   3e-67   
gb|KJB83109.1|  hypothetical protein B456_013G229800                    224   3e-67   Gossypium raimondii
gb|KDO66518.1|  hypothetical protein CISIN_1g018662mg                   223   3e-67   Citrus sinensis [apfelsine]
gb|KJB62255.1|  hypothetical protein B456_009G408400                    216   7e-66   Gossypium raimondii
ref|XP_002987569.1|  hypothetical protein SELMODRAFT_183219             212   3e-63   Selaginella moellendorffii
ref|XP_002992834.1|  hypothetical protein SELMODRAFT_187027             210   2e-62   Selaginella moellendorffii
ref|XP_001766453.1|  predicted protein                                  209   5e-62   
ref|XP_001772164.1|  predicted protein                                  207   5e-61   
gb|KJB83107.1|  hypothetical protein B456_013G229800                    194   1e-56   Gossypium raimondii
emb|CDY44436.1|  BnaC07g24740D                                          189   1e-54   Brassica napus [oilseed rape]
ref|XP_009147161.1|  PREDICTED: protein phosphatase 1 regulatory ...    186   3e-54   
ref|XP_009102238.1|  PREDICTED: protein phosphatase 1 regulatory ...    185   7e-53   Brassica rapa
emb|CDY17937.1|  BnaC04g02820D                                          182   1e-51   Brassica napus [oilseed rape]
emb|CDY42421.1|  BnaC02g22870D                                          183   2e-51   Brassica napus [oilseed rape]
emb|CDY47338.1|  BnaCnng14750D                                          183   3e-51   Brassica napus [oilseed rape]
emb|CDX89753.1|  BnaC03g46670D                                          183   3e-51   
emb|CDX87941.1|  BnaC03g54550D                                          182   4e-51   
gb|EMS46865.1|  Protein phosphatase 1 regulatory subunit pprA           178   2e-50   Triticum urartu
gb|EMT13288.1|  Protein phosphatase 1 regulatory subunit pprA           177   5e-50   
ref|XP_008791675.1|  PREDICTED: protein phosphatase 1 regulatory ...    170   1e-47   
ref|XP_005646296.1|  L domain-like protein                              166   3e-45   Coccomyxa subellipsoidea C-169
ref|XP_002947065.1|  hypothetical protein VOLCADRAFT_103293             162   2e-43   Volvox carteri f. nagariensis
ref|XP_001700674.1|  predicted protein                                  160   2e-43   Chlamydomonas reinhardtii
gb|KIY98793.1|  Protein phosphatase 1 regulatory subunit 7              159   9e-43   Monoraphidium neglectum
ref|XP_009125770.1|  PREDICTED: protein phosphatase 1 regulatory ...    155   5e-42   Brassica rapa
emb|CDY71037.1|  BnaUnng04160D                                          151   8e-41   Brassica napus [oilseed rape]
ref|XP_005844814.1|  hypothetical protein CHLNCDRAFT_56306              150   1e-39   Chlorella variabilis
gb|KJB10119.1|  hypothetical protein B456_001G184800                    144   1e-38   Gossypium raimondii
ref|XP_009526623.1|  hypothetical protein PHYSODRAFT_502348             148   1e-38   Phytophthora sojae
gb|ESA15010.1|  hypothetical protein GLOINDRAFT_346276                  145   1e-37   
gb|EXX51280.1|  Sds22p                                                  145   1e-37   Rhizophagus irregularis DAOM 197198w
gb|EUC54575.1|  protein phosphatase 1 regulatory subunit 7              149   1e-36   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_011399381.1|  Protein phosphatase 1 regulatory subunit pprA      140   5e-36   Auxenochlorella protothecoides
emb|CDY39147.1|  BnaA07g01430D                                          134   1e-35   Brassica napus [oilseed rape]
emb|CEL55522.1|  hypothetical protein RSOLAG1IB_01534                   140   2e-35   Rhizoctonia solani AG-1 IB
emb|CCA21457.1|  protein phosphatase 1 regulatory subunit putative      139   2e-35   Albugo laibachii Nc14
gb|ETM45543.1|  hypothetical protein L914_09442                         140   3e-35   Phytophthora parasitica
gb|ETL92238.1|  hypothetical protein L917_09407                         140   3e-35   Phytophthora parasitica
gb|ETI45747.1|  hypothetical protein F443_09768                         140   3e-35   Phytophthora parasitica P1569
gb|KDQ14279.1|  hypothetical protein BOTBODRAFT_174788                  141   3e-35   Botryobasidium botryosum FD-172 SS1
ref|XP_002837094.1|  hypothetical protein                               138   9e-35   Tuber melanosporum Mel28
ref|XP_008332239.1|  PREDICTED: protein phosphatase 1 regulatory ...    138   9e-35   
emb|CCM04306.1|  predicted protein                                      138   1e-34   Fibroporia radiculosa
ref|XP_008892784.1|  hypothetical protein PPTG_01292                    138   1e-34   Phytophthora parasitica INRA-310
ref|XP_008616913.1|  hypothetical protein SDRG_12616                    137   1e-34   Saprolegnia diclina VS20
emb|CAG07637.1|  unnamed protein product                                136   2e-34   Tetraodon nigroviridis
ref|XP_001637000.1|  predicted protein                                  137   2e-34   Nematostella vectensis
ref|XP_002899652.1|  protein phosphatase 1 regulatory subunit, pu...    137   3e-34   Phytophthora infestans T30-4
ref|XP_003978239.1|  PREDICTED: protein phosphatase 1 regulatory ...    136   3e-34   
ref|XP_011274445.1|  hypothetical protein BN7_3294                      137   3e-34   Wickerhamomyces ciferrii
gb|EAW71245.1|  protein phosphatase 1, regulatory subunit 7, isof...    132   4e-34   Homo sapiens [man]
gb|ABQ22781.1|  phosphatase 1 regulatory subunit 7 protein-like p...    132   4e-34   Callithrix jacchus [common marmoset]
ref|XP_002125791.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   6e-34   Ciona intestinalis [sea vase]
ref|XP_010205344.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   6e-34   Colius striatus
ref|XP_010741941.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   6e-34   
ref|XP_004225569.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   8e-34   
ref|XP_005050840.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   8e-34   
ref|XP_006000404.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    135   9e-34   
ref|XP_009087555.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   9e-34   
emb|CCI49593.1|  unnamed protein product                                135   9e-34   Albugo candida
ref|XP_005050838.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   9e-34   Ficedula albicollis
ref|XP_005050839.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   1e-33   Ficedula albicollis
ref|XP_002113851.1|  hypothetical protein TRIADDRAFT_26327              134   1e-33   Trichoplax adhaerens
ref|XP_009688823.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   1e-33   Struthio camelus australis
emb|CCA71895.1|  probable SDS22-protein phosphatase 1, regulatory...    135   1e-33   Serendipita indica DSM 11827
ref|XP_005721607.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   1e-33   Pundamilia nyererei
ref|XP_007939645.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   1e-33   Orycteropus afer afer
ref|XP_001384275.2|  regulatory subunit for the mitotic function ...    135   2e-33   Scheffersomyces stipitis CBS 6054
ref|XP_008688738.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   2e-33   Ursus maritimus [white bear]
ref|XP_009087554.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   2e-33   
ref|XP_005425122.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   2e-33   Geospiza fortis
ref|XP_009087553.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   2e-33   Serinus canaria [canary]
ref|XP_009087551.1|  PREDICTED: protein phosphatase 1 regulatory ...    135   2e-33   
ref|XP_009087552.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   2e-33   Serinus canaria [canary]
gb|KIY43946.1|  L domain-like protein                                   135   2e-33   Fistulina hepatica ATCC 64428
ref|XP_004412756.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   2e-33   Odobenus rosmarus divergens
ref|XP_009506393.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   2e-33   Phalacrocorax carbo [common cormorant]
ref|XP_008861707.1|  hypothetical protein H310_00636                    134   2e-33   Aphanomyces invadans
gb|EFB16581.1|  hypothetical protein PANDA_012295                       133   2e-33   Ailuropoda melanoleuca
ref|XP_008861706.1|  hypothetical protein H310_00635                    134   2e-33   Aphanomyces invadans
ref|XP_007939636.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   3e-33   Orycteropus afer afer
gb|KDN44191.1|  hypothetical protein RSAG8_05664                        135   3e-33   Rhizoctonia solani AG-8 WAC10335
dbj|GAM28146.1|  hypothetical protein SAMD00019534_113220               134   3e-33   Acytostelium subglobosum LB1
gb|KIK45072.1|  hypothetical protein CY34DRAFT_22738                    134   3e-33   Suillus luteus UH-Slu-Lm8-n1
emb|CDS07272.1|  hypothetical protein LRAMOSA01221                      134   3e-33   Lichtheimia ramosa
ref|XP_003438187.2|  PREDICTED: protein phosphatase 1 regulatory ...    134   3e-33   Oreochromis niloticus
ref|XP_004743830.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   3e-33   Mustela putorius furo [black ferret]
ref|XP_004412755.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   4e-33   Odobenus rosmarus divergens
ref|XP_005151059.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   4e-33   Melopsittacus undulatus
ref|XP_004905713.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   4e-33   
ref|XP_005151057.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   4e-33   Melopsittacus undulatus
ref|XP_011228086.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   4e-33   Ailuropoda melanoleuca
ref|XP_004637423.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   4e-33   Octodon degus
ref|XP_005151058.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   4e-33   Melopsittacus undulatus
ref|XP_004743829.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   5e-33   Mustela putorius furo [black ferret]
ref|XP_008136695.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   5e-33   
ref|XP_006786565.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   6e-33   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004542733.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   6e-33   Maylandia zebra
ref|XP_004386537.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   6e-33   
emb|CDH49670.1|  protein phosphatase pp1 regulatory subunit             133   6e-33   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_005912848.1|  PREDICTED: protein phosphatase 1 regulatory ...    134   6e-33   Haplochromis burtoni
gb|KDO20340.1|  hypothetical protein SPRG_13486                         138   7e-33   Saprolegnia parasitica CBS 223.65
ref|XP_004667875.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   7e-33   Jaculus jaculus
ref|XP_004743828.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   7e-33   Mustela putorius furo [black ferret]
ref|XP_010792283.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_011228085.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   
ref|XP_005411200.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   8e-33   
ref|XP_007085112.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   Panthera tigris altaica
ref|XP_003991355.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   Felis catus [cat]
ref|XP_004905711.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   
ref|XP_008136693.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   
ref|XP_004637422.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   Octodon degus
ref|XP_004427807.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   8e-33   
ref|XP_002923185.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   8e-33   Ailuropoda melanoleuca
ref|XP_009236624.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   9e-33   
ref|XP_008136694.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   9e-33   Eptesicus fuscus
ref|XP_007362441.1|  L domain-like protein                              133   9e-33   Dichomitus squalens LYAD-421 SS1
ref|XP_006267104.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   9e-33   Alligator mississippiensis
gb|EDL91951.1|  protein phosphatase 1, regulatory (inhibitor) sub...    132   9e-33   Rattus norvegicus [brown rat]
ref|XP_007085111.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   9e-33   Panthera tigris altaica
ref|XP_010604936.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   1e-32   Fukomys damarensis [Damara mole rat]
ref|XP_006935810.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   1e-32   Felis catus [cat]
ref|XP_007067430.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   1e-32   
ref|XP_004386536.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   1e-32   Trichechus manatus latirostris
ref|XP_004905709.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   1e-32   
ref|XP_005301181.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   1e-32   Chrysemys picta bellii
ref|XP_011228084.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   1e-32   Ailuropoda melanoleuca
ref|NP_001269342.1|  protein phosphatase 1 regulatory subunit 7 i...    132   1e-32   Homo sapiens [man]
ref|XP_008250385.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   1e-32   
ref|XP_004905710.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   
ref|XP_007965163.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   1e-32   Chlorocebus sabaeus
ref|XP_008283975.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Stegastes partitus
ref|XP_009181801.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   1e-32   
ref|XP_005796060.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Xiphophorus maculatus
ref|XP_004905712.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   
ref|XP_005411199.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   
ref|XP_006209214.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Vicugna pacos
ref|XP_009236623.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Pongo abelii [orang utan]
ref|XP_001158513.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Pan troglodytes
ref|XP_004667874.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Jaculus jaculus
ref|NP_001269338.1|  protein phosphatase 1 regulatory subunit 7 i...    132   1e-32   Homo sapiens [man]
ref|XP_005339689.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Ictidomys tridecemlineatus
ref|XP_007427574.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   
ref|XP_006786564.1|  PREDICTED: protein phosphatase 1 regulatory ...    133   1e-32   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004701754.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   1e-32   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005654258.1|  PREDICTED: protein phosphatase 1, regulatory...    132   1e-32   Sus scrofa [pigs]
ref|XP_008432357.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Poecilia reticulata
ref|XP_009009789.1|  hypothetical protein HELRODRAFT_63747              131   2e-32   Helobdella robusta
ref|XP_004427806.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005411198.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Chinchilla lanigera
ref|NP_001269341.1|  protein phosphatase 1 regulatory subunit 7 i...    132   2e-32   Homo sapiens [man]
ref|XP_006181900.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Camelus ferus
ref|NP_001009825.1|  protein phosphatase 1 regulatory subunit 7         132   2e-32   Rattus norvegicus [brown rat]
ref|XP_007559514.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Poecilia formosa
ref|XP_008250383.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008499068.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Calypte anna
ref|XP_003936819.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Saimiri boliviensis boliviensis
ref|XP_006209213.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Vicugna pacos
ref|NP_001230831.1|  protein phosphatase 1, regulatory (inhibitor...    132   2e-32   Sus scrofa [pigs]
ref|XP_006034956.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   
ref|XP_006989655.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Peromyscus maniculatus bairdii
ref|XP_010986780.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Camelus dromedarius [camel]
ref|XP_009442992.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Pan troglodytes
ref|XP_005636024.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   
ref|XP_009236626.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   
ref|XP_007374707.1|  hypothetical protein SPAPADRAFT_60516              132   2e-32   Spathaspora passalidarum NRRL Y-27907
ref|XP_005077259.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   2e-32   
ref|XP_010604935.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   
ref|XP_008998061.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Callithrix jacchus [common marmoset]
ref|NP_002703.1|  protein phosphatase 1 regulatory subunit 7 isof...    132   2e-32   Homo sapiens [man]
ref|XP_003278941.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_001158701.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   2e-32   Pan troglodytes
ref|XP_005574921.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   2e-32   Macaca fascicularis [crab eating macaque]
ref|XP_005005742.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   3e-32   Cavia porcellus [guinea pig]
ref|XP_003499326.2|  PREDICTED: protein phosphatase 1 regulatory ...    132   3e-32   Cricetulus griseus [Chinese hamsters]
ref|NP_001232178.1|  putative protein phosphatase 1 regulatory su...    132   3e-32   Taeniopygia guttata
ref|XP_005489568.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   3e-32   Zonotrichia albicollis
ref|XP_008827369.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   3e-32   Nannospalax galili
gb|EHH21837.1|  hypothetical protein EGK_04990                          131   3e-32   Macaca mulatta [rhesus macaque]
ref|XP_007067429.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   3e-32   
ref|XP_003639940.2|  PREDICTED: protein phosphatase 1 regulatory ...    132   3e-32   
ref|XP_005636023.1|  PREDICTED: protein phosphatase 1 regulatory ...    132   3e-32   
ref|XP_005301179.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   3e-32   Chrysemys picta bellii
ref|XP_007067428.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   3e-32   Chelonia mydas [green seaturtle]
ref|NP_001187986.1|  phosphatase 1 regulatory subunit 7                 131   4e-32   Ictalurus punctatus
ref|XP_005959711.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   4e-32   Pantholops hodgsonii [Tibetan antelope]
ref|XP_007965158.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   4e-32   Chlorocebus sabaeus
ref|XP_500880.1|  YALI0B14355p                                          131   4e-32   Yarrowia lipolytica CLIB122
ref|XP_003474608.2|  PREDICTED: protein phosphatase 1 regulatory ...    131   4e-32   Cavia porcellus [guinea pig]
ref|NP_001271924.1|  uncharacterized protein LOC101925067               131   4e-32   Macaca fascicularis [crab eating macaque]
ref|XP_005077258.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   4e-32   
gb|KDO16430.1|  hypothetical protein SPRG_18044                         133   5e-32   Saprolegnia parasitica CBS 223.65
ref|XP_009995028.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   5e-32   Chaetura pelagica
ref|XP_007965159.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   5e-32   Chlorocebus sabaeus
ref|XP_005529692.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   5e-32   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_006083066.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   5e-32   
ref|XP_007765818.1|  L domain-like protein                              131   5e-32   Coniophora puteana RWD-64-598 SS2
ref|XP_008048044.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   5e-32   Carlito syrichta
ref|XP_009941052.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   5e-32   Opisthocomus hoazin [hoatzin]
ref|XP_005529693.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   5e-32   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_004484408.1|  PREDICTED: protein phosphatase 1 regulatory ...    131   5e-32   Dasypus novemcinctus
ref|XP_001364455.2|  PREDICTED: protein phosphatase 1 regulatory ...    130   5e-32   Monodelphis domestica
ref|XP_004079302.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   5e-32   Oryzias latipes [Japanese rice fish]
gb|KIM84899.1|  hypothetical protein PILCRDRAFT_817719                  131   5e-32   
ref|XP_006875268.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   6e-32   
ref|XP_011246359.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   6e-32   
ref|XP_005529691.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   6e-32   
gb|KDN52501.1|  L domain-like protein                                   131   6e-32   
gb|KIO07894.1|  hypothetical protein M404DRAFT_997580                   130   7e-32   
ref|XP_008938227.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   7e-32   
ref|XP_009477570.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   7e-32   
ref|XP_007299464.1|  L domain-like protein                              130   7e-32   
ref|XP_003218361.2|  PREDICTED: protein phosphatase 1 regulatory ...    131   7e-32   
ref|XP_008048043.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   8e-32   
gb|EFA82606.1|  Protein phosphatase                                     130   8e-32   
ref|XP_008048042.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   8e-32   
ref|XP_006083064.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   8e-32   
gb|ETE73200.1|  Protein phosphatase 1 regulatory subunit 7              130   8e-32   
ref|XP_007342271.1|  L domain-like protein                              131   9e-32   
ref|XP_009816501.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   9e-32   
ref|XP_005857754.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   9e-32   
ref|XP_006083063.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   9e-32   
ref|XP_006083065.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|NP_001264357.1|  protein phosphatase 1 regulatory subunit 7 i...    130   1e-31   
ref|NP_001264358.1|  protein phosphatase 1 regulatory subunit 7 i...    130   1e-31   
ref|NP_001124579.1|  protein phosphatase 1 regulatory subunit 7         130   1e-31   
ref|XP_010881857.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_009875982.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   1e-31   
ref|NP_001264359.1|  protein phosphatase 1 regulatory subunit 7 i...    130   1e-31   
ref|XP_009461083.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_008928436.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
gb|EOA94784.1|  Protein phosphatase 1 regulatory subunit 7              128   1e-31   
ref|XP_009461081.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_006077196.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   1e-31   
ref|XP_009461079.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_004620684.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_009891372.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_006875267.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_009461080.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_009642749.1|  PREDICTED: protein phosphatase 1 regulatory ...    130   1e-31   
ref|XP_009827499.1|  hypothetical protein H257_04607                    130   1e-31   
ref|XP_005205095.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   1e-31   
ref|XP_006077195.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   1e-31   
ref|XP_003798302.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   1e-31   
ref|XP_007257899.1|  PREDICTED: putative glycerol kinase 5-like         131   1e-31   
ref|XP_009081911.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_010122352.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_007532040.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_009945165.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_007532041.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_011374591.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_007127869.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   2e-31   
gb|ELR52253.1|  Protein phosphatase 1 regulatory subunit 7              129   2e-31   
ref|XP_010139038.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
gb|KDR76325.1|  hypothetical protein GALMADRAFT_226023                  129   2e-31   
ref|XP_006909973.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_003798301.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_009913783.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_010559561.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|NP_001029410.1|  protein phosphatase 1 regulatory subunit 7         129   2e-31   
ref|XP_006077194.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_006165231.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_006136770.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    129   2e-31   
ref|XP_010291986.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
ref|XP_010559560.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   2e-31   
emb|CDQ88587.1|  unnamed protein product                                129   2e-31   
ref|XP_008627750.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   3e-31   
ref|XP_005901563.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   3e-31   
ref|XP_004597480.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   3e-31   
ref|XP_003766276.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   3e-31   
ref|XP_009695432.1|  PREDICTED: protein phosphatase 1 regulatory ...    129   3e-31   
gb|EPQ02385.1|  Protein phosphatase 1 regulatory subunit 7              130   3e-31   
ref|XP_009566009.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   4e-31   
ref|XP_009282497.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   4e-31   
dbj|GAC76434.1|  protein phosphatase 1, regulatory subunit, and r...    129   4e-31   
ref|XP_009566010.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   4e-31   
ref|XP_009321459.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   4e-31   
ref|XP_009282498.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
ref|XP_009566008.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
ref|XP_009566007.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
ref|XP_007127864.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
ref|XP_007127866.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
ref|XP_009979370.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
ref|XP_007127865.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
emb|CCE43284.1|  hypothetical protein CPAR2_209290                      128   5e-31   
ref|XP_001836305.2|  protein phosphatase regulatory subunit             129   5e-31   
gb|EMC77914.1|  Protein phosphatase 1 regulatory subunit 7              127   5e-31   
ref|XP_005028921.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   5e-31   
ref|XP_009975292.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   6e-31   
ref|XP_004597479.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   6e-31   
ref|XP_002620534.1|  protein phosphatase regulatory subunit Sds22       128   6e-31   
ref|NP_001133060.1|  protein phosphatase 1 regulatory subunit 7         127   6e-31   
gb|EDL39961.1|  protein phosphatase 1, regulatory (inhibitor) sub...    127   6e-31   
ref|XP_009578926.1|  PREDICTED: protein phosphatase 1 regulatory ...    128   6e-31   
ref|XP_007330410.1|  hypothetical protein AGABI1DRAFT_75193             128   7e-31   
ref|XP_010299549.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   7e-31   
ref|XP_750229.1|  protein phosphatase PP1 regulatory subunit Sds22      127   8e-31   
gb|EDP55818.1|  protein phosphatase PP1 regulatory subunit Sds22,...    127   8e-31   
ref|XP_003724429.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    127   8e-31   
ref|XP_007000550.1|  hypothetical protein TREMEDRAFT_24836              127   8e-31   
ref|XP_005236902.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   9e-31   
ref|XP_001265185.1|  protein phosphatase PP1 regulatory subunit S...    127   9e-31   
ref|NP_001032463.1|  protein phosphatase 1 regulatory subunit 7 i...    127   9e-31   
ref|XP_005236901.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   9e-31   
ref|XP_458939.2|  DEHA2D10934p                                          127   9e-31   
ref|XP_010181263.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   1e-30   
emb|CDI52353.1|  probable SDS22-protein phosphatase 1, regulatory...    128   1e-30   
ref|XP_001622447.1|  predicted protein                                  123   1e-30   
gb|EEQ86301.1|  protein phosphatase regulatory subunit Sds22            127   1e-30   
ref|XP_005436297.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   1e-30   
gb|ELT97402.1|  hypothetical protein CAPTEDRAFT_177567                  123   1e-30   
gb|KIK10151.1|  hypothetical protein K443DRAFT_670776                   127   1e-30   
ref|NP_075689.1|  protein phosphatase 1 regulatory subunit 7            127   1e-30   
ref|XP_005501597.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   1e-30   
ref|XP_007872697.1|  hypothetical protein PNEG_00793                    126   1e-30   
dbj|BAE26253.1|  unnamed protein product                                127   1e-30   
gb|KDR07843.1|  Protein phosphatase 1 regulatory subunit 7              126   1e-30   
emb|CBQ71688.1|  probable SDS22-protein phosphatase 1, regulatory...    127   1e-30   
gb|EEH11319.1|  phosphatase PP1 regulatory subunit sds22                127   1e-30   
ref|XP_005501596.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   1e-30   
ref|XP_002590499.1|  hypothetical protein BRAFLDRAFT_124501             126   2e-30   
ref|XP_004196630.1|  Piso0_003852                                       127   2e-30   
gb|EQL28475.1|  adenylate cyclase                                       127   2e-30   
gb|EKV11284.1|  hypothetical protein PDIG_51200                         126   2e-30   
gb|EGE83267.1|  hypothetical protein BDDG_06211                         127   2e-30   
ref|XP_009904679.1|  PREDICTED: protein phosphatase 1 regulatory ...    126   2e-30   
ref|XP_009904678.1|  PREDICTED: protein phosphatase 1 regulatory ...    126   2e-30   
ref|XP_006760590.1|  PREDICTED: protein phosphatase 1 regulatory ...    126   2e-30   
ref|XP_002561258.1|  Pc16g09410                                         126   2e-30   
ref|XP_007184916.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   2e-30   
dbj|GAD92822.1|  protein phosphatase PP1 regulatory subunit Sds22...    127   2e-30   
ref|XP_009904676.1|  PREDICTED: protein phosphatase 1 regulatory ...    126   2e-30   
ref|XP_006760589.1|  PREDICTED: protein phosphatase 1 regulatory ...    126   2e-30   
ref|XP_003866681.1|  Sds22 serine-threonine phosphatase                 126   2e-30   
ref|XP_009904677.1|  PREDICTED: protein phosphatase 1 regulatory ...    126   3e-30   
ref|XP_004262576.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   3e-30   
ref|XP_007184914.1|  PREDICTED: protein phosphatase 1 regulatory ...    126   3e-30   
ref|XP_003289118.1|  hypothetical protein DICPUDRAFT_79885              125   3e-30   
ref|XP_006459368.1|  hypothetical protein AGABI2DRAFT_116346            126   3e-30   
gb|KGO67091.1|  Leucine rich repeat 4                                   126   3e-30   
ref|XP_010714813.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   3e-30   
ref|XP_004003485.1|  PREDICTED: protein phosphatase 1 regulatory ...    127   3e-30   
ref|XP_004316990.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   3e-30   
ref|XP_007184915.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   3e-30   
ref|XP_010714814.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   4e-30   
gb|ERE82036.1|  anoctamin-7                                             130   4e-30   
ref|XP_003209089.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   4e-30   
ref|XP_003209088.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   4e-30   
ref|XP_004262575.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   4e-30   
ref|XP_570198.1|  enzyme regulator                                      126   4e-30   
ref|XP_007184913.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   4e-30   
gb|AFR94905.2|  enzyme regulator                                        125   5e-30   
gb|KGO43251.1|  Leucine-rich repeat, typical subtype                    125   5e-30   
emb|CCF53620.1|  probable SDS22-protein phosphatase 1, regulatory...    126   5e-30   
gb|EER43365.1|  protein phosphatase PP1 regulatory subunit sds22        125   6e-30   
gb|EGC46298.1|  protein phosphatase PP1 regulatory subunit sds22        125   6e-30   
gb|EST07457.1|  leucine rich repeat                                     126   6e-30   
ref|XP_002799157.1|  PREDICTED: protein phosphatase 1 regulatory ...    124   6e-30   
ref|XP_001487335.1|  hypothetical protein PGUG_00712                    125   7e-30   
emb|CDQ70865.1|  unnamed protein product                                125   7e-30   
gb|EHJ76433.1|  hypothetical protein KGM_01212                          120   7e-30   
gb|EFW15464.1|  protein phosphatase PP1 regulatory subunit sds22        124   8e-30   
ref|XP_006678673.1|  hypothetical protein BATDEDRAFT_88063              125   8e-30   
ref|XP_007470014.1|  PREDICTED: protein phosphatase 1 regulatory ...    124   8e-30   
emb|CDM26437.1|  Protein phosphatase 1 regulatory subunit SDS22         124   9e-30   
gb|KIK17633.1|  hypothetical protein PISMIDRAFT_215005                  125   9e-30   
ref|XP_002176035.2|  protein phosphatase regulatory subunit Sds22       124   1e-29   
ref|XP_001090766.1|  PREDICTED: protein phosphatase 1 regulatory ...    125   1e-29   
ref|XP_002618999.1|  hypothetical protein CLUG_00158                    124   1e-29   
ref|XP_001528256.1|  protein phosphatases PP1 regulatory subunit ...    125   1e-29   
ref|XP_009174859.1|  hypothetical protein T265_10275                    124   1e-29   
ref|XP_007470013.1|  PREDICTED: protein phosphatase 1 regulatory ...    124   1e-29   
ref|XP_005361434.1|  PREDICTED: protein phosphatase 1 regulatory ...    123   1e-29   
gb|KFH46462.1|  Protein phosphatase 1 regulatory subunit-like pro...    124   1e-29   
gb|KIR89301.1|  enzyme regulator                                        124   1e-29   
ref|XP_638758.1|  hypothetical protein DDB_G0284039                     124   1e-29   
ref|XP_007470011.1|  PREDICTED: protein phosphatase 1 regulatory ...    124   1e-29   
ref|XP_007470012.1|  PREDICTED: protein phosphatase 1 regulatory ...    124   2e-29   
ref|XP_010148584.1|  PREDICTED: protein phosphatase 1 regulatory ...    120   2e-29   
ref|XP_008039111.1|  L domain-like protein                              124   2e-29   
dbj|GAA98844.1|  hypothetical protein E5Q_05532                         128   2e-29   
ref|XP_011110181.1|  hypothetical protein H072_4233                     124   2e-29   
gb|EAS33893.3|  protein phosphatase PP1 regulatory subunit sds22        123   2e-29   
ref|XP_001245476.1|  hypothetical protein CIMG_04917                    123   3e-29   
ref|XP_001819988.2|  phosphatase 1 regulatory subunit SDS22             123   3e-29   
ref|XP_775865.1|  hypothetical protein CNBD2740                         124   3e-29   
gb|EIT77077.1|  protein phosphatase 1, regulatory subunit               123   3e-29   
ref|XP_001880916.1|  predicted protein                                  123   3e-29   
gb|KFM57874.1|  Protein phosphatase 1 regulatory subunit 7              122   3e-29   
ref|XP_008711559.1|  hypothetical protein HMPREF1541_01036              123   3e-29   
gb|EMG50611.1|  Protein phosphatases PP1 regulatory subunit SDS22       123   3e-29   
emb|CCG81156.1|  Protein phosphatase 1 regulatory subunit SDS22         125   3e-29   
gb|KIR36164.1|  enzyme regulator                                        123   4e-29   
dbj|BAE57986.1|  unnamed protein product                                123   4e-29   
gb|KGB74969.1|  hypothetical protein CNBG_0807                          123   4e-29   
gb|KDQ57186.1|  hypothetical protein JAAARDRAFT_35788                   123   4e-29   
ref|XP_002150211.1|  protein phosphatase PP1 regulatory subunit S...    122   4e-29   
gb|KIR57135.1|  enzyme regulator                                        123   5e-29   
gb|KHC38027.1|  hypothetical protein MGO_01795                          122   6e-29   
gb|KFP26891.1|  Protein phosphatase 1 regulatory subunit 7              119   6e-29   
gb|KGU35001.1|  hypothetical protein MGK_01809                          122   6e-29   
gb|KGR12167.1|  hypothetical protein MG5_01805                          122   6e-29   
dbj|GAK63306.1|  L domain-like protein                                  126   7e-29   
ref|XP_008082168.1|  L                                                  122   7e-29   
ref|XP_003737915.1|  PREDICTED: protein phosphatase 1 regulatory ...    121   7e-29   
gb|EIE84002.1|  hypothetical protein RO3G_08707                         126   7e-29   
ref|XP_001269680.1|  protein phosphatase PP1 regulatory subunit S...    122   8e-29   
ref|XP_004923978.1|  PREDICTED: protein phosphatase 1 regulatory ...    122   8e-29   
ref|XP_010080283.1|  PREDICTED: protein phosphatase 1 regulatory ...    122   9e-29   
ref|XP_003233907.1|  protein phosphatase PP1 regulatory subunit S...    121   1e-28   
gb|KII89932.1|  hypothetical protein PLICRDRAFT_40112                   122   1e-28   
gb|KIP05025.1|  hypothetical protein PHLGIDRAFT_74960                   121   1e-28   
gb|KHC39465.1|  hypothetical protein MGQ_01803                          122   1e-28   
gb|KGU28480.1|  hypothetical protein MG7_01820                          122   1e-28   
ref|XP_721066.1|  hypothetical protein CaO19.8440                       122   1e-28   
gb|KHC53499.1|  hypothetical protein MEW_01761                          122   1e-28   
ref|XP_007389030.1|  L domain-like protein                              121   1e-28   
gb|AAB82534.1|  PprA                                                    117   1e-28   
gb|EHK96286.1|  putative protein phosphatase 1 regulatory subunit...    122   1e-28   
ref|XP_002374468.1|  protein phosphatase PP1 regulatory subunit S...    122   1e-28   
ref|XP_002418347.1|  leucine-ruch repeat protein, hypothetical; p...    121   1e-28   
ref|XP_004523858.1|  PREDICTED: protein phosphatase 1 regulatory ...    121   1e-28   
ref|XP_001592988.1|  hypothetical protein SS1G_05910                    122   2e-28   
dbj|GAA56143.1|  protein phosphatase 1 regulatory subunit 7             121   2e-28   



>ref|XP_009607849.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Nicotiana 
tomentosiformis]
Length=319

 Score =   275 bits (702),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME L+ L NLQELWLGRNRIR +NLCGLKCIKKIS+QSNRLTSM G +ECVALEELYLS
Sbjct  159  VMELLENLKNLQELWLGRNRIRTVNLCGLKCIKKISLQSNRLTSMIGFQECVALEELYLS  218

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIEKMEGLSTLVNLRVLDVSANKLT I++I NLTKLEDLWLNDNNI+S+  +AEAVAG
Sbjct  219  HNGIEKMEGLSTLVNLRVLDVSANKLTEINDIENLTKLEDLWLNDNNIASLVGLAEAVAG  278

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            + +KLTT+YLERNPCA SPNY S+LRQIFPNI+Q+DSE++A
Sbjct  279  AKEKLTTIYLERNPCAQSPNYTSSLRQIFPNIEQIDSEVYA  319


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 64/110 (58%), Gaps = 6/110 (5%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECVA-LEELYLSH  578
              +++++E+ L  N+++ I    ++  KK+    +  N ++S+ GL +  + L +LY+S 
Sbjct  75   HVISDIEEIVLRDNQLKKI--PDVEIFKKLLVFDVSFNEISSLNGLSKVSSTLRDLYVSK  132

Query  577  NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            N + KME +     L++L++ +N+L  +  + NL  L++LWL  N I +V
Sbjct  133  NELTKMEEIEHFHELQILELGSNRLRVMELLENLKNLQELWLGRNRIRTV  182



>ref|XP_004239265.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Solanum 
lycopersicum]
Length=332

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/161 (81%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME L+ L NLQELWLGRNRIR +NLCGLKCIKKIS+QSNRLTSM G +ECVALEELYLS
Sbjct  172  VMELLENLKNLQELWLGRNRIRTVNLCGLKCIKKISLQSNRLTSMMGFQECVALEELYLS  231

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVSANKLT I++I NLTKLEDLWLNDNNI+S+E +AEAV+ 
Sbjct  232  HNGIVKMEGLSTLVNLRVLDVSANKLTEINDIENLTKLEDLWLNDNNIASLEGLAEAVSS  291

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            + +KLTT+YLERNPCA SPNYISTLRQIFPNI+Q+DSE++A
Sbjct  292  TREKLTTIYLERNPCAKSPNYISTLRQIFPNIEQIDSEVYA  332


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
            Q +++L+EL L  N+++ I N+   K +    +  N ++S+ GL +  + L ELY+S N 
Sbjct  88   QLISDLEELVLRDNQLKKIPNVVIFKKLLVFDVSFNEISSLSGLSKVSSTLRELYVSKNE  147

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + KME +     L++L++ +N+L  +  + NL  L++LWL  N I +V
Sbjct  148  VTKMEEIEHFHELQILELGSNRLRVMELLENLKNLQELWLGRNRIRTV  195



>ref|XP_010095367.1| Protein phosphatase 1 regulatory subunit pprA [Morus notabilis]
 gb|EXB59786.1| Protein phosphatase 1 regulatory subunit pprA [Morus notabilis]
Length=340

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ LTNLQELWLGRNRI+A+NLCGLKCIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  180  VMENLQNLTNLQELWLGRNRIKAVNLCGLKCIKKISLQSNRLTSMKGFEECVALEELYLS  239

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NK+T++ +I NLT+LEDLWLNDN I  +E IAEAV G
Sbjct  240  HNGISKMEGLSTLVNLRVLDVSSNKITSVGDIGNLTQLEDLWLNDNQIELLEGIAEAVVG  299

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S  KLTT+YLE NPCA SP Y +TLRQIFPNI+Q+DS++FA
Sbjct  300  SRDKLTTIYLENNPCAKSPGYSTTLRQIFPNIEQIDSDMFA  340


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 59/108 (55%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNG  572
              L  L+EL    N++  I +    K +    +  N +T++ GL      L+ELY+S N 
Sbjct  96   HALAGLEELVFRDNKLTKIPDASIFKRLLVFDVSFNEITALHGLSNVSNTLKELYVSKNE  155

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+E +     L++L++ +N+L  + N+ NLT L++LWL  N I +V
Sbjct  156  VPKIEEIDHFHELQILELGSNRLRVMENLQNLTNLQELWLGRNRIKAV  203



>gb|EYU27278.1| hypothetical protein MIMGU_mgv1a0098171mg, partial [Erythranthe 
guttata]
Length=238

 Score =   270 bits (691),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ L+ LQELWLGRNRIRAINLCGLK IKK+S+QSNRLTSM GLEECVALEELYLS
Sbjct  78   VMENLQNLSLLQELWLGRNRIRAINLCGLKGIKKLSLQSNRLTSMAGLEECVALEELYLS  137

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTL+NLRVLDVS+NKLT +++I NL KLEDLWLNDN I+S+++IAEAV G
Sbjct  138  HNGIAKMEGLSTLINLRVLDVSSNKLTEVNDIENLAKLEDLWLNDNQITSLDNIAEAVVG  197

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S   LTT+YLERNPCA+SP YIS LRQIFPN+QQVDSE+FA
Sbjct  198  SKDNLTTIYLERNPCASSPTYISALRQIFPNVQQVDSEMFA  238


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 61/101 (60%), Gaps = 2/101 (2%)
 Frame = -1

Query  724  ELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIEKMEGL  551
            EL L  N+++ I ++   K +    +  N ++S+ GL +   AL+ELY+S N + KME +
Sbjct  1    ELVLRDNQLKTIPDVSIFKMLLVFDVSFNEISSLDGLSKVSNALKELYVSKNEVTKMEEI  60

Query  550  STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
                 L++L++ +NKL  + N+ NL+ L++LWL  N I ++
Sbjct  61   EHFHELQILELGSNKLRVMENLQNLSLLQELWLGRNRIRAI  101



>ref|XP_009763167.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Nicotiana 
sylvestris]
Length=319

 Score =   272 bits (695),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/161 (81%), Positives = 147/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME L+ L NLQELWLGRNRIR +NLCGLKCIKKIS+QSNRLTSM G +ECVALEELYLS
Sbjct  159  VMELLENLKNLQELWLGRNRIRTVNLCGLKCIKKISLQSNRLTSMIGFQECVALEELYLS  218

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVSANKLT I++I NLTKLEDLWLNDNNI+S+  +AEAVAG
Sbjct  219  HNGIAKMEGLSTLVNLRVLDVSANKLTEINDIENLTKLEDLWLNDNNIASLVGLAEAVAG  278

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            + +KLTT+YLERNPCA SPNY S+LRQIFPNI+Q+DSE++A
Sbjct  279  AKEKLTTIYLERNPCAQSPNYTSSLRQIFPNIEQIDSEVYA  319


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 64/110 (58%), Gaps = 6/110 (5%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECVA-LEELYLSH  578
              +++++E+ L  N+++ I    ++  KK+    +  N ++S+ GL +  + L ELY+S 
Sbjct  75   HVISDIEEIVLRDNQLKKI--PDVEIFKKLLVFDVSFNEISSLNGLSKVSSTLRELYVSK  132

Query  577  NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            N I KME +     L++L++ +N+L  +  + NL  L++LWL  N I +V
Sbjct  133  NEITKMEEIEHFHELQILELGSNRLRVMELLENLKNLQELWLGRNRIRTV  182



>gb|KJB83106.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=229

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ  T L+ELWLGRNRI+AINLCGLK IKKIS+QSNRLTSM GLEECVALEELYLS
Sbjct  69   VMENLQNFTKLEELWLGRNRIKAINLCGLKYIKKISLQSNRLTSMIGLEECVALEELYLS  128

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKLT+++++ NLT+LEDLWLNDN I S+E +AEAV+G
Sbjct  129  HNGISKMEGLSTLVNLRVLDVSSNKLTSVNDVQNLTRLEDLWLNDNQIESLESVAEAVSG  188

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY +TLRQIFPNI+Q+DS +FA
Sbjct  189  SREKLTTVYLENNPCAKSPNYQATLRQIFPNIEQIDSSIFA  229


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 50/78 (64%), Gaps = 1/78 (1%)
 Frame = -1

Query  658  ISIQSNRLTSMKGLEECVA-LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA  482
              +  N +TS+ G+ +  + L+ELY+S N + KME +  L  L++L++ +N+L  + N+ 
Sbjct  15   FDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGSNRLRVMENLQ  74

Query  481  NLTKLEDLWLNDNNISSV  428
            N TKLE+LWL  N I ++
Sbjct  75   NFTKLEELWLGRNRIKAI  92



>ref|XP_006338147.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Solanum tuberosum]
Length=332

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ME L+ L NLQELWLGRNRIR +NLCGLKCIKKIS+QSNRLTSM G +ECVALEELYLS
Sbjct  172  IMELLENLKNLQELWLGRNRIRIVNLCGLKCIKKISLQSNRLTSMIGFQECVALEELYLS  231

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVSANKLT I++I  LTKLEDLWLNDNNI+S+E + EAV G
Sbjct  232  HNGIAKMEGLSTLVNLRVLDVSANKLTEINDIEKLTKLEDLWLNDNNIASLEGLEEAVTG  291

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            + +KLTT+YLERNPCA SPNYISTLRQIFPNI+Q+DSE++A
Sbjct  292  TREKLTTIYLERNPCAQSPNYISTLRQIFPNIEQIDSEVYA  332


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 63/108 (58%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
            Q +++L+EL L  N+++ I ++   K +    +  N ++S+ GL +  + L ELY+S N 
Sbjct  88   QLISHLEELVLRDNQLKKIPDVVIFKKLLVFDVSFNEISSLSGLSKVSSTLRELYVSKNE  147

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + KME +     L++L++ +N+L  +  + NL  L++LWL  N I  V
Sbjct  148  VTKMEEIEHFHELQILELGSNRLRIMELLENLKNLQELWLGRNRIRIV  195



>emb|CAN64835.1| hypothetical protein VITISV_020599 [Vitis vinifera]
Length=324

 Score =   270 bits (691),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTLT L+ELWLGRNRIR +NLCGLKCI+KIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  163  VMENLQTLTKLKELWLGRNRIRVVNLCGLKCIEKISLQSNRLTSMKGFEDCVALEELYLS  222

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLD S+NKLTA+ +I NLT+LEDLWLNDN I+S+E IAEAVAG
Sbjct  223  HNGIAKMEGLSTLVNLRVLDASSNKLTAVDDIXNLTQLEDLWLNDNQITSLEGIAEAVAG  282

Query  400  SLQKLTTLYLERNPCA-NSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA NSPNY +TL+QIFPN+QQ+DS +F 
Sbjct  283  SREKLTTIYLENNPCAKNSPNYSATLKQIFPNLQQIDSAVFG  324


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 61/106 (58%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            ++ L+EL L  N++  I ++   K +    +  N ++S+ GL +    L+ELY+S N + 
Sbjct  81   ISGLEELVLRDNKLTKIPDVSIFKKLLVFDVSFNEISSLNGLAKVSNTLKELYVSKNEVT  140

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             ME +     L++L++ +N+L  + N+  LTKL++LWL  N I  V
Sbjct  141  TMEEIDHFHELQILELGSNRLRVMENLQTLTKLKELWLGRNRIRVV  186



>ref|XP_002283839.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Vitis 
vinifera]
 emb|CBI28014.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   270 bits (691),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 147/162 (91%), Gaps = 1/162 (1%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTLT L+ELWLGRNRIR +NLCGLKCI+KIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  172  VMENLQTLTKLKELWLGRNRIRVVNLCGLKCIEKISLQSNRLTSMKGFEDCVALEELYLS  231

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLD S+NKLTA+ +I NLT+LEDLWLNDN I+S+E IAEAVAG
Sbjct  232  HNGIAKMEGLSTLVNLRVLDASSNKLTAVDDIENLTQLEDLWLNDNQITSLEGIAEAVAG  291

Query  400  SLQKLTTLYLERNPCA-NSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA NSPNY +TL+QIFPN+QQ+DS +F 
Sbjct  292  SREKLTTIYLENNPCAKNSPNYSATLKQIFPNLQQIDSAVFG  333


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 61/106 (58%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            ++ L+EL L  N++  I ++   K +    +  N ++S+ GL +    L+ELY+S N + 
Sbjct  90   ISGLEELVLRDNKLTKIPDVSIFKKLLVFDVSFNEISSLNGLAKVSNTLKELYVSKNEVT  149

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             ME +     L++L++ +N+L  + N+  LTKL++LWL  N I  V
Sbjct  150  TMEEIDHFHELQILELGSNRLRVMENLQTLTKLKELWLGRNRIRVV  195



>emb|CDP03273.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   269 bits (688),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/161 (80%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ L NLQELWLGRNR + +NLCGLKCIKKIS+QSNRLTSM G EECVALEELYLS
Sbjct  163  VMENLQNLINLQELWLGRNRFKTVNLCGLKCIKKISLQSNRLTSMTGFEECVALEELYLS  222

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTL NLRVLDVS+NKLT IS+I  LT+LEDLWLNDNNI+S++ IAEAVAG
Sbjct  223  HNGISKMEGLSTLANLRVLDVSSNKLTEISDIKKLTQLEDLWLNDNNITSLDGIAEAVAG  282

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S   LTT+YLERNPC NSPNYI TL++IF NIQQ+DSELF 
Sbjct  283  SRDALTTIYLERNPCVNSPNYIVTLKEIFRNIQQIDSELFG  323


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 60/106 (57%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEEC-VALEELYLSHNGIE  566
            + +L+EL L  N+++ + ++   K +    +  N + +++GL +    L ELY+S N + 
Sbjct  81   IADLEELVLRDNQLKKVPDVSIFKKLLVFDVSFNEIPTLQGLSKVSTTLRELYVSKNEVT  140

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME +     L++L++ +N L  + N+ NL  L++LWL  N   +V
Sbjct  141  KMEEIDHFHALQILELGSNNLRVMENLQNLINLQELWLGRNRFKTV  186



>gb|KJB83108.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=337

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ  T L+ELWLGRNRI+AINLCGLK IKKIS+QSNRLTSM GLEECVALEELYLS
Sbjct  177  VMENLQNFTKLEELWLGRNRIKAINLCGLKYIKKISLQSNRLTSMIGLEECVALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKLT+++++ NLT+LEDLWLNDN I S+E +AEAV+G
Sbjct  237  HNGISKMEGLSTLVNLRVLDVSSNKLTSVNDVQNLTRLEDLWLNDNQIESLESVAEAVSG  296

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY +TLRQIFPNI+Q+DS +FA
Sbjct  297  SREKLTTVYLENNPCAKSPNYQATLRQIFPNIEQIDSSIFA  337


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 61/101 (60%), Gaps = 2/101 (2%)
 Frame = -1

Query  724  ELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIEKMEGL  551
            EL L  N++  + ++   K +    +  N +TS+ G+ +  + L+ELY+S N + KME +
Sbjct  100  ELVLRDNKLMKVPDVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEI  159

Query  550  STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
              L  L++L++ +N+L  + N+ N TKLE+LWL  N I ++
Sbjct  160  DHLHELQILELGSNRLRVMENLQNFTKLEELWLGRNRIKAI  200



>gb|KJB83105.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=338

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/161 (79%), Positives = 146/161 (91%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ  T L+ELWLGRNRI+AINLCGLK IKKIS+QSNRLTSM GLEECVALEELYLS
Sbjct  178  VMENLQNFTKLEELWLGRNRIKAINLCGLKYIKKISLQSNRLTSMIGLEECVALEELYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKLT+++++ NLT+LEDLWLNDN I S+E +AEAV+G
Sbjct  238  HNGISKMEGLSTLVNLRVLDVSSNKLTSVNDVQNLTRLEDLWLNDNQIESLESVAEAVSG  297

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY +TLRQIFPNI+Q+DS +FA
Sbjct  298  SREKLTTVYLENNPCAKSPNYQATLRQIFPNIEQIDSSIFA  338


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGI  569
            +L+ L+EL L  N++  + ++   K +    +  N +TS+ G+ +  + L+ELY+S N +
Sbjct  95   SLSGLEELVLRDNKLMKVPDVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEV  154

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME +  L  L++L++ +N+L  + N+ N TKLE+LWL  N I ++
Sbjct  155  TKMEEIDHLHELQILELGSNRLRVMENLQNFTKLEELWLGRNRIKAI  201



>ref|XP_008387197.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Malus 
domestica]
 ref|XP_008387204.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Malus 
domestica]
Length=339

 Score =   268 bits (686),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTLT LQELWLGRNRI+ +NLCGLKCIKK+S+QSNRLTSM G EECVALEELYLS
Sbjct  179  VMENLQTLTKLQELWLGRNRIKVVNLCGLKCIKKLSLQSNRLTSMTGFEECVALEELYLS  238

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS NKLT++  I +LT LEDLWLNDN+I S+E  AE +AG
Sbjct  239  HNGISKMEGLSTLVNLRVLDVSNNKLTSVEGIESLTMLEDLWLNDNSIESLEGFAEVLAG  298

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE+NPCA SPNY +TLRQIFPNI+Q+DS +FA
Sbjct  299  SREKLTTIYLEKNPCAKSPNYATTLRQIFPNIEQIDSHMFA  339



>ref|XP_010049636.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Eucalyptus 
grandis]
 gb|KCW82375.1| hypothetical protein EUGRSUZ_C03782 [Eucalyptus grandis]
Length=338

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ L  LQELWLGRNRI+ +NLCGLKCI+KIS+QSNRLTSM G E C+ALEELYLS
Sbjct  178  VMENLQNLVKLQELWLGRNRIKTVNLCGLKCIEKISLQSNRLTSMAGFEGCIALEELYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLD+S+NKL +I +I NLT+LEDLWLNDN I S+E IAEAVAG
Sbjct  238  HNGIAKMEGLSTLVNLRVLDLSSNKLKSIDDIQNLTRLEDLWLNDNQIESLETIAEAVAG  297

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTTLYLE NPCA SPNY +TL+QIFPNIQQ+DS++FA
Sbjct  298  STEKLTTLYLENNPCAKSPNYFTTLKQIFPNIQQIDSKIFA  338


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/110 (33%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECVA-LEELYLSH  578
            + L+ L+EL L  N++    L G    K++    +  N + S+ GL +  + L+ELY+S 
Sbjct  94   EALSGLEELVLRDNKL--TKLPGAHIFKRLLVFDVSFNEIPSLSGLSKVSSTLKELYVSK  151

Query  577  NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            N + K+E +    +L++L++ +N+L  + N+ NL KL++LWL  N I +V
Sbjct  152  NEVPKIEEIDHFTDLQILELGSNRLRVMENLQNLVKLQELWLGRNRIKTV  201



>ref|XP_007202248.1| hypothetical protein PRUPE_ppa008819mg [Prunus persica]
 gb|EMJ03447.1| hypothetical protein PRUPE_ppa008819mg [Prunus persica]
Length=318

 Score =   266 bits (681),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ +T+LQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSM G EECVALEELYLS
Sbjct  158  VMENLQNMTHLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMTGFEECVALEELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNL +LDVS NKLT+++ I NLT LEDLWLNDN+I SVE IAE VAG
Sbjct  218  HNGISKMEGLSTLVNLHILDVSNNKLTSVNGIENLTMLEDLWLNDNSIDSVEGIAEVVAG  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY + LRQIFPNIQQ+D  +FA
Sbjct  278  SREKLTTIYLENNPCAKSPNYAAALRQIFPNIQQIDCHIFA  318



>ref|XP_006451264.1| hypothetical protein CICLE_v10008855mg [Citrus clementina]
 ref|XP_006494312.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Citrus sinensis]
 gb|ESR64504.1| hypothetical protein CICLE_v10008855mg [Citrus clementina]
Length=337

 Score =   267 bits (682),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/160 (79%), Positives = 142/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ LTNLQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EEC+ALEELYLS
Sbjct  177  VMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNL VLDVS+NKLT + +I NL++LEDLWLNDN I S+E I EAVAG
Sbjct  237  HNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAG  296

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            S + LTT+YLE NPCA S NY +TLRQIFPNIQQ+DS++F
Sbjct  297  SRETLTTIYLENNPCAKSSNYSATLRQIFPNIQQIDSDVF  336


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            L  L+EL L  N++  I ++   K +    +  N +TS  GL      L+ELY+S N + 
Sbjct  95   LAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVP  154

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME +    +L++L+  +N+L  + N+ NLT L++LWL  N I  V
Sbjct  155  KMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVV  200



>ref|XP_008242516.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Prunus 
mume]
 ref|XP_008242517.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Prunus 
mume]
Length=339

 Score =   266 bits (681),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ +T+LQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSM G EECVALEELYLS
Sbjct  179  VMENLQNMTHLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMTGFEECVALEELYLS  238

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNL +LDVS NKLT+++ I NLT LEDLWLNDN+I SVE IAE VAG
Sbjct  239  HNGISKMEGLSTLVNLHILDVSNNKLTSVNGIENLTMLEDLWLNDNSIDSVEGIAEVVAG  298

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY + LRQIFPNIQQ+D  +FA
Sbjct  299  SREKLTTIYLENNPCAKSPNYAAALRQIFPNIQQIDCHIFA  339



>gb|KJB65013.1| hypothetical protein B456_010G076100 [Gossypium raimondii]
Length=338

 Score =   265 bits (678),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 126/161 (78%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ  T LQELWLGRNRI+ INLCGL CIKKIS+QSNRLTSM GLEEC ALEE+YLS
Sbjct  178  VMENLQNFTKLQELWLGRNRIKVINLCGLSCIKKISLQSNRLTSMIGLEECNALEEIYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS+NKLT++ +I NLT+LEDLWLNDN I S+EDIA+ V+G
Sbjct  238  HNGIAKMEGLSKLVNLRVLDVSSNKLTSVDDIQNLTRLEDLWLNDNRIESLEDIADGVSG  297

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY +TL+QIFPNIQQ+DSE+FA
Sbjct  298  SREKLTTIYLENNPCAQSPNYNATLKQIFPNIQQIDSEVFA  338


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
            ++LT L+EL L  N++  I   G+ K +    +  N +TS++GL +  + ++ELY+S N 
Sbjct  94   ESLTGLEELILRDNKLTKIPDVGIFKKLLVFDVSFNEITSLQGLSKASSTIKELYVSKNE  153

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + KME +  L  L++L++ +N+L  + N+ N TKL++LWL  N I  +
Sbjct  154  VTKMEEIDHLHELQILELGSNRLRVMENLQNFTKLQELWLGRNRIKVI  201



>gb|KHN41663.1| Protein phosphatase 1 regulatory subunit pprA [Glycine soja]
Length=330

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ+L NLQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSM G + CVALEELYLS
Sbjct  170  VMENLQSLENLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMMGFDGCVALEELYLS  229

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+LVNLRVLDVS+NK+T + +I NLTKLEDLWLNDN I+S+E IAEAV G
Sbjct  230  HNGIAKMEGLSSLVNLRVLDVSSNKITLVDDIVNLTKLEDLWLNDNQIASLEGIAEAVTG  289

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA +PNY   LR+IFPNIQQ+DS++F+
Sbjct  290  SKEKLTTIYLENNPCAKTPNYTGILRKIFPNIQQIDSDIFS  330


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 61/108 (56%), Gaps = 6/108 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            L++L+EL L  N+ +  N+  +   KK+    +  N ++S+ GL      L+ELY+S N 
Sbjct  88   LSSLEELVLRDNQFK--NIPDVSVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSKNE  145

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            +  +E +     L++L++ +NKL  + N+ +L  L++LWL  N I  V
Sbjct  146  VAMIEEIEHFHQLQLLELGSNKLRVMENLQSLENLQELWLGRNRIKVV  193



>ref|NP_001242512.1| uncharacterized protein LOC100782492 [Glycine max]
 gb|ACU21286.1| unknown [Glycine max]
Length=330

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ+L NLQELWLG+NRI+ +NLCGLKCIKKIS QSNRLTSM G E CVALEELYLS
Sbjct  170  VMENLQSLENLQELWLGQNRIKVVNLCGLKCIKKISFQSNRLTSMTGFEGCVALEELYLS  229

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+LVNLRVLDVS+NK+T++ +I NLTKLEDLWLNDN I+S+E IAEAV+G
Sbjct  230  HNGIAKMEGLSSLVNLRVLDVSSNKITSVDDIVNLTKLEDLWLNDNQIASLEGIAEAVSG  289

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YL+ NPCA +PNY   LR+IFPNIQQ+DS++F+
Sbjct  290  SKEKLTTIYLKNNPCAKTPNYTGILREIFPNIQQIDSDIFS  330


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 64/108 (59%), Gaps = 6/108 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            +++L+EL L  N+++  N+  +   KK+    +  N ++S+ GL      L+ELY+S+N 
Sbjct  88   ISSLEELVLRDNQLK--NIPDVTVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSNNE  145

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+E +     L++L++ +NKL  + N+ +L  L++LWL  N I  V
Sbjct  146  VAKIEEIEHFHQLQILELGSNKLRVMENLQSLENLQELWLGQNRIKVV  193



>gb|KHN16632.1| Protein phosphatase 1 regulatory subunit 7 [Glycine soja]
Length=330

 Score =   263 bits (673),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ+L NLQELWLG+NRI+ +NLCGLKCIKKIS QSNRLTSM G E CVALEELYLS
Sbjct  170  VMENLQSLENLQELWLGQNRIKVVNLCGLKCIKKISFQSNRLTSMTGFEGCVALEELYLS  229

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+LVNLRVLDVS+NK+T++ +I NLTKLEDLWLNDN I+S+E IAEAV+G
Sbjct  230  HNGIAKMEGLSSLVNLRVLDVSSNKITSVDDIVNLTKLEDLWLNDNQIASLEGIAEAVSG  289

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YL+ NPCA +PNY   LR+IFPNIQQ+DS++F+
Sbjct  290  SKEKLTTIYLKNNPCAKTPNYTGILREIFPNIQQIDSDIFS  330


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 64/108 (59%), Gaps = 6/108 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            +++L+EL L  N+++  N+  +   KK+    +  N ++S+ GL      L+ELY+S+N 
Sbjct  88   ISSLEELVLRDNQLK--NIPDVTVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSNNE  145

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+E +     L++L++ +NKL  + N+ +L  L++LWL  N I  V
Sbjct  146  VAKIEEIEHFHQLQILELGSNKLRVMENLQSLENLQELWLGQNRIKVV  193



>ref|NP_001136450.1| uncharacterized protein LOC100216558 [Zea mays]
 gb|ACF81958.1| unknown [Zea mays]
 gb|AFW65997.1| hypothetical protein ZEAMMB73_087922 [Zea mays]
Length=352

 Score =   264 bits (674),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/161 (77%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+TLTNLQELWLGRNRIRA+NLCGLK IKKIS+QSNRLTSM G +EC ALEELYLS
Sbjct  192  VMENLETLTNLQELWLGRNRIRAVNLCGLKLIKKISLQSNRLTSMHGFQECAALEELYLS  251

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLR+LDVSANKLT I NI  LT+LEDLWLNDN I S+E I  A+AG
Sbjct  252  HNGIQKMEGLSTLHNLRILDVSANKLTTIENIETLTRLEDLWLNDNQIPSLEGIETALAG  311

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLERNPCA +P+Y STLR+IFPN++Q+DS++ A
Sbjct  312  SREKLTTIYLERNPCAKTPDYSSTLRKIFPNLEQIDSDIIA  352


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEEC-VALEELYLSHNG  572
            + +  L+E  +  N++  I   G+ K +    +  N ++S+ GL +  + L+ELY+S N 
Sbjct  108  EAIAGLKEFVIRDNKLTRIPDAGIFKDLLVFDVSFNEISSLTGLSKVSIKLKELYVSKNE  167

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + KME L     L +L++ +N+L  + N+  LT L++LWL  N I +V
Sbjct  168  VAKMEELEHFHALEILELGSNRLRVMENLETLTNLQELWLGRNRIRAV  215



>ref|XP_004503473.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X2 [Cicer arietinum]
 ref|XP_004503474.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X3 [Cicer arietinum]
Length=327

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ L NLQELWLGRNRI+ INLCGLKCIKKIS+QSNRLTSM G E CVALEELYLS
Sbjct  167  VMENLQNLVNLQELWLGRNRIKIINLCGLKCIKKISLQSNRLTSMIGFEGCVALEELYLS  226

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+LVNLRVLDVS+NKLT++ +I NLT+LEDLWLNDN I S+E  AEAVAG
Sbjct  227  HNGITKMEGLSSLVNLRVLDVSSNKLTSVDDILNLTQLEDLWLNDNQIESLEGFAEAVAG  286

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY   LR+IFPNI+Q+DS++F+
Sbjct  287  SREKLTTIYLENNPCAKSPNYTVILREIFPNIEQIDSDVFS  327


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 6/105 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            L++L+E+ L  N+++  N+  +    K+    +  N +TS+ GL      L ELY+S N 
Sbjct  85   LSSLEEIVLRDNQLK--NIPDVTIFNKLLLFDVSFNEITSLHGLSRVSNTLNELYVSKNE  142

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI  437
            I K+E +     L +L++ +NKL  + N+ NL  L++LWL  N I
Sbjct  143  ITKIEEIDHFHQLHILELGSNKLRVMENLQNLVNLQELWLGRNRI  187



>ref|NP_001242821.1| uncharacterized protein LOC100781548 [Glycine max]
 gb|ACU18623.1| unknown [Glycine max]
Length=330

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ+L NLQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSM G + CV LEELYLS
Sbjct  170  VMENLQSLENLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMMGFDGCVTLEELYLS  229

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+LVNLRVLDVS+NK+T + +I NLTKLEDLWLNDN I+S+E IAEAV G
Sbjct  230  HNGIAKMEGLSSLVNLRVLDVSSNKITLVDDIVNLTKLEDLWLNDNQIASLEGIAEAVTG  289

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA +PNY   LR+IFPNIQQ+DS++F+
Sbjct  290  SKEKLTTIYLENNPCAKTPNYTGILRKIFPNIQQIDSDIFS  330


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 61/108 (56%), Gaps = 6/108 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            L++L+EL L  N+ +  N+  +   KK+    +  N ++S+ GL      L+ELY+S N 
Sbjct  88   LSSLEELVLRDNQFK--NIPDVSVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSKNE  145

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            +  +E +     L++L++ +NKL  + N+ +L  L++LWL  N I  V
Sbjct  146  VAMIEEIEHFHQLQLLELGSNKLRVMENLQSLENLQELWLGRNRIKVV  193



>ref|XP_008791657.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X1 [Phoenix dactylifera]
Length=329

 Score =   262 bits (670),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/160 (76%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTL NLQELWLGRNRIR +NLCGLKCI+KIS+QSNRLTSM G +EC+ALEELYLS
Sbjct  169  VMENLQTLKNLQELWLGRNRIRMVNLCGLKCIRKISLQSNRLTSMTGFQECIALEELYLS  228

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGL+TLVNLR+LDVS+NKLTAI++I NLT LEDLWLNDN I+S+E I   V+G
Sbjct  229  HNGIQKMEGLATLVNLRILDVSSNKLTAINDIENLTSLEDLWLNDNQIASLEGIEVPVSG  288

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            S +KLTT+YLE NPCA+SPNY +TL+Q+FPN+QQ+DS++ 
Sbjct  289  SREKLTTIYLEHNPCASSPNYFTTLKQLFPNLQQIDSDIL  328


 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            T++ L+EL L  N++R I ++   K +    +  N ++S+ GL +    LEELY+S N +
Sbjct  86   TISGLRELVLRDNKLREIPDVSIFKTLLVFDVSFNEISSLNGLSKISNTLEELYVSKNEV  145

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME L  L  LR+L++ +N+L  + N+  L  L++LWL  N I  V
Sbjct  146  TKMEELEHLDALRILELGSNRLRVMENLQTLKNLQELWLGRNRIRMV  192



>ref|XP_010535961.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Tarenaya 
hassleriana]
Length=343

 Score =   263 bits (671),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+ LT L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  183  VMENLENLTKLEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEDCVALEELYLS  242

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGL+ LVNLRVLDVS NKLT++ +I NLT+LEDLWLNDN I S+E +AEAVAG
Sbjct  243  HNGISKMEGLNRLVNLRVLDVSNNKLTSVDDIQNLTQLEDLWLNDNQIESLEGLAEAVAG  302

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY++T+R+IFPN QQ+DS +F 
Sbjct  303  SKEKLTTIYLENNPCAKSPNYVATVREIFPNAQQIDSNIFG  343


 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGI  569
            TL+ L+EL L  N++  + ++     +    I  N + S++GL +  + L+ELY+S N +
Sbjct  100  TLSGLEELILRDNKLTKVPDISIFTKLLVFDISFNEIPSLEGLAKASSMLKELYVSKNEV  159

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KM  +  L NL++L++ +N+L  + N+ NLTKLE+LWL  N I  V
Sbjct  160  SKMVEIEHLHNLQILELGSNRLRVMENLENLTKLEELWLGRNRIKVV  206



>ref|XP_011048326.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Populus euphratica]
 ref|XP_011048327.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Populus euphratica]
Length=336

 Score =   262 bits (669),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN+Q  TNLQELWLGRNRI+ +NLCGLKCIKK+S+QSNRLTSMKG EECVALEELYLS
Sbjct  176  VMENMQNFTNLQELWLGRNRIKVVNLCGLKCIKKLSLQSNRLTSMKGFEECVALEELYLS  235

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKLT++++I NLT+LEDLWLNDN I S+E ++EAV  
Sbjct  236  HNGIAKMEGLSTLVNLRVLDVSSNKLTSVNDIQNLTQLEDLWLNDNQIESLEGVSEAVVS  295

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y + LRQIFPNIQQ+DS +FA
Sbjct  296  SREKLTTIYLENNPCAKSTSYSAFLRQIFPNIQQIDSSVFA  336


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            +L+ LQEL L  N+++ I   G+ K +    +  N +TS+ GL +    L+ELY+S N +
Sbjct  93   SLSALQELVLRDNKLKKIPDSGIFKNLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEV  152

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             K+E +  L  L++L++ +N+L  + N+ N T L++LWL  N I  V
Sbjct  153  TKIEEIDHLYQLQILELGSNRLRVMENMQNFTNLQELWLGRNRIKVV  199



>ref|XP_009352536.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Pyrus 
x bretschneideri]
 ref|XP_009352537.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Pyrus 
x bretschneideri]
Length=339

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME+LQ +T LQELWLGRNR++ +NLCGLKCIKK+S+QSNRLTSM G EECVALEELYLS
Sbjct  179  VMESLQNMTKLQELWLGRNRVKVVNLCGLKCIKKLSLQSNRLTSMTGFEECVALEELYLS  238

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS NKLT++ +I NLT LEDLWLNDN+I +VE  AE VAG
Sbjct  239  HNGISKMEGLSTLVNLRVLDVSNNKLTSVESIENLTVLEDLWLNDNSIETVEGFAEVVAG  298

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY + LRQIFPNI+Q+DS +F+
Sbjct  299  SREKLTTIYLENNPCAKSPNYATALRQIFPNIEQIDSHVFS  339



>ref|NP_197469.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AAO24571.1| At5g19680 [Arabidopsis thaliana]
 dbj|BAF00080.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92737.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=328

 Score =   261 bits (667),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  168  VMENLENFTKLEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAAVRQIFPNVEQIDSNLFA  328


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + ++     +    I  N +TS++G+ +  + L+ELY+S N + 
Sbjct  86   LSDLEELVLRDNKLAKVPDVSIFTKLLVYDISFNEITSLEGISKASSTLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L NL++L++ +N+L  + N+ N TKLE+LWL  N I  V
Sbjct  146  KIMEIEHLHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIKVV  191



>gb|KFK26188.1| hypothetical protein AALP_AA8G214000 [Arabis alpina]
Length=334

 Score =   261 bits (668),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++  T L+ELWLGRNRI+ +NLCGL CIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  174  VMENMENFTKLEELWLGRNRIKVVNLCGLNCIKKISLQSNRLTSMKGFEECVALEELYLS  233

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAVAG
Sbjct  234  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVAG  293

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA + NY++ LRQIFPN++Q+DS LFA
Sbjct  294  SKEKLTTIYLENNPCAKASNYVAVLRQIFPNVEQIDSNLFA  334


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
            + L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  90   EALSDLEELVLRDNKLGKVPDISIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNE  149

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L++L++L++ +N+L  + N+ N TKLE+LWL  N I  V
Sbjct  150  VNKIMEIEHLLDLQILELGSNRLRVMENMENFTKLEELWLGRNRIKVV  197



>ref|XP_010493047.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Camelina 
sativa]
Length=181

 Score =   256 bits (653),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGL+CIKKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  21   VMENLENFTILEELWLGRNRIKVVNLCGLRCIKKISLQSNRLTSMKGFEDCVALEELYLS  80

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  81   HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  140

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS LFA
Sbjct  141  SKEKLTTIYLENNPCAKSSDYVAVVRQIFPNVEQIDSNLFA  181



>gb|AET05214.2| protein phosphatase 1 regulatory subunit 7 [Medicago truncatula]
Length=335

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTL NLQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSM G E C+ALEELYLS
Sbjct  175  VMENLQTLVNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMIGFEGCIALEELYLS  234

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+L NLRVLDVS+NKLT++ +I NLT+LEDLWLNDN I S+E  AEAVAG
Sbjct  235  HNGITKMEGLSSLANLRVLDVSSNKLTSVDDIHNLTQLEDLWLNDNQIESLEGFAEAVAG  294

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE N CA SPNY + LR++FPNIQQ+DS++F+
Sbjct  295  SREKLTTIYLENNLCAKSPNYTAILREVFPNIQQIDSDVFS  335


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (58%), Gaps = 6/109 (6%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEE-CVALEELYLSHN  575
            TL++L+EL L  N+++  N+  +   KK+    +  N + S+ G+   C  L+ELY+S N
Sbjct  92   TLSSLEELVLRDNQLK--NIPDVSIFKKLLVFDVSFNEIASLHGVSRVCNTLKELYVSKN  149

Query  574  GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             + K+E +     L++L++ +NKL  + N+  L  L++LWL  N I  V
Sbjct  150  EVTKIEEIEHFHQLQILELGSNKLRVMENLQTLVNLQELWLGRNRIKVV  198



>ref|XP_003630738.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula]
Length=329

 Score =   261 bits (666),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTL NLQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSM G E C+ALEELYLS
Sbjct  169  VMENLQTLVNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMIGFEGCIALEELYLS  228

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+L NLRVLDVS+NKLT++ +I NLT+LEDLWLNDN I S+E  AEAVAG
Sbjct  229  HNGITKMEGLSSLANLRVLDVSSNKLTSVDDIHNLTQLEDLWLNDNQIESLEGFAEAVAG  288

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE N CA SPNY + LR++FPNIQQ+DS++F+
Sbjct  289  SREKLTTIYLENNLCAKSPNYTAILREVFPNIQQIDSDVFS  329


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 63/109 (58%), Gaps = 6/109 (6%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEE-CVALEELYLSHN  575
            TL++L+EL L  N+++  N+  +   KK+    +  N + S+ G+   C  L+ELY+S N
Sbjct  86   TLSSLEELVLRDNQLK--NIPDVSIFKKLLVFDVSFNEIASLHGVSRVCNTLKELYVSKN  143

Query  574  GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             + K+E +     L++L++ +NKL  + N+  L  L++LWL  N I  V
Sbjct  144  EVTKIEEIEHFHQLQILELGSNKLRVMENLQTLVNLQELWLGRNRIKVV  192



>ref|XP_006400530.1| hypothetical protein EUTSA_v10014089mg [Eutrema salsugineum]
 gb|ESQ41983.1| hypothetical protein EUTSA_v10014089mg [Eutrema salsugineum]
Length=328

 Score =   260 bits (665),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++  T L+ELWLGRNRI+ +NLCGL+C+KKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  168  VMENMENFTKLEELWLGRNRIKVVNLCGLRCVKKISLQSNRLTSMKGFEDCVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAVAG
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVAG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ LRQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAVLRQIFPNVEQIDSNLFA  328


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/107 (33%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGI  569
             L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N +
Sbjct  85   ALSDLEELILRDNKLAKVPDISIFSKLLVFDLSFNEITSLQGLSKASSTLKELYVSKNEV  144

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             K+  +  L +L++L++ +N+L  + N+ N TKLE+LWL  N I  V
Sbjct  145  NKIAEIEHLHDLQILELGSNRLRVMENMENFTKLEELWLGRNRIKVV  191



>gb|AAM61087.1| unknown [Arabidopsis thaliana]
Length=328

 Score =   260 bits (665),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  168  VMENLENFTKLEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS +FA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAAVRQIFPNVEQIDSNIFA  328


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + ++     +    I  N +TS++G+ +  + L+ELY+S N + 
Sbjct  86   LSDLEELVLRDNKLAKVPDVSIFTKLLVYDISFNEITSLEGISKASSTLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L NL++L++ +N+L  + N+ N TKLE+LWL  N I  V
Sbjct  146  KIMEIEHLHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIKVV  191



>ref|XP_008458673.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Cucumis 
melo]
Length=333

 Score =   260 bits (665),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++ LTNLQELWLGRNRI+A+NLCGLKC+KKIS+QSNRLTSM G E+CVALEELYLS
Sbjct  171  VMENMENLTNLQELWLGRNRIKAVNLCGLKCLKKISLQSNRLTSMTGFEDCVALEELYLS  230

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI K+EG+STLVNLR+LDVS+NKLT++S+I NLT LEDLWLNDN I S+E IAE VAG
Sbjct  231  HNGISKIEGVSTLVNLRILDVSSNKLTSVSDIQNLTCLEDLWLNDNQIESLETIAEDVAG  290

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA + NY + LR+IFPNIQQ+DSE+F 
Sbjct  291  SREKLTTIYLENNPCAKTSNYSARLREIFPNIQQIDSEIFT  331


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 62/106 (58%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            L+ L+EL L  N++  I +    K +    +  N +TS+ GL      L+ELY+S N + 
Sbjct  89   LSGLEELILRDNQMTKIPDASIFKRLLVFDVSFNEITSLHGLSTVSNTLKELYVSKNEVS  148

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L   + L++L++ +N+L  + N+ NLT L++LWL  N I +V
Sbjct  149  KMEELDHFLQLQILELGSNRLRVMENMENLTNLQELWLGRNRIKAV  194



>gb|KHG03391.1| Protein phosphatase 1 regulatory subunit 7 [Gossypium arboreum]
 gb|KHG03799.1| Protein phosphatase 1 regulatory subunit 7 [Gossypium arboreum]
 gb|KHG23993.1| Protein phosphatase 1 regulatory subunit 7 [Gossypium arboreum]
 gb|KHG24659.1| Protein phosphatase 1 regulatory subunit 7 [Gossypium arboreum]
Length=242

 Score =   256 bits (655),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 124/158 (78%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ  T LQELWLGRNRI+ INLCGL CIKKIS+QSNRLTSM GLEEC ALEE+YLS
Sbjct  41   VMENLQNFTKLQELWLGRNRIKVINLCGLSCIKKISLQSNRLTSMIGLEECNALEEIYLS  100

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI K EGLS LVNLRVLDVS+NKLT++ +I NLT+LEDLWLNDN I S+EDIAE V+G
Sbjct  101  HNGIAKTEGLSKLVNLRVLDVSSNKLTSVDDIQNLTRLEDLWLNDNRIESLEDIAEGVSG  160

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE  287
            S +KLTT+YLE NPCA SPNY +TL+QIFPNIQQ+DSE
Sbjct  161  SREKLTTIYLENNPCAQSPNYNATLKQIFPNIQQIDSE  198



>emb|CDY42285.1| BnaC02g08910D [Brassica napus]
Length=318

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++TLT L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  158  VMENMETLTKLEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECVALEELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I S++ I EAV G
Sbjct  218  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIESLDAITEAVEG  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S  KLTT+YLE NPCA S +Y++ LR+IFPN++Q+DS LFA
Sbjct  278  SKAKLTTIYLENNPCAKSSDYVAVLRKIFPNVEQIDSNLFA  318


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  74   DALSDLEELILRDNKLAKVPDVSIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNE  133

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L  + N+  LTKLE+LWL  N I  V
Sbjct  134  VNKIMEIEHLHDLQILELGSNRLRVMENMETLTKLEELWLGRNRIKVV  181



>emb|CDX92510.1| BnaA10g15490D [Brassica napus]
Length=328

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++  T L ELWLGRNRI+ +NLCGL CIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  168  VMENMENFTKLDELWLGRNRIKVVNLCGLTCIKKISLQSNRLTSMKGFEECVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ LRQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSADYVAVLRQIFPNVEQIDSNLFA  328


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + +      +    +  N +TS++GL +  + L+ELY+S N + 
Sbjct  86   LSDLEELILRDNKLAKVPDTAIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L +L++L++ +N+L  + N+ N TKL++LWL  N I  V
Sbjct  146  KIMEIEHLHDLQILELGSNRLRVMENMENFTKLDELWLGRNRIKVV  191



>ref|XP_010420782.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Camelina sativa]
Length=328

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  168  VMENLENFTILEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEDCVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAVVRQIFPNVEQIDSNLFA  328


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + ++     +    I  N +TS++GL +  + L+ELY+S N + 
Sbjct  86   LSDLEELVLRDNKLEKVPDVSIFSKLLVFDISFNEITSLEGLSKATSSLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L NL++L++ +N+L  + N+ N T LE+LWL  N I  V
Sbjct  146  KIMEIEHLHNLQILELGSNRLRVMENLENFTILEELWLGRNRIKVV  191



>ref|XP_004951389.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Setaria italica]
Length=343

 Score =   259 bits (662),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL TLTNLQELWLGRNRIR +NLCGLK IKKIS+QSNRLTSM G +ECVALEELYLS
Sbjct  183  VMENLGTLTNLQELWLGRNRIRTVNLCGLKLIKKISLQSNRLTSMDGFQECVALEELYLS  242

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLRVLDVS+NKLT I NI  LT+LEDLWLNDN I S++ I  A+AG
Sbjct  243  HNGIQKMEGLSTLQNLRVLDVSSNKLTTIENIETLTRLEDLWLNDNQIPSLDGIEAALAG  302

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLERNPCA +PNY STL++IFPN++Q+DS++ A
Sbjct  303  SREKLTTIYLERNPCAKTPNYSSTLKKIFPNLEQIDSDIIA  343


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 59/106 (56%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            +  LQEL L  N++ R  +    K +    +  N ++S+ GL +  + L+ELY+S N + 
Sbjct  101  IAGLQELVLRDNKLTRIPDASIFKGLLIFDVSFNEISSLTGLSKVSSTLKELYVSKNEVP  160

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L     L +L++ +N L  + N+  LT L++LWL  N I +V
Sbjct  161  KMEELEHFHALEILELGSNGLRVMENLGTLTNLQELWLGRNRIRTV  206



>ref|XP_010925562.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Elaeis 
guineensis]
Length=330

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTLTNLQELWLGRNRIR +NLCGLKCI+KIS+QSNRLT M G +ECVALEELYLS
Sbjct  170  VMENLQTLTNLQELWLGRNRIRTVNLCGLKCIRKISLQSNRLTCMTGFQECVALEELYLS  229

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGL+TLVNL +LD+S+NKLTAI +I NLT+LEDLWLNDN I+S+E +  AV+G
Sbjct  230  HNGIQKMEGLATLVNLHILDISSNKLTAIEDIENLTRLEDLWLNDNQIASLEGLESAVSG  289

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            S +KLTT+YLE NPCA+ PNY ++LR+IFPN+QQ+DS++ 
Sbjct  290  SREKLTTIYLEHNPCASFPNYSTSLRKIFPNLQQIDSDIL  329


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            T++ L EL L  N++R +   G+ K +    +  N ++S+ GL +    LEELY+S N +
Sbjct  87   TISGLHELVLRDNKLRKVPDVGIFKNLLVFDVSFNEISSLNGLSKVSNTLEELYVSKNEV  146

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME L  L  LR+L++ +N+L  + N+  LT L++LWL  N I +V
Sbjct  147  TKMEELEHLHALRILELGSNRLRVMENLQTLTNLQELWLGRNRIRTV  193



>ref|XP_004139355.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Cucumis sativus]
 ref|XP_004157884.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Cucumis sativus]
 gb|KGN60590.1| hypothetical protein Csa_2G000970 [Cucumis sativus]
Length=333

 Score =   258 bits (660),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++ LTNLQELWLGRNRI+A+NLCGLKC+KKIS+QSNRLTSM G E+CVALEELYLS
Sbjct  171  VMENMENLTNLQELWLGRNRIKAVNLCGLKCLKKISLQSNRLTSMTGFEDCVALEELYLS  230

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI K+EG+STLVNLR+LDVS+NKLT++S++ NLT LEDLWLNDN I S+E IAE VAG
Sbjct  231  HNGISKIEGVSTLVNLRILDVSSNKLTSVSDVQNLTCLEDLWLNDNQIESLETIAEDVAG  290

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA + NY + L++IFPNIQQ+DSE+F 
Sbjct  291  SREKLTTIYLENNPCAKTSNYCARLKEIFPNIQQIDSEIFT  331


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            L+ L+EL L  N++  I +    K +    +  N +TS+ GL +    L+ELY+S N + 
Sbjct  89   LSGLEELILRDNQMTKIPDASIFKRLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEVT  148

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L   + L++L++ +N+L  + N+ NLT L++LWL  N I +V
Sbjct  149  KMEELDHFLQLQILELGSNRLRVMENMENLTNLQELWLGRNRIKAV  194



>ref|XP_004287462.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Fragaria 
vesca subsp. vesca]
Length=336

 Score =   258 bits (660),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM++L+ +T LQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSM G E CVALEELYLS
Sbjct  176  VMQSLENMTKLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMTGFEGCVALEELYLS  235

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS NK+T++++I NLT LEDLWLNDN I S+E +AEAV G
Sbjct  236  HNGISKMEGLSTLVNLRVLDVSNNKITSVNDIKNLTMLEDLWLNDNQIESIEGMAEAVIG  295

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KL T+YLE+NPCA SPNY + LRQ FPNIQQ+DS +FA
Sbjct  296  SREKLATIYLEKNPCAKSPNYAAALRQTFPNIQQIDSHIFA  336


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L+ L+EL L  N++R I +    K +    +  N +TS++G+ +    L+ELY+S N + 
Sbjct  94   LSGLEELVLRDNKLRKIPDASIFKKLLVFDVSFNEITSLQGMSKVSGGLKELYVSKNEVT  153

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+E +  L  L++L++ +N+L  + ++ N+TKL++LWL  N I  V
Sbjct  154  KIEEIDHLHELQILELGSNRLRVMQSLENMTKLQELWLGRNRIKVV  199



>ref|XP_003571803.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Brachypodium 
distachyon]
Length=339

 Score =   258 bits (659),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 144/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTLTNLQELWLGRNRIR INLCGLK IKK+S+QSNRLTSM GL+ECVALEELYLS
Sbjct  179  VMENLQTLTNLQELWLGRNRIRTINLCGLKSIKKLSLQSNRLTSMNGLQECVALEELYLS  238

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLRVLDVS+NKL AI +I  LT+LEDLWLNDN I S++ I  A++G
Sbjct  239  HNGIQKMEGLSTLQNLRVLDVSSNKLIAIEDIETLTRLEDLWLNDNQIPSLDGIESALSG  298

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLERNPCA +PNY STL+++FPN++Q+DS++ A
Sbjct  299  SREKLTTIYLERNPCAKTPNYSSTLKKMFPNLEQIDSDMLA  339


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 60/106 (57%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            +  LQEL L  N++  I +    K +    +  N ++S+ GL +  + ++E+Y+S N + 
Sbjct  97   IAGLQELVLRDNKLTKIPDASIFKGLLVFDVSFNEISSLNGLSKVSSTVKEIYVSKNEVA  156

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L     L +L++ +N+L  + N+  LT L++LWL  N I ++
Sbjct  157  KMEELDHFHALELLELGSNRLRVMENLQTLTNLQELWLGRNRIRTI  202



>ref|XP_010493045.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Camelina sativa]
Length=328

 Score =   258 bits (658),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGL+CIKKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  168  VMENLENFTILEELWLGRNRIKVVNLCGLRCIKKISLQSNRLTSMKGFEDCVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAVVRQIFPNVEQIDSNLFA  328


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 63/106 (59%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            L++L+EL L  N++  +  +     +    I  N +TS++GL +   +L+ELY+S N + 
Sbjct  86   LSDLEELVLRDNKLEKVPEISIFSKLLVFDISFNEITSLEGLSKATTSLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L NL++L++ +N+L  + N+ N T LE+LWL  N I  V
Sbjct  146  KIMEIEHLHNLQILELGSNRLRVMENLENFTILEELWLGRNRIKVV  191



>ref|XP_006288189.1| hypothetical protein CARUB_v10001424mg [Capsella rubella]
 gb|EOA21087.1| hypothetical protein CARUB_v10001424mg [Capsella rubella]
Length=328

 Score =   258 bits (658),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGL CIKKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  168  VMENLENFTKLEELWLGRNRIKVVNLCGLSCIKKISLQSNRLTSMKGFEDCVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ LR+IFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAVLRKIFPNVEQIDSNLFA  328


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
            + L++L+EL L  N++  + ++     +    I  N +TS++G  +  + L+ELY+S N 
Sbjct  84   EALSDLEELVLRDNKLAKVPDVSIFSKLLVFDISFNEITSLEGTSKASSSLKELYVSKNE  143

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L NL++L++ +N+L  + N+ N TKLE+LWL  N I  V
Sbjct  144  VNKIMEIEHLHNLQILELGSNRLRVMENLENFTKLEELWLGRNRIKVV  191



>ref|XP_002324444.1| hypothetical protein POPTR_0018s09320g [Populus trichocarpa]
 gb|EEF03009.1| hypothetical protein POPTR_0018s09320g [Populus trichocarpa]
Length=336

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 143/161 (89%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME++Q  T+LQELWLGRNRI+ +NLCGLKCIKK+S+QSNR+TSMKG EECVALEELYLS
Sbjct  176  VMESMQNFTSLQELWLGRNRIKVVNLCGLKCIKKLSLQSNRVTSMKGFEECVALEELYLS  235

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKLT++++I NLT+LEDLWLNDN I S+E ++EAV  
Sbjct  236  HNGIAKMEGLSTLVNLRVLDVSSNKLTSVNDIQNLTQLEDLWLNDNQIESLEGVSEAVVS  295

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y + LRQIFPNIQQ+DS +FA
Sbjct  296  SREKLTTIYLENNPCAKSTSYSAFLRQIFPNIQQIDSSVFA  336


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            +L+ LQEL L  N+++ I   G+ K +    +  N +TS+ GL +    L+ELY+S N +
Sbjct  93   SLSALQELVLRDNKLKKIPDSGIFKNLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEV  152

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             K+E +  L  L++L++ +N+L  + ++ N T L++LWL  N I  V
Sbjct  153  TKIEEIDHLYQLQILELGSNRLRVMESMQNFTSLQELWLGRNRIKVV  199



>ref|XP_009405606.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Musa acuminata subsp. malaccensis]
Length=348

 Score =   258 bits (659),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 122/160 (76%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+TLTNLQELWLGRNRIR + LCGLKCI+KIS+QSNRLTSM G +EC+ALEELYLS
Sbjct  188  VMENLETLTNLQELWLGRNRIRMVTLCGLKCIRKISLQSNRLTSMMGFQECIALEELYLS  247

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLRVLD+S+NKLTAIS+I  LT+LEDLWLNDN I S++ I  AV+G
Sbjct  248  HNGIQKMEGLSTLQNLRVLDISSNKLTAISDIEKLTRLEDLWLNDNQIPSLKGIDLAVSG  307

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            S +KLTT+YLERNPCA S  Y +TLRQIFPN+QQ+DS++F
Sbjct  308  SREKLTTIYLERNPCATSSEYSTTLRQIFPNLQQLDSDIF  347


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 61/106 (58%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            +  L EL L  N++R I ++   K +    +  N ++S+ GL      L+ELY+S N + 
Sbjct  106  IAGLHELVLRDNKLRKIPDVSIFKNLLVFDVSFNEISSLNGLSNVANTLKELYVSKNEVN  165

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L  L +L++L++ +N+L  + N+  LT L++LWL  N I  V
Sbjct  166  KMEELEHLHSLQILELGSNRLRVMENLETLTNLQELWLGRNRIRMV  211



>ref|XP_002871899.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48158.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   258 bits (658),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  168  VMENLENFTKLEELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGL+ LV LRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLNALVTLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAVVRQIFPNVEQIDSNLFA  328


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 1/78 (1%)
 Frame = -1

Query  658  ISIQSNRLTSMKGLEECVA-LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA  482
              I  N +TS++G  +  + L+ELY+S N + K+  +  L NL++L++ +N+L  + N+ 
Sbjct  114  FDISFNEITSLEGTSKASSTLKELYVSKNEVNKIVEIEHLHNLQILELGSNRLRVMENLE  173

Query  481  NLTKLEDLWLNDNNISSV  428
            N TKLE+LWL  N I  V
Sbjct  174  NFTKLEELWLGRNRIKVV  191



>ref|XP_010454252.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Camelina sativa]
Length=328

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+  T L+ELWLGRNRI+ +NLCGL+CIKKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  168  VMENLENFTILEELWLGRNRIKVVNLCGLRCIKKISLQSNRLTSMKGFEDCVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I NLTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQNLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S  KLTT+YLE NPCA S +Y++ +RQIFPN++Q+DS LFA
Sbjct  288  SKDKLTTIYLENNPCAKSSDYVAVVRQIFPNVEQIDSNLFA  328


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + ++     +    I  N +TS++GL +  + L+ELY+S N + 
Sbjct  86   LSDLEELVLRDNKLEKVPDISIFSKLLVFDISFNEITSLEGLSKATSSLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L NL++L++ +N+L  + N+ N T LE+LWL  N I  V
Sbjct  146  KIMEIEHLHNLQILELGSNRLRVMENLENFTILEELWLGRNRIKVV  191



>ref|XP_008794123.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Phoenix dactylifera]
 ref|XP_008794124.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Phoenix dactylifera]
Length=330

 Score =   257 bits (657),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 119/160 (74%), Positives = 144/160 (90%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +MENLQTLTNLQELWLGRNRIR +NLCGLKCI+KIS+QSNRLT M G +ECVALEELYLS
Sbjct  170  IMENLQTLTNLQELWLGRNRIRMVNLCGLKCIRKISLQSNRLTCMTGFQECVALEELYLS  229

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGL+TLVNLRVLD+S+NKLTAI +I NLT+LEDLWLNDN I+S+E +  AV+G
Sbjct  230  HNGIQKMEGLATLVNLRVLDISSNKLTAIEDIENLTRLEDLWLNDNQIASLEGLELAVSG  289

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            S +KLTT+YLE NPCA  PNY +TL+++FPN+QQ+DS++ 
Sbjct  290  SREKLTTIYLEHNPCAGFPNYSTTLKKLFPNLQQIDSDIL  329


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            T++ L EL L  N++R I ++   K +    +  N ++S+ GL +    LEELY+S N +
Sbjct  87   TISGLHELVLRDNKLRKIPDVSIFKNLLVFDVSFNEISSLNGLSKVSNTLEELYVSKNEV  146

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME L  L  LR+L++ +N L  + N+  LT L++LWL  N I  V
Sbjct  147  TKMEELEHLHALRILELGSNNLRIMENLQTLTNLQELWLGRNRIRMV  193



>ref|XP_006853636.1| hypothetical protein AMTR_s00056p00073840 [Amborella trichopoda]
 gb|ERN15103.1| hypothetical protein AMTR_s00056p00073840 [Amborella trichopoda]
Length=347

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ LTNLQELWLGRNRIR + LCGLKCI+K S+QSNRLTSM G + C+ALEELYLS
Sbjct  187  VMENLQNLTNLQELWLGRNRIREVQLCGLKCIRKFSLQSNRLTSMLGFQHCIALEELYLS  246

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLRVLDVS+NKLTA+++I NLTKLEDLWLNDN I+S+E I +AVAG
Sbjct  247  HNGIQKMEGLSTLENLRVLDVSSNKLTAVNDIENLTKLEDLWLNDNKIASLEGIGKAVAG  306

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S + LTT+YLE NPCA+SP Y++ LR+IFPN+ Q+DS +FA
Sbjct  307  STETLTTIYLEHNPCADSPAYMANLREIFPNLVQIDSTVFA  347


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 49/74 (66%), Gaps = 1/74 (1%)
 Frame = -1

Query  643  NRLTSMKGLEECVA-LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL  467
            N ++S++G+ +  + L+ELY+S N + KM  L  L  LR+L++ +N+L  + N+ NLT L
Sbjct  138  NEISSLEGVSKVSSMLQELYVSKNEVTKMVELDHLHELRILELGSNRLRVMENLQNLTNL  197

Query  466  EDLWLNDNNISSVE  425
            ++LWL  N I  V+
Sbjct  198  QELWLGRNRIREVQ  211



>gb|EPS60921.1| hypothetical protein M569_13879, partial [Genlisea aurea]
Length=330

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ+LT+LQELWLGRNRIRAI LCGLK IKK+S+QSNRLTS +GLEEC +LEELYLS
Sbjct  171  VMENLQSLTSLQELWLGRNRIRAIELCGLKSIKKLSLQSNRLTSTRGLEECTSLEELYLS  230

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKL  I +I NL KLEDLWLNDN I+S+++I EAVAG
Sbjct  231  HNGIAKMEGLSTLVNLRVLDVSSNKLPEIEDINNLEKLEDLWLNDNRIASLDNIDEAVAG  290

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            S Q LTTLYLERN CANS +Y+S LR++FPNIQQ+DS++F
Sbjct  291  SRQTLTTLYLERNQCANSQDYVSVLRRVFPNIQQLDSQIF  330


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEEC-VALEELYLSHNGI  569
            T+++LQEL L  N+++ I   G+ K +  +    N ++S+ GL      L+ELY+S N +
Sbjct  88   TISSLQELVLRDNQLKKIPDVGIFKGLLVLDASFNDISSLNGLSSASTTLKELYVSKNEL  147

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE  425
             ++E +  L  L++L++ +NKL  + N+ +LT L++LWL  N I ++E
Sbjct  148  TRIEEIEHLQELKILELGSNKLKVMENLQSLTSLQELWLGRNRIRAIE  195



>gb|KDP42237.1| hypothetical protein JCGZ_02967 [Jatropha curcas]
Length=337

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/161 (76%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+ LTNLQELWLGRNRI+ INLCGLK I+K+S+QSNRLTSMKGLEECVALEELYLS
Sbjct  177  VMENLKNLTNLQELWLGRNRIKTINLCGLKYIRKLSLQSNRLTSMKGLEECVALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLV L VLDVS+NKLT++++I NLT LEDLWLNDN I S++ I EA+AG
Sbjct  237  HNGIAKMEGLSTLVKLSVLDVSSNKLTSVNDIQNLTHLEDLWLNDNQIESLDGIEEAIAG  296

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+Y+E NPC  SPNY   LRQIFPNIQQ+DS +FA
Sbjct  297  SREKLTTIYIENNPCTRSPNYGIILRQIFPNIQQIDSNVFA  337


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNR-IRAINLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            + L  L+EL L  N+ I+  ++   K +    +  N + S++GL +    L+ELY+S N 
Sbjct  93   EPLVGLEELVLRDNKLIKIPDVSIFKSLLVFDVSFNEIRSLQGLSKASNTLKELYVSKNE  152

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + KME +  L  L++L++ +N+L  + N+ NLT L++LWL  N I ++
Sbjct  153  VTKMEEIDHLYQLQILELGSNRLRVMENLKNLTNLQELWLGRNRIKTI  200



>emb|CDY44934.1| BnaA02g04390D [Brassica napus]
Length=318

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++ LT L+ELWLGRNRI+ +NLCGL+C+KKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  158  VMENMENLTKLEELWLGRNRIKVVNLCGLRCVKKISLQSNRLTSMKGFEDCVALEELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I S+E I EAV G
Sbjct  218  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIESLEAITEAVTG  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ LR+IFPN++Q+DS LFA
Sbjct  278  SKEKLTTIYLENNPCAKSSDYVAVLRKIFPNVEQIDSNLFA  318


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L +L+EL L  N++  + ++     +    +  N +TS++G+ +  + L+ELY+S N 
Sbjct  74   DALCDLEELILRDNKLAKVPDVSIFSRLLVFDVSFNEITSLEGISKASSTLKELYVSKNE  133

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L  + N+ NLTKLE+LWL  N I  V
Sbjct  134  VNKIMEIEHLHDLQILELGSNRLRVMENMENLTKLEELWLGRNRIKVV  181



>emb|CDY58975.1| BnaC09g38010D [Brassica napus]
Length=328

 Score =   256 bits (654),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++  T L ELWLGRNRI+ +NLCGL CIKKIS+QSNRLTSMKG EECVALEELYLS
Sbjct  168  VMENMENFTKLDELWLGRNRIKVVNLCGLTCIKKISLQSNRLTSMKGFEECVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I  LTKLEDLWLNDN I S+E I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVVDIQTLTKLEDLWLNDNQIESLEAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ LRQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSSDYVAVLRQIFPNVEQIDSNLFA  328


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + +      +    +  N +TS++GL +  + L+ELY+S N + 
Sbjct  86   LSDLEELILRDNKLAKVPDTAIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L +L++L++ +N+L  + N+ N TKL++LWL  N I  V
Sbjct  146  KIMEIEHLHDLQILELGSNRLRVMENMENFTKLDELWLGRNRIKVV  191



>ref|XP_002451818.1| hypothetical protein SORBIDRAFT_04g008200 [Sorghum bicolor]
 gb|EES04794.1| hypothetical protein SORBIDRAFT_04g008200 [Sorghum bicolor]
Length=344

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+TLTNLQELWLGRNRIRA+NLCGLK IKKIS+QSNRLTSM G +EC ALEELYLS
Sbjct  184  VMENLETLTNLQELWLGRNRIRAVNLCGLKLIKKISLQSNRLTSMDGFQECTALEELYLS  243

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLR+LDVS+NKLT I NI  LT+LEDLWLNDN I S++ I  A+AG
Sbjct  244  HNGIQKMEGLSTLQNLRILDVSSNKLTTIENIETLTRLEDLWLNDNQIPSLDGIETALAG  303

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLERNPCA +P Y STL++IFP ++Q+DS++ A
Sbjct  304  SREKLTTIYLERNPCAKTPEYSSTLKKIFPKLEQIDSDIIA  344


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
            +T+  LQEL L  N++  I   G+ K +    +  N ++S+ G+ +  + L+ELY+S N 
Sbjct  100  ETIAGLQELVLRDNKLTRIPDAGIFKGLLVFDVSFNEISSLTGMSKVSSKLKELYVSKNE  159

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + KME L  L  L +L++ +N+L  + N+  LT L++LWL  N I +V
Sbjct  160  VAKMEELEHLHALEILELGSNRLRVMENLETLTNLQELWLGRNRIRAV  207



>ref|XP_010249563.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Nelumbo 
nucifera]
Length=337

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ LT+LQELWLGRNRIR +NLCGL+CIKK+S+QSNRLTSM G ++CVALEELYLS
Sbjct  177  VMENLQNLTHLQELWLGRNRIRTVNLCGLRCIKKLSLQSNRLTSMLGFQDCVALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTL NL VLDVS+NKLT I++I NLT+LEDLWLNDN I+S+E I  AVAG
Sbjct  237  HNGISKMEGLSTLANLHVLDVSSNKLTTINDIENLTRLEDLWLNDNQIASLEGIDSAVAG  296

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA + NY +TLR IFPN+QQ+DS++F+
Sbjct  297  SREKLTTIYLENNPCATTSNYSATLRHIFPNLQQIDSDIFS  337


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            +++ LQEL L  NR+  I +    K +    I  N + S+ GL +    L+ELY+S N +
Sbjct  94   SISGLQELVLRDNRLTKIPDASIFKSLLVFDISFNEIPSLNGLSKVSNTLKELYVSKNEV  153

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             K+E L     L++L++ +N+L  + N+ NLT L++LWL  N I +V
Sbjct  154  TKIEELDHFHELQILELGSNRLRVMENLQNLTHLQELWLGRNRIRTV  200



>ref|XP_007160299.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
 gb|ESW32293.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
Length=330

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ+L NLQELWLGRNRI+ +NLCGL CIKKIS+QSNRLTSM G E C+ALEELYLS
Sbjct  171  VMENLQSLANLQELWLGRNRIKVVNLCGLNCIKKISLQSNRLTSMTGFEGCIALEELYLS  230

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLR+LDVS+NKLT++ +I NLT+LEDLWLNDN I+S+E + EAV  
Sbjct  231  HNGIAKMEGLSTLVNLRILDVSSNKLTSVDDIVNLTQLEDLWLNDNQIASLEGVTEAVC-  289

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY + LR+IFPNIQQ+DS +F+
Sbjct  290  SREKLTTIYLENNPCAKSPNYTAFLREIFPNIQQIDSHVFS  330


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 62/108 (57%), Gaps = 6/108 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            L +L EL L  N++R  N+  +   +K+    +  N+++S+ G  +    L+ELY+S N 
Sbjct  89   LASLDELVLRDNQLR--NIPDVSIFQKLLVFDVSFNQISSLHGCAKVSDTLKELYVSKNE  146

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+E +     L++L++ +NKL  + N+ +L  L++LWL  N I  V
Sbjct  147  VAKIEEIDHFHQLQILELGSNKLRVMENLQSLANLQELWLGRNRIKVV  194



>ref|XP_009120865.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Brassica 
rapa]
Length=328

 Score =   254 bits (650),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++  T L ELWLGRNRI+ +NLCGL CIKKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  168  VMENMENFTKLDELWLGRNRIKVVNLCGLTCIKKISLQSNRLTSMKGFEDCVALEELYLS  227

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I  LTKLEDLWLNDN I S++ I EAV G
Sbjct  228  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQTLTKLEDLWLNDNQIESLQAITEAVTG  287

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ LRQIFPN++Q+DS LFA
Sbjct  288  SKEKLTTIYLENNPCAKSADYVAVLRQIFPNVEQIDSNLFA  328


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + +      +    +  N +TS++GL +  + L+ELY+S N + 
Sbjct  86   LSDLEELILRDNKLAKVPDTAIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNEVN  145

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L +L++L++ +N+L  + N+ N TKL++LWL  N I  V
Sbjct  146  KIMEIEHLHDLQILELGSNRLRVMENMENFTKLDELWLGRNRIKVV  191



>ref|XP_007160300.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
 gb|ESW32294.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
Length=358

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 141/161 (88%), Gaps = 1/161 (1%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ+L NLQELWLGRNRI+ +NLCGL CIKKIS+QSNRLTSM G E C+ALEELYLS
Sbjct  199  VMENLQSLANLQELWLGRNRIKVVNLCGLNCIKKISLQSNRLTSMTGFEGCIALEELYLS  258

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLR+LDVS+NKLT++ +I NLT+LEDLWLNDN I+S+E + EAV  
Sbjct  259  HNGIAKMEGLSTLVNLRILDVSSNKLTSVDDIVNLTQLEDLWLNDNQIASLEGVTEAVC-  317

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY + LR+IFPNIQQ+DS +F+
Sbjct  318  SREKLTTIYLENNPCAKSPNYTAFLREIFPNIQQIDSHVFS  358


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/108 (31%), Positives = 62/108 (57%), Gaps = 6/108 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            L  +QEL L  N++R  N+  +   +K+    +  N+++S+ G  +    L+ELY+S N 
Sbjct  117  LFYMQELVLRDNQLR--NIPDVSIFQKLLVFDVSFNQISSLHGCAKVSDTLKELYVSKNE  174

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+E +     L++L++ +NKL  + N+ +L  L++LWL  N I  V
Sbjct  175  VAKIEEIDHFHQLQILELGSNKLRVMENLQSLANLQELWLGRNRIKVV  222



>ref|XP_009126382.1| PREDICTED: LOW QUALITY PROTEIN: protein phosphatase 1 regulatory 
subunit pprA-like [Brassica rapa]
Length=318

 Score =   253 bits (646),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 140/161 (87%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN++ LT L+ELWLGRNRI+ + LCGL+C+KKIS+QSNRLTSMKG E+CVALEELYLS
Sbjct  158  VMENMENLTKLEELWLGRNRIKVVXLCGLRCVKKISLQSNRLTSMKGFEDCVALEELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I S+E I EAV G
Sbjct  218  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNPIESLEAITEAVTG  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S +Y++ LR+IFPN++Q+DS LFA
Sbjct  278  SKEKLTTIYLENNPCAKSSDYVAVLRKIFPNVEQIDSNLFA  318


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 65/108 (60%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L +L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  74   DALCDLEELILRDNKLAKVPDVSIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNE  133

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L  + N+ NLTKLE+LWL  N I  V
Sbjct  134  VNKIMEIEHLHDLQILELGSNRLRVMENMENLTKLEELWLGRNRIKVV  181



>gb|EEC72782.1| hypothetical protein OsI_06455 [Oryza sativa Indica Group]
Length=333

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+TL NLQELWLGRNRI+ INLCGLK IKK+S+QSNRLTSM GL+EC+ALEELYLS
Sbjct  173  VMENLETLANLQELWLGRNRIKTINLCGLKAIKKLSLQSNRLTSMNGLQECIALEELYLS  232

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLRVLDVS+NKLTAI ++  L++LEDLWLNDN I S++ I  A+A 
Sbjct  233  HNGIQKMEGLSTLQNLRVLDVSSNKLTAIEDVETLSRLEDLWLNDNQIPSLDGIESALAS  292

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLERNPCA +PNY STL+ IFPN++Q+DS++ A
Sbjct  293  SREKLTTIYLERNPCAKAPNYSSTLKTIFPNLEQLDSDMLA  333


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 60/106 (57%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            +  LQEL    N++  I +    K +    +  N ++S+KGL +  + L+ELY+S N + 
Sbjct  91   IAGLQELVFRDNKLTTIPDASIFKGLLVFDVSFNEISSLKGLSKVSSTLKELYVSKNEVA  150

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L     L++L++ +N+L  + N+  L  L++LWL  N I ++
Sbjct  151  KMEELEHFHALQILELGSNRLRVMENLETLANLQELWLGRNRIKTI  196



>ref|XP_008364658.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
 ref|XP_008364659.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
Length=339

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME+LQ +T LQELWLGRNRI+ +NLCGLKCIKK+S+QSNRLTSM G EECVALEELYLS
Sbjct  179  VMESLQNMTKLQELWLGRNRIKVVNLCGLKCIKKLSLQSNRLTSMTGFEECVALEELYLS  238

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS NKL ++  I NLT LEDLWLNDN+  S+E  A+ VAG
Sbjct  239  HNGISKMEGLSTLVNLRVLDVSNNKLASVEGIENLTVLEDLWLNDNSXESLEGFAKVVAG  298

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY + LRQIF NI+Q+DS +F+
Sbjct  299  SREKLTTIYLENNPCAKSPNYATALRQIFXNIEQIDSHVFS  339



>ref|XP_008356664.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
 ref|XP_008356665.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
Length=339

 Score =   252 bits (643),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 137/161 (85%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME+LQ +T LQELWLGRNRI+ +NLCGLKCIKK+S+QSNRLTSM G EECVALEELYLS
Sbjct  179  VMESLQNMTKLQELWLGRNRIKVVNLCGLKCIKKLSLQSNRLTSMTGFEECVALEELYLS  238

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS NKL ++  I NLT LEDLWLNDN+  S+E  A+ VAG
Sbjct  239  HNGISKMEGLSTLVNLRVLDVSNNKLASVEGIENLTVLEDLWLNDNSXESLEGFAKVVAG  298

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA SPNY + LRQIF NI+Q+DS +F+
Sbjct  299  SREKLTTIYLENNPCAKSPNYATALRQIFXNIEQIDSHVFS  339



>ref|XP_011008944.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Populus euphratica]
Length=337

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN+  LT+LQELW+GRNRI+ +NLCGLKCIKK+S+QSNRLTSMKG EECVALEELYLS
Sbjct  177  VMENMGNLTSLQELWMGRNRIKVVNLCGLKCIKKLSLQSNRLTSMKGFEECVALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KM+GLSTL NLRVLDVS+NKLT++ +I NLT+LEDLWLNDN I S++ +AEAV  
Sbjct  237  HNGIAKMDGLSTLANLRVLDVSSNKLTSVDDIQNLTQLEDLWLNDNQIESLKGVAEAVVS  296

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S NY + LR+ FPNI Q+DS +FA
Sbjct  297  SREKLTTIYLENNPCAKSTNYTAFLREFFPNIGQIDSNVFA  337


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            +++ LQEL L  N+++ I   G+ K +    +  N +TS+ GL +    L+ELY+S N  
Sbjct  94   SISGLQELVLRDNKLKKIPDSGIFKNLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEA  153

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             K+E +  L  LR+L++ +N+L  + N+ NLT L++LW+  N I  V
Sbjct  154  TKIEEIDHLYQLRILELGSNRLRVMENMGNLTSLQELWMGRNRIKVV  200



>ref|XP_006647096.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Oryza brachyantha]
Length=334

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 142/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+TL NLQELWLGRNRI+ INLCGLK IKK+S+QSNRLTSM GL+EC+ALEELYLS
Sbjct  174  VMENLETLANLQELWLGRNRIKTINLCGLKSIKKLSLQSNRLTSMNGLQECIALEELYLS  233

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLRVLDVS+NKLT+I +I  LT+LEDLWLNDN I S++ I  A+A 
Sbjct  234  HNGIQKMEGLSTLQNLRVLDVSSNKLTSIEDIETLTRLEDLWLNDNQIPSLDGIESALAS  293

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLERNPC+ +PNY  TL++IFPN++Q+DS++ A
Sbjct  294  SREKLTTIYLERNPCSKTPNYSPTLKKIFPNLEQIDSDMLA  334


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 59/106 (56%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            +  LQEL    N++  I +    K +    +  N ++S+KGL +  + L+ELY+S N + 
Sbjct  92   IAGLQELVFRDNKLTTIPDASIFKGLVVFDVSFNEISSLKGLSKVSSTLKELYVSKNEVA  151

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L     L +L++ +N+L  + N+  L  L++LWL  N I ++
Sbjct  152  KMEELEHFHALDILELGSNRLRVMENLETLANLQELWLGRNRIKTI  197



>ref|XP_006381757.1| hypothetical protein POPTR_0006s17720g [Populus trichocarpa]
 gb|ERP59554.1| hypothetical protein POPTR_0006s17720g [Populus trichocarpa]
Length=337

 Score =   250 bits (639),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMEN+   T+LQELW+GRNRI+ +NLCGLKCIKK+S+QSNRLTSMKG EECVALEELYLS
Sbjct  177  VMENMGNFTSLQELWMGRNRIKVVNLCGLKCIKKLSLQSNRLTSMKGFEECVALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTL NL VLDVS+NKLT++ +I NLT+LEDLWLNDN I S++ +AEAV  
Sbjct  237  HNGIAKMEGLSTLANLHVLDVSSNKLTSVDDIQNLTQLEDLWLNDNQIESLKGVAEAVIS  296

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLE NPCA S NY + LR+ FPNI+Q+DS +FA
Sbjct  297  SREKLTTIYLENNPCAKSTNYTAFLREFFPNIEQIDSNVFA  337


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGL-KCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            +++ LQEL L  N+++ I   G+ K +    +  N +TS+ GL +    L+ELY+S N +
Sbjct  94   SISGLQELVLRDNKLKKIPDTGIFKSLLVFDVSFNEITSLHGLSKASNTLKELYVSKNEV  153

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             K+E +  L  L++L++ +N+L  + N+ N T L++LW+  N I  V
Sbjct  154  TKIEEIDHLYQLQILELGSNRLRVMENMGNFTSLQELWMGRNRIKVV  200



>ref|NP_001046364.1| Os02g0230100 [Oryza sativa Japonica Group]
 dbj|BAD26172.1| putative sds22+ [Oryza sativa Japonica Group]
 dbj|BAF08278.1| Os02g0230100 [Oryza sativa Japonica Group]
 dbj|BAG95066.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56607.1| hypothetical protein OsJ_05977 [Oryza sativa Japonica Group]
Length=333

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 141/161 (88%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+TL NLQELWLGRNRI+ INLC LK IKK+S+QSNRLTSM GL+EC+ALEELYLS
Sbjct  173  VMENLETLANLQELWLGRNRIKTINLCSLKAIKKLSLQSNRLTSMNGLQECIALEELYLS  232

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+KMEGLSTL NLRVLDVS+NKLTAI ++  L++LEDLWLNDN I S++ I  A+A 
Sbjct  233  HNGIQKMEGLSTLQNLRVLDVSSNKLTAIEDVETLSRLEDLWLNDNQIPSLDGIESALAS  292

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +KLTT+YLERNPCA +PNY STL+ IFPN++Q+DS++ A
Sbjct  293  SREKLTTIYLERNPCAKAPNYSSTLKTIFPNLEQLDSDMLA  333


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 60/106 (57%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            +  LQEL    N++  I +    K +    +  N ++S+KGL +  + L+ELY+S N + 
Sbjct  91   IAGLQELVFRDNKLTTIPDASIFKGLLVFDVSFNEISSLKGLSKVSSTLKELYVSKNEVA  150

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME L     L++L++ +N+L  + N+  L  L++LWL  N I ++
Sbjct  151  KMEELEHFHALQILELGSNRLRVMENLETLANLQELWLGRNRIKTI  196



>ref|XP_010253998.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Nelumbo nucifera]
 ref|XP_010253999.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Nelumbo nucifera]
Length=338

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 139/160 (87%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            V+ENLQ L +LQELWLGRNRIR +NLCGL+CIKKIS+QSNRLTSM G ++CV+LEELYLS
Sbjct  178  VIENLQNLAHLQELWLGRNRIRTVNLCGLRCIKKISLQSNRLTSMLGFQDCVSLEELYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTL NLRVLDVS+NKLT I +I +LT+LEDLWLNDN I+S+E I  AVAG
Sbjct  238  HNGISKMEGLSTLANLRVLDVSSNKLTTIDDIEHLTRLEDLWLNDNQIASLEGIDVAVAG  297

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            S +KLTT+YLERN CA S NY + LR IFPN+QQ+DS++F
Sbjct  298  SSKKLTTIYLERNQCATSSNYSAILRSIFPNLQQIDSDIF  337


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            +++ L+EL L  NR++ I ++   K +    +  N ++S+ GL +    L+ELY+S N +
Sbjct  95   SISALEELVLRDNRLKKIPDVSIFKSLLVFDVSFNEISSLNGLSKITNTLKELYVSKNEV  154

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME L    +L++L++ +N+L  I N+ NL  L++LWL  N I +V
Sbjct  155  TKMEELDHFHDLQILELGSNRLRVIENLQNLAHLQELWLGRNRIRTV  201



>ref|XP_011093997.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Sesamum 
indicum]
Length=353

 Score =   246 bits (629),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 125/183 (68%), Positives = 144/183 (79%), Gaps = 22/183 (12%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEE-------CVA  602
            VMENL+ L+ LQELWLGRNRIRAINLCGLKCIKK+S+QSNRLTS+ GLE        C +
Sbjct  171  VMENLENLSTLQELWLGRNRIRAINLCGLKCIKKLSLQSNRLTSISGLEVATMDSVCCSS  230

Query  601  L---------------EELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL  467
                            ++LYLSHNGIEKMEGLSTLVNLRVLDVS+NKL  I++I NL KL
Sbjct  231  YINNSFKPNSSVKHFQQKLYLSHNGIEKMEGLSTLVNLRVLDVSSNKLKEINDIKNLAKL  290

Query  466  EDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSE  287
            EDLWLNDN I+S++ IAEAVA S + LTT+YLERNPCANSPNYISTLRQIFP IQQ+DSE
Sbjct  291  EDLWLNDNQITSLDSIAEAVASSRESLTTIYLERNPCANSPNYISTLRQIFPKIQQIDSE  350

Query  286  LFA  278
            ++ 
Sbjct  351  IYG  353


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/107 (32%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            +++ LQEL L  N+++ I ++   K +    +  N ++S+ GL +    L+ELY+S N +
Sbjct  88   SISALQELVLRDNQLKKIPDVSIFKVLLVFDVSFNEISSLNGLSKVSNTLKELYVSKNEV  147

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             K+E +     L++L++ +NKL  + N+ NL+ L++LWL  N I ++
Sbjct  148  TKIEEIEHFHQLQILELGSNKLRVMENLENLSTLQELWLGRNRIRAI  194



>ref|XP_010688296.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Beta 
vulgaris subsp. vulgaris]
Length=338

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/161 (76%), Positives = 145/161 (90%), Gaps = 0/161 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENL+TL NLQELWLGRNRI+A+NLCGLKCIKK+S+QSNRLTS+KGLEEC ALEELYLS
Sbjct  178  VMENLETLINLQELWLGRNRIKAVNLCGLKCIKKLSLQSNRLTSIKGLEECEALEELYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTL NLRVLD+++NKLTAI +I  LT+LEDLWLNDN I+S+E +A+ V+G
Sbjct  238  HNGISKMEGLSTLANLRVLDIASNKLTAIEDIEKLTRLEDLWLNDNQIASLEGMADIVSG  297

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            S +K+TT+YLE NPCA SPNY +TLRQIFP IQQ+DS++ A
Sbjct  298  SKEKITTIYLENNPCAKSPNYTATLRQIFPYIQQIDSQIIA  338


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 61/108 (56%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNG  572
              +++L+EL L  N++  I ++   K +    +  N ++S+ GL +    L+ELY+S N 
Sbjct  94   HAISSLEELVLRDNKLMKIPDVSIYKDLVVFDVSFNEISSLSGLSKVSNTLKELYVSKNE  153

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+E +     L +L++ +NKL  + N+  L  L++LWL  N I +V
Sbjct  154  VTKIEEIEHFHKLLILELGSNKLRVMENLETLINLQELWLGRNRIKAV  201



>gb|KDO66519.1| hypothetical protein CISIN_1g018662mg [Citrus sinensis]
Length=330

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ LTNLQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EEC+ALEELYLS
Sbjct  177  VMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNL VLDVS+NKLT + +I NL++LEDLWLNDN I S+E I EAVAG
Sbjct  237  HNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAG  296

Query  400  SLQKLTTLYLERNPC  356
            S + LTT+YLE NPC
Sbjct  297  SRETLTTIYLENNPC  311


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            L  L+EL L  N++  I ++   K +    +  N +TS  GL      L+ELY+S N + 
Sbjct  95   LAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVP  154

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME +    +L++L+  +N+L  + N+ NLT L++LWL  N I  V
Sbjct  155  KMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVV  200



>ref|XP_002514241.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus 
communis]
 gb|EEF48195.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus 
communis]
Length=312

 Score =   226 bits (575),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ LT LQELWLGRNRI+ INLCGLKCIKK+S+QSNRLTSMKGLEECVALEELYLS
Sbjct  177  VMENLQNLTTLQELWLGRNRIKTINLCGLKCIKKLSLQSNRLTSMKGLEECVALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNL VLDVS+NKLT++ +I NLT++EDLWLNDN I S+E IAEA+ G
Sbjct  237  HNGISKMEGLSTLVNLSVLDVSSNKLTSVDDIQNLTQIEDLWLNDNQIESLEGIAEAIVG  296

Query  400  SLQKLTTLYLERNPCA  353
            S +KLTT+Y E NPC 
Sbjct  297  SREKLTTIYFENNPCV  312


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/108 (33%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            + L+ L+EL L  N++  I ++   K +    +  N + S+ GL +    L+ELY+S N 
Sbjct  93   EELSGLEELVLRDNKLMKIPDVTIFKSLLVFDVSFNEIRSLNGLSKVSNTLKELYVSKNE  152

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + KME +  L  L++L++ +N+L  + N+ NLT L++LWL  N I ++
Sbjct  153  VTKMEEIDHLYQLQMLELGSNRLRVMENLQNLTTLQELWLGRNRIKTI  200



>gb|KHG22032.1| Protein phosphatase 1 regulatory subunit pprA [Gossypium arboreum]
Length=332

 Score =   225 bits (574),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ  T L+ELWLGRNRI+AINLCGLK IKKIS+QSNRLTSM GLEECVALEELYLS
Sbjct  178  VMENLQNFTKLEELWLGRNRIKAINLCGLKYIKKISLQSNRLTSMIGLEECVALEELYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKLT++++I NLT+LEDLWLNDN I S+E +AEAV+G
Sbjct  238  HNGILKMEGLSTLVNLRVLDVSSNKLTSVNDIQNLTRLEDLWLNDNQIESLESVAEAVSG  297

Query  400  SLQKLTTLYLERNPCAN  350
            S +KLTT+YLE NPC N
Sbjct  298  SREKLTTVYLENNPCEN  314


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGI  569
            +L+ L+EL L  N++  + ++   K +    +  N +TS+ G+ +  + L+ELY+S N +
Sbjct  95   SLSGLEELVLRDNKLTKVPDVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEV  154

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME +  L  L++L++ +N+L  + N+ N TKLE+LWL  N I ++
Sbjct  155  TKMEEIDHLHELQILELGSNRLRVMENLQNFTKLEELWLGRNRIKAI  201



>ref|XP_004503472.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X1 [Cicer arietinum]
Length=352

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 112/153 (73%), Positives = 124/153 (81%), Gaps = 3/153 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ L NLQELWLGRNRI+ INLCGLKCIKKIS+QSNRLTSM G E CVALEELYLS
Sbjct  167  VMENLQNLVNLQELWLGRNRIKIINLCGLKCIKKISLQSNRLTSMIGFEGCVALEELYLS  226

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS+LVNLRVLDVS+NKLT++ +I NLT+LEDLWLNDN I S+E  AEAVAG
Sbjct  227  HNGITKMEGLSSLVNLRVLDVSSNKLTSVDDILNLTQLEDLWLNDNQIESLEGFAEAVAG  286

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQ  302
            S +KLTT+YLE NPC     +      IF   Q
Sbjct  287  SREKLTTIYLENNPCV---RFFLAFWWIFHQFQ  316


 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 6/105 (6%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECV-ALEELYLSHNG  572
            L++L+E+ L  N+++  N+  +    K+    +  N +TS+ GL      L ELY+S N 
Sbjct  85   LSSLEEIVLRDNQLK--NIPDVTIFNKLLLFDVSFNEITSLHGLSRVSNTLNELYVSKNE  142

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNI  437
            I K+E +     L +L++ +NKL  + N+ NL  L++LWL  N I
Sbjct  143  ITKIEEIDHFHQLHILELGSNKLRVMENLQNLVNLQELWLGRNRI  187



>gb|KJB83109.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=365

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ  T L+ELWLGRNRI+AINLCGLK IKKIS+QSNRLTSM GLEECVALEELYLS
Sbjct  178  VMENLQNFTKLEELWLGRNRIKAINLCGLKYIKKISLQSNRLTSMIGLEECVALEELYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNLRVLDVS+NKLT+++++ NLT+LEDLWLNDN I S+E +AEAV+G
Sbjct  238  HNGISKMEGLSTLVNLRVLDVSSNKLTSVNDVQNLTRLEDLWLNDNQIESLESVAEAVSG  297

Query  400  SLQKLTTLYLERNPCA  353
            S +KLTT+YLE NPC 
Sbjct  298  SREKLTTVYLENNPCV  313


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGI  569
            +L+ L+EL L  N++  + ++   K +    +  N +TS+ G+ +  + L+ELY+S N +
Sbjct  95   SLSGLEELVLRDNKLMKVPDVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEV  154

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME +  L  L++L++ +N+L  + N+ N TKLE+LWL  N I ++
Sbjct  155  TKMEEIDHLHELQILELGSNRLRVMENLQNFTKLEELWLGRNRIKAI  201



>gb|KDO66518.1| hypothetical protein CISIN_1g018662mg [Citrus sinensis]
Length=352

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQ LTNLQELWLGRNRI+ +NLCGLKCIKKIS+QSNRLTSMKG EEC+ALEELYLS
Sbjct  177  VMENLQNLTNLQELWLGRNRIKVVNLCGLKCIKKISLQSNRLTSMKGFEECIALEELYLS  236

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLSTLVNL VLDVS+NKLT + +I NL++LEDLWLNDN I S+E I EAVAG
Sbjct  237  HNGISKMEGLSTLVNLHVLDVSSNKLTLVDDIQNLSRLEDLWLNDNQIESLESIVEAVAG  296

Query  400  SLQKLTTLYLERNP  359
            S + LTT+YLE NP
Sbjct  297  SRETLTTIYLENNP  310


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/106 (35%), Positives = 59/106 (56%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGIE  566
            L  L+EL L  N++  I ++   K +    +  N +TS  GL      L+ELY+S N + 
Sbjct  95   LAGLEELILRDNKLMKIPDVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVP  154

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            KME +    +L++L+  +N+L  + N+ NLT L++LWL  N I  V
Sbjct  155  KMEEIEHFHDLQILEFGSNRLRVMENLQNLTNLQELWLGRNRIKVV  200



>gb|KJB62255.1| hypothetical protein B456_009G408400 [Gossypium raimondii]
Length=243

 Score =   216 bits (551),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME LQ  T LQELWLGRNRI+ INLCGL CIKKIS+QSNRLTSM GLEEC ALEE+YLS
Sbjct  100  VMEKLQNFTKLQELWLGRNRIKVINLCGLSCIKKISLQSNRLTSMIGLEECNALEEIYLS  159

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS+NKLT++ +I NLT+LEDLW NDN I S+EDIAE V+G
Sbjct  160  HNGIAKMEGLSKLVNLRVLDVSSNKLTSVDDIQNLTRLEDLWHNDNRIESLEDIAEGVSG  219

Query  400  SLQKLTTLYLERNPC  356
            S +KLTT+YLE NPC
Sbjct  220  SREKLTTIYLENNPC  234



>ref|XP_002987569.1| hypothetical protein SELMODRAFT_183219 [Selaginella moellendorffii]
 gb|EFJ11405.1| hypothetical protein SELMODRAFT_183219 [Selaginella moellendorffii]
Length=317

 Score =   212 bits (539),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            V+E ++ +  L+ELWLGRNRIR +NLCGL  I K+S+QSNRLTSM G EEC+ALEELYLS
Sbjct  158  VLEGIENMKRLEELWLGRNRIRTVNLCGLTSIVKLSLQSNRLTSMLGFEECLALEELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGL+TLVNLRVLDVS+N+LT+I+++ NL KLEDLWLNDNNI S++ I   ++G
Sbjct  218  HNGISKMEGLATLVNLRVLDVSSNRLTSIADVENLEKLEDLWLNDNNIPSLDGIETILSG  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
              Q L+T+YLERNPCA+  +Y++ L    P + Q+DS + 
Sbjct  278  PRQSLSTIYLERNPCASDSSYVNKLIAALPKLGQIDSRVL  317


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEE-CVALEELYLSHNGI  569
            +L  LQEL L  N++ R   + GL  +    +  N LTS+ G+ + C  L ELYLS N I
Sbjct  75   SLFGLQELVLRDNKLTRLPPVGGLSELVVFDVSFNELTSLDGMNKVCSKLRELYLSKNEI  134

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME L  +  LR+L++ +N++  +  I N+ +LE+LWL  N I +V
Sbjct  135  VKMEQLEHMQELRLLELGSNRIRVLEGIENMKRLEELWLGRNRIRTV  181



>ref|XP_002992834.1| hypothetical protein SELMODRAFT_187027 [Selaginella moellendorffii]
 gb|EFJ06124.1| hypothetical protein SELMODRAFT_187027 [Selaginella moellendorffii]
Length=317

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 128/160 (80%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            V+E ++ +  L+ELWLGRNRIR +NLCGL  I K+S+Q+NRLTSM G EEC+ALEELYLS
Sbjct  158  VLEGIENMKRLEELWLGRNRIRTVNLCGLTSIVKLSLQNNRLTSMLGFEECLALEELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGL+TLVNLRVLDVS+N+LT+I+++ NL KLEDLWLNDNNI S++ I   ++G
Sbjct  218  HNGISKMEGLATLVNLRVLDVSSNRLTSIADVENLEKLEDLWLNDNNIPSLDGIETILSG  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
              Q L+T+YLERNPCA+  +Y++ L    P + Q+DS + 
Sbjct  278  PRQSLSTIYLERNPCASDSSYVNKLIAALPKLGQIDSRVL  317


 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEE-CVALEELYLSHNGI  569
            +L  LQEL L  N++ R   + GL  +    +  N LTS+ G+ + C  L ELYLS N I
Sbjct  75   SLFGLQELVLRDNKLTRLPPVGGLSELVVFDVSFNELTSLDGMNKVCSKLRELYLSKNEI  134

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME L  +  LR+L++ +N++  +  I N+ +LE+LWL  N I +V
Sbjct  135  VKMEQLEHMQELRLLELGSNRIRVLEGIENMKRLEELWLGRNRIRTV  181



>ref|XP_001766453.1| predicted protein [Physcomitrella patens]
 gb|EDQ68781.1| predicted protein [Physcomitrella patens]
Length=319

 Score =   209 bits (531),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 125/160 (78%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME L  L  LQ+LWLGRNRI+++NLCGL  + KIS+QSNRL+SM   +ECV L ELYLS
Sbjct  158  VMEGLDQLKELQQLWLGRNRIQSVNLCGLTGLLKISVQSNRLSSMAVFQECVNLTELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  MEGLSTL NLRVLD+++NK+T ISN+  LT+LEDLWLNDN++++++DI   + G
Sbjct  218  HNQISVMEGLSTLQNLRVLDLASNKITDISNLEKLTRLEDLWLNDNSVATLDDIEMKLEG  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
                LTT+YLERNPCA+ PNYI T+R I P +QQ+DS L 
Sbjct  278  CKNSLTTIYLERNPCAHDPNYIRTMRAILPKLQQLDSHLL  317


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/106 (36%), Positives = 62/106 (58%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEE-CVALEELYLSHNGIE  566
            L++L+EL L  N++  I  L  L  +  + +  N+++SM G+     +L ELYLS N I 
Sbjct  76   LSDLKELVLRDNKLLKIPELSNLVNLTLLDVSYNKVSSMNGMSAISSSLTELYLSKNEIG  135

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+E +  L  LRVL++ +N++  +  +  L +L+ LWL  N I SV
Sbjct  136  KIEEIEHLTRLRVLELGSNRIRVMEGLDQLKELQQLWLGRNRIQSV  181



>ref|XP_001772164.1| predicted protein [Physcomitrella patens]
 gb|EDQ62977.1| predicted protein [Physcomitrella patens]
Length=358

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 123/160 (77%), Gaps = 0/160 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VME L  L  LQ+LWLGRNRI+++NLCGL  + KIS+Q+NRLTSM   ++CV L ELYLS
Sbjct  197  VMERLDQLKELQQLWLGRNRIQSVNLCGLTGLLKISVQNNRLTSMAAFQDCVNLTELYLS  256

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  MEGLSTL NLRVLD+S+NK+T ISN+  L +LEDLWLNDN+ISS++DI   +AG
Sbjct  257  HNHISVMEGLSTLQNLRVLDLSSNKITEISNLEELIRLEDLWLNDNSISSLDDIEMKLAG  316

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
                LTT+YLERNPCA  P Y+ T+R I P +QQ+DS L 
Sbjct  317  CKNSLTTIYLERNPCALDPKYMRTMRAILPKLQQLDSHLL  356


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 65/109 (60%), Gaps = 6/109 (6%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAINLCGLKCIKKI---SIQSNRLTSMKGLEECVA-LEELYLSHN  575
            TL  L+EL L  N++  + + GL    ++    +  N+++SM GL +  + L ELYLS+N
Sbjct  114  TLKGLKELVLRDNKL--LKIPGLSTFVELLLLDVSFNKVSSMNGLSDVSSSLTELYLSNN  171

Query  574  GIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             IEK+  +  L NLRVL++ +NK+  +  +  L +L+ LWL  N I SV
Sbjct  172  EIEKIVEMEHLTNLRVLELGSNKIRVMERLDQLKELQQLWLGRNRIQSV  220


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 36/109 (33%), Positives = 64/109 (59%), Gaps = 8/109 (7%)
 Frame = -1

Query  730  LQELWLGRNRIRAIN--LCGLKCIKKISIQSN-----RLTSMKGLEECVALEELYLSHNG  572
            L+EL L  NR+ +I+  +  L  ++K+S + N      LT          L+EL L  N 
Sbjct  68   LEELDLTANRLTSIDPRISNLSHLQKLSFEQNLLADSALTEFNQFTTLKGLKELVLRDNK  127

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANL-TKLEDLWLNDNNISSV  428
            + K+ GLST V L +LDVS NK+++++ ++++ + L +L+L++N I  +
Sbjct  128  LLKIPGLSTFVELLLLDVSFNKVSSMNGLSDVSSSLTELYLSNNEIEKI  176



>gb|KJB83107.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=289

 Score =   194 bits (493),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/154 (62%), Positives = 123/154 (80%), Gaps = 7/154 (5%)
 Frame = -1

Query  736  TNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM  560
            + L+EL++ +N +  +  +  L  ++ + + SNRL       ECVALEELYLSHNGI KM
Sbjct  142  STLKELYVSKNEVTKMEEIDHLHELQILELGSNRL------RECVALEELYLSHNGISKM  195

Query  559  EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT  380
            EGLSTLVNLRVLDVS+NKLT+++++ NLT+LEDLWLNDN I S+E +AEAV+GS +KLTT
Sbjct  196  EGLSTLVNLRVLDVSSNKLTSVNDVQNLTRLEDLWLNDNQIESLESVAEAVSGSREKLTT  255

Query  379  LYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            +YLE NPCA SPNY +TLRQIFPNI+Q+DS +FA
Sbjct  256  VYLENNPCAKSPNYQATLRQIFPNIEQIDSSIFA  289



>emb|CDY44436.1| BnaC07g24740D [Brassica napus]
Length=297

 Score =   189 bits (480),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVALEELYLS
Sbjct  167  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALEELYLS  226

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EAV G
Sbjct  227  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEAVEG  286

Query  400  S  398
            S
Sbjct  287  S  287


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  83   DALSDLEELILRDNKLAEVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNE  142

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L  + N+ +LTKLE+LWL  N I  V
Sbjct  143  VNKIMEIEHLHDLQILELGSNRLWVMVNMESLTKLEELWLGRNRIKVV  190



>ref|XP_009147161.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Brassica 
rapa]
Length=239

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVAL ELYLS
Sbjct  104  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALAELYLS  163

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EAV G
Sbjct  164  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEAVEG  223

Query  400  S  398
            S
Sbjct  224  S  224


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 51/78 (65%), Gaps = 1/78 (1%)
 Frame = -1

Query  658  ISIQSNRLTSMKGLEECVA-LEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIA  482
              +  N +TS++GL +  + L+ELY+S N + K+  +  L +L++L++ +N+L  + N+ 
Sbjct  50   FDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILELGSNRLRVMVNME  109

Query  481  NLTKLEDLWLNDNNISSV  428
            +LTKLE+LWL  N I  V
Sbjct  110  SLTKLEELWLGRNRIKVV  127



>ref|XP_009102238.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Brassica rapa]
Length=309

 Score =   185 bits (469),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVAL ELYLS
Sbjct  174  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALAELYLS  233

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDV  NKLT++ +I +LTKLEDLWLNDN I  +E I EAV G
Sbjct  234  HNGISKMEGLSALVNLRVLDVLNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEAVEG  293

Query  400  S  398
            S
Sbjct  294  S  294


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N + 
Sbjct  92   LSDLEELILRDNKLAEVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVY  151

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L +L++L++ +N+L  + N+ +LTKLE+LWL  N I  V
Sbjct  152  KIMEIEYLHDLQILELGSNRLRVMVNMESLTKLEELWLGRNRIKVV  197



>emb|CDY17937.1| BnaC04g02820D [Brassica napus]
Length=335

 Score =   182 bits (463),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVALEELYLS
Sbjct  108  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALEELYLS  167

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EA
Sbjct  168  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEA  224


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 66/106 (62%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N + 
Sbjct  26   LSDLEELILRDNKLAEVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVN  85

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L +L++L++ +N+L  + N+ +LTKLE+LWL  N I  V
Sbjct  86   KIMEIEHLHDLQILELGSNRLWVMVNMESLTKLEELWLGRNRIKVV  131



>emb|CDY42421.1| BnaC02g22870D [Brassica napus]
Length=394

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVALEELYLS
Sbjct  167  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALEELYLS  226

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EA
Sbjct  227  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEA  283


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  83   DALSDLEELILRDNKLAEVPDISIFSRVLVFDVSFNEITSLEGLSKASSTLKELYVSKNE  142

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L+ + N+ +LTKLE+LWL  N I  V
Sbjct  143  VNKIMEIEHLHDLQILELGSNRLSVMVNMESLTKLEELWLGRNRIKVV  190



>emb|CDY47338.1| BnaCnng14750D [Brassica napus]
Length=394

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVALEELYLS
Sbjct  167  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALEELYLS  226

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EA
Sbjct  227  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEA  283


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  83   DALSDLEELILRDNKLAEVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNE  142

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L  + N+ +LTKLE+LWL  N I  V
Sbjct  143  VNKIMEIEHLHDLQILELGSNRLWVMVNMESLTKLEELWLGRNRIKVV  190



>emb|CDX89753.1| BnaC03g46670D [Brassica napus]
Length=394

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVALEELYLS
Sbjct  167  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALEELYLS  226

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EA
Sbjct  227  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEA  283


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  83   DALSDLEELILRDNKLAEVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNE  142

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L  + N+ +LTKLE+LWL  N I  V
Sbjct  143  VNKIMEIEHLHDLQILELGSNRLWVMVNMESLTKLEELWLGRNRIKVV  190



>emb|CDX87941.1| BnaC03g54550D [Brassica napus]
Length=394

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVALEELYLS
Sbjct  167  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALEELYLS  226

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EA
Sbjct  227  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEA  283


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  83   DALSDLEELILRDNKLAEVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNE  142

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            + K+  +  L +L++L++ +N+L  + N+ +LTKLE+LWL  N I  V
Sbjct  143  VNKIMEIEHLHDLQILELGSNRLWVMVNMESLTKLEELWLGRNRIKVV  190



>gb|EMS46865.1| Protein phosphatase 1 regulatory subunit pprA [Triticum urartu]
Length=285

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/154 (57%), Positives = 116/154 (75%), Gaps = 7/154 (5%)
 Frame = -1

Query  736  TNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM  560
            + ++EL+  +N +  +  L     ++ + + SNRL       ECVALEELYLSHNGI+KM
Sbjct  138  STVKELYFSKNEVPKMEELEHFHALELLELGSNRL------RECVALEELYLSHNGIQKM  191

Query  559  EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT  380
            EGLS L NLRVLDVS+NKLTAI +I  LT+LEDLWLNDN I S+  I  A++GS +KLTT
Sbjct  192  EGLSMLQNLRVLDVSSNKLTAIEDIEPLTRLEDLWLNDNQIPSLSGIESALSGSREKLTT  251

Query  379  LYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            +YLERNPCA +PNY STL++IFPN++Q+DS++ A
Sbjct  252  IYLERNPCAKTPNYSSTLKEIFPNLEQIDSDMLA  285



>gb|EMT13288.1| Protein phosphatase 1 regulatory subunit pprA [Aegilops tauschii]
Length=285

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 116/154 (75%), Gaps = 7/154 (5%)
 Frame = -1

Query  736  TNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM  560
            + ++EL+  +N +  +  L     ++ + + SNRL       ECVALEELYLSHNGI+KM
Sbjct  138  STVKELYFSKNEVPKMEELEHFHALELLELGSNRL------RECVALEELYLSHNGIQKM  191

Query  559  EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTT  380
            EGLS L NLRVLDVS+NKLTAI +I  LT+LEDLWLNDN I S+  I  A++GS +KLTT
Sbjct  192  EGLSMLQNLRVLDVSSNKLTAIEDIEPLTRLEDLWLNDNQIPSLSGIESALSGSREKLTT  251

Query  379  LYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
            +YLERNPCA +PNY STL+++FPN++Q+DS++ A
Sbjct  252  IYLERNPCAKTPNYSSTLKEMFPNLEQIDSDMLA  285



>ref|XP_008791675.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X2 [Phoenix dactylifera]
Length=267

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VMENLQTL NLQELWLGRNRIR +NLCGLKCI+KIS+QSNRLTSM G +EC+ALEELYLS
Sbjct  169  VMENLQTLKNLQELWLGRNRIRMVNLCGLKCIRKISLQSNRLTSMTGFQECIALEELYLS  228

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL  467
            HNGI+KMEGL+TLVNLR+LDVS+NKLTAI++I NLT+ 
Sbjct  229  HNGIQKMEGLATLVNLRILDVSSNKLTAINDIENLTRF  266


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = -1

Query  742  TLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECV-ALEELYLSHNGI  569
            T++ L+EL L  N++R I ++   K +    +  N ++S+ GL +    LEELY+S N +
Sbjct  86   TISGLRELVLRDNKLREIPDVSIFKTLLVFDVSFNEISSLNGLSKISNTLEELYVSKNEV  145

Query  568  EKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
             KME L  L  LR+L++ +N+L  + N+  L  L++LWL  N I  V
Sbjct  146  TKMEELEHLDALRILELGSNRLRVMENLQTLKNLQELWLGRNRIRMV  192



>ref|XP_005646296.1| L domain-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21752.1| L domain-like protein [Coccomyxa subellipsoidea C-169]
Length=329

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 116/164 (71%), Gaps = 6/164 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            M  L+ LTNLQELWLGRNRI  I+ L  L  ++K+S+QSNRL SM GL+ C  LEELYLS
Sbjct  165  MTGLEGLTNLQELWLGRNRIAEISGLNSLTALRKLSVQSNRLMSMAGLQHCSQLEELYLS  224

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI+++EGL +L NLRVLDVS+N+++ ++ +  LT+L DLWLNDN I+S+ D+  A  G
Sbjct  225  HNGIQRLEGLESLPNLRVLDVSSNQVSDLTGLEALTQLTDLWLNDNAITSLGDLVAAAGG  284

Query  400  SL-QKLTTLYLERNPCANSPN----YISTLRQIFPNIQQVDSEL  284
             +   LT LYL  NP A +      Y + + ++FP +QQ+D +L
Sbjct  285  PMGGSLTCLYLSGNPAAETAGGHAAYRAAVVRMFPKLQQLDDQL  328


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/119 (29%), Positives = 68/119 (57%), Gaps = 5/119 (4%)
 Frame = -1

Query  730  LQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEE--CVALEELYLSHNGIEKM  560
            L+EL L  N I  I  +     ++++ +  N++ S++ L       L +LY+++N ++K+
Sbjct  84   LKELVLHDNHIEEIPEMEDFTSLQRLELSYNQIQSLQPLLSLGSTVLSDLYVANNAVQKI  143

Query  559  EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT  383
            E +    NLR+L++ +NK+  ++ +  LT L++LWL  N I+ +  +    A  L+KL+
Sbjct  144  EAVQQFTNLRMLELGSNKIREMTGLEGLTNLQELWLGRNRIAEISGLNSLTA--LRKLS  200



>ref|XP_002947065.1| hypothetical protein VOLCADRAFT_103293 [Volvox carteri f. nagariensis]
 gb|EFJ51655.1| hypothetical protein VOLCADRAFT_103293 [Volvox carteri f. nagariensis]
Length=363

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+E + +LT LQELWLGRNRI  ++ L  L  +++IS+QSNRLTSM GLE C ALEELYL
Sbjct  162  VIEGIASLTGLQELWLGRNRITNVDGLTTLVNLRRISLQSNRLTSMLGLEACTALEELYL  221

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAI--SNIANLTKLEDLWLNDNNISSVEDIAEA  410
            SHNGI  +EGL  L  L++LDVS+N+LTA+  S +A LT+LEDLWLNDN I +++   + 
Sbjct  222  SHNGIATLEGLGPLTRLKILDVSSNRLTAVDPSALATLTQLEDLWLNDNRIPAIDAALDR  281

Query  409  VAGSLQK-LTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            V   ++  LT +YLE NP A+ P Y   L  + P ++Q+D+   
Sbjct  282  VLDPVRHSLTCIYLEGNPAASDPQYKRKLVNMLPKLKQLDANFL  325



>ref|XP_001700674.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO97912.1| predicted protein [Chlamydomonas reinhardtii]
Length=315

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 115/164 (70%), Gaps = 4/164 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN++TLT L+ELWLGRNRI  ++ L  L  +++IS+QSNRLTSM GLE C +LEELYL
Sbjct  152  AIENIETLTGLRELWLGRNRIAKVDGLATLTNLRRISLQSNRLTSMSGLEHCTSLEELYL  211

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLT--AISNIANLTKLEDLWLNDNNISSVE-DIAE  413
            SHNGI  +EGL+ L  L++LDVS+N++T   ++++  LT+LEDLWLNDN + +++  + +
Sbjct  212  SHNGISTLEGLAPLGRLKILDVSSNRITQLHVADLVALTQLEDLWLNDNQLPAIDAALDK  271

Query  412  AVAGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            A+      LT +YLE NP A  P Y   L  + P ++Q+DS   
Sbjct  272  ALDPVRHSLTCIYLEGNPAAQDPQYKRKLTNMLPKLKQLDSNFL  315



>gb|KIY98793.1| Protein phosphatase 1 regulatory subunit 7 [Monoraphidium neglectum]
Length=341

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/160 (50%), Positives = 110/160 (69%), Gaps = 1/160 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+    L ELWLGRNR+ R   L  L  + ++S+QSNRL SM GLE C +LEELYLS
Sbjct  178  VEGLEAQGALVELWLGRNRLERVQGLGHLTNLVRLSLQSNRLDSMLGLEGCTSLEELYLS  237

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI K++GL TL  L+VLDVS+N+LTA+ N+ +L++LEDLWLNDN I +++ +  A+A 
Sbjct  238  HNGILKLKGLDTLTRLKVLDVSSNRLTAVDNLGSLSRLEDLWLNDNQIPTLDGLDTALAS  297

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
              + LTT+YL  NP A  P Y   L  + P + Q+D ++ 
Sbjct  298  QRESLTTVYLHGNPAAGDPRYKEKLLALLPRLAQLDDKVL  337



>ref|XP_009125770.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Brassica rapa]
Length=280

 Score =   155 bits (393),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 73/98 (74%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVAL ELYLS
Sbjct  174  VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALAELYLS  233

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKL  467
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTK+
Sbjct  234  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKV  271


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = -1

Query  739  LTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIE  566
            L++L++L L  N++  + ++     +    +  N +TS +GL +  + L+ELY+S N + 
Sbjct  92   LSDLEKLILRDNKLAEVPDISIFSRLLVFDVSFNEITSCEGLSKASSTLKELYVSKNEVY  151

Query  565  KMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
            K+  +  L +L++L++ +N+L  + N+ +LTKLE+LWL  N I  V
Sbjct  152  KIMEIEYLHDLQILELGSNRLRVMVNMESLTKLEELWLGRNRIKVV  197



>emb|CDY71037.1| BnaUnng04160D [Brassica napus]
Length=229

 Score =   151 bits (381),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 91/121 (75%), Gaps = 15/121 (12%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+                SN+LTSMKG E+CVALEELYLS
Sbjct  114  VMVNMESLTKLEELWLGRNRIKV---------------SNQLTSMKGFEDCVALEELYLS  158

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGI KMEGLS LVNLRVLDVS NKLT++ +I +LTKLEDLWLNDN I  +E I EAV G
Sbjct  159  HNGISKMEGLSALVNLRVLDVSNNKLTSVDDIQSLTKLEDLWLNDNQIEILEAITEAVEG  218

Query  400  S  398
            S
Sbjct  219  S  219


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/145 (30%), Positives = 78/145 (54%), Gaps = 19/145 (13%)
 Frame = -1

Query  745  QTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNG  572
              L++L+EL L  N++  + ++     +    +  N +TS++GL +  + L+ELY+S N 
Sbjct  24   DALSDLEELILRDNKLAEVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSTNE  83

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAIS------NIANLTKLEDLWLNDNNI------SSV  428
            + K+  +  L +L++L++ +N+L   S      N+ +LTKLE+LWL  N I      +S+
Sbjct  84   VNKIMEIEHLHDLQILELGSNRLWVYSFIHVMVNMESLTKLEELWLGRNRIKVSNQLTSM  143

Query  427  EDIAEAVAGSLQKLTTLYLERNPCA  353
            +   + VA     L  LYL  N  +
Sbjct  144  KGFEDCVA-----LEELYLSHNGIS  163



>ref|XP_005844814.1| hypothetical protein CHLNCDRAFT_56306 [Chlorella variabilis]
 gb|EFN52712.1| hypothetical protein CHLNCDRAFT_56306 [Chlorella variabilis]
Length=319

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 107/162 (66%), Gaps = 3/162 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAINLC--GLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            +E L  L  LQELWLGRNRI  +  C   L  ++++S+QSNRLTSM GL+ C ALEELYL
Sbjct  159  LEGLSQLGLLQELWLGRNRIAELGDCLSSLHNLRRLSLQSNRLTSMAGLQHCTALEELYL  218

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE++EGL  LVNL++LDV+ N++  I N+  L +L DLW NDN I S++++  A+ 
Sbjct  219  SHNGIEQLEGLDRLVNLKILDVANNRIQRIGNLGVL-QLTDLWANDNQIGSLDEVEAALK  277

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
                 ++ +YL  NPCA   +Y   ++   P ++Q+D    A
Sbjct  278  SQRGSMSCVYLRGNPCAAGTDYKLRMKFTLPRLEQLDDSPVA  319



>gb|KJB10119.1| hypothetical protein B456_001G184800, partial [Gossypium raimondii]
Length=174

 Score =   144 bits (363),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/97 (73%), Positives = 82/97 (85%), Gaps = 0/97 (0%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            V+ENLQ  T LQELWLGRN+I+ INLCGL CIKKIS+QSN+LTSM GLEEC ALEE+YLS
Sbjct  78   VIENLQNFTKLQELWLGRNQIKVINLCGLSCIKKISLQSNQLTSMIGLEECNALEEIYLS  137

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTK  470
            HNGI KM  LS LVNL+VLDVS+NKLT+  +I  LT+
Sbjct  138  HNGIAKMGDLSKLVNLQVLDVSSNKLTSFDDIQYLTR  174


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 61/101 (60%), Gaps = 2/101 (2%)
 Frame = -1

Query  724  ELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVA-LEELYLSHNGIEKMEGL  551
            EL L  N++  I ++   K +    +  N +TS++GL +  + ++ELY+S N + KME +
Sbjct  1    ELILRDNKLTKIPDVVIFKKLLVFDVSFNEITSLQGLSKASSTIKELYVSKNEVTKMEEI  60

Query  550  STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSV  428
              L  L++L++ ++KL  I N+ N TKL++LWL  N I  +
Sbjct  61   DHLHELQILELGSHKLRVIENLQNFTKLQELWLGRNQIKVI  101



>ref|XP_009526623.1| hypothetical protein PHYSODRAFT_502348 [Phytophthora sojae]
 gb|EGZ17565.1| hypothetical protein PHYSODRAFT_502348 [Phytophthora sojae]
Length=342

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +E L+ LT L++LWLG+N+I AI  L  L  +K IS+QSNR+T +KGL+  +ALEELYL
Sbjct  175  TIEGLEGLTELEQLWLGKNKITAIQGLEKLAKLKIISVQSNRVTVIKGLDNNLALEELYL  234

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAV  407
            SHNGIEK+E +  L NL  +D++ N+++AI + +A LT+LED WLNDN+++   D+   V
Sbjct  235  SHNGIEKIENVEHLTNLTTMDLAGNRISAIPTGLAPLTQLEDFWLNDNHVAHYADVEHLV  294

Query  406  AGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               L  L TLYLERNP A    Y   L ++ P + Q+D+
Sbjct  295  P--LAGLRTLYLERNPIAQDFEYRKKLEELLPELDQIDA  331


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/114 (36%), Positives = 69/114 (61%), Gaps = 1/114 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            M ++ TLT L+ L L  N+I+AI  L  L  +K + +  N +  +  L     LEELY++
Sbjct  88   MASVATLTRLEHLELYDNQIQAIEGLTSLTGLKVLDLSFNEIRVIPDLSHLTQLEELYVA  147

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
            +N ++K+ G+ +L  L+ LD+ AN+L  I  +  LT+LE LWL  N I++++ +
Sbjct  148  NNKLKKISGIESLKTLKKLDLGANRLRTIEGLEGLTELEQLWLGKNKITAIQGL  201


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            L  ++++ ++SN L SM  +     LE L L  N I+ +EGL++L  L+VLD+S N++  
Sbjct  72   LAGLQRLHVRSNLLRSMASVATLTRLEHLELYDNQIQAIEGLTSLTGLKVLDLSFNEIRV  131

Query  496  ISNIANLTKLEDLWLNDNNISSVEDI  419
            I ++++LT+LE+L++ +N +  +  I
Sbjct  132  IPDLSHLTQLEELYVANNKLKKISGI  157



>gb|ESA15010.1| hypothetical protein GLOINDRAFT_346276 [Rhizophagus irregularis 
DAOM 181602]
Length=346

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L NL++LWLG+N+I    NL  L+ +K +SIQSNRLT +KGLE  V LEE+Y+
Sbjct  184  VIENLDKLVNLEQLWLGKNKITEFQNLENLRNLKILSIQSNRLTQIKGLEGLVNLEEIYM  243

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGI+K+EG    + LRV+DVS N LT I NI++LT+LE+ W N+N  S  E++     
Sbjct  244  SHNGIQKIEGFENNLKLRVIDVSNNLLTKIENISHLTELEEFWANNNQFSDFEELP-VQM  302

Query  403  GSLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
            G L+KL T+YLE NP    N   Y   ++ + P I Q+D+
Sbjct  303  GHLKKLNTIYLEGNPMQTENQAIYRLKVKTLLPQISQLDA  342


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            ++ +++L +L+EL L  NRI  I NL     +K + +  N++  ++ LE    L  LY  
Sbjct  97   IDGIESLKDLEELDLYDNRISYIENLNNFPELKFLDLSFNKIRVIENLEHLTKLVNLYFV  156

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             N I K++ L  L+N+  L++ ANK+  I N+  L  LE LWL  N I+  +++
Sbjct  157  QNRISKIQNLDNLINVTNLELGANKIRVIENLDKLVNLEQLWLGKNKITEFQNL  210


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = -1

Query  700  IRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLD  521
            I ++ L     IK + ++ N +T + G+E    LEEL L  N I  +E L+    L+ LD
Sbjct  73   ITSLMLDRFPKIKSLCVRQNLVTKIDGIESLKDLEELDLYDNRISYIENLNNFPELKFLD  132

Query  520  VSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
            +S NK+  I N+ +LTKL +L+   N IS ++++
Sbjct  133  LSFNKIRVIENLEHLTKLVNLYFVQNRISKIQNL  166



>gb|EXX51280.1| Sds22p [Rhizophagus irregularis DAOM 197198w]
Length=351

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 108/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L NL++LWLG+N+I    NL  L+ +K +SIQSNRLT +KGLE  V LEE+Y+
Sbjct  184  VIENLDKLVNLEQLWLGKNKITEFQNLENLRNLKILSIQSNRLTQIKGLEGLVNLEEIYM  243

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGI+K+EG    + LRV+DVS N LT I NI++LT+LE+ W N+N  S  E++     
Sbjct  244  SHNGIQKIEGFENNLKLRVIDVSNNLLTKIENISHLTELEEFWANNNQFSDFEELP-VQM  302

Query  403  GSLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
            G L+KL T+YLE NP    N   Y   ++ + P I Q+D+
Sbjct  303  GHLKKLNTIYLEGNPMQTENQAIYRLKVKTLLPQISQLDA  342


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            ++ +++L +L+EL L  NRI  I NL     +K + +  N++  ++ LE    L  LY  
Sbjct  97   IDGIESLKDLEELDLYDNRISYIENLNNFPELKFLDLSFNKIRVIENLEHLTKLVNLYFV  156

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             N I K++ L  L+N+  L++ ANK+  I N+  L  LE LWL  N I+  +++
Sbjct  157  QNRISKIQNLDNLINVTNLELGANKIRVIENLDKLVNLEQLWLGKNKITEFQNL  210


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 54/94 (57%), Gaps = 0/94 (0%)
 Frame = -1

Query  700  IRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLD  521
            I ++ L     IK + ++ N +T + G+E    LEEL L  N I  +E L+    L+ LD
Sbjct  73   ITSLMLDRFPKIKSLCVRQNLVTKIDGIESLKDLEELDLYDNRISYIENLNNFPELKFLD  132

Query  520  VSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
            +S NK+  I N+ +LTKL +L+   N IS ++++
Sbjct  133  LSFNKIRVIENLEHLTKLVNLYFVQNRISKIQNL  166



>gb|EUC54575.1| protein phosphatase 1 regulatory subunit 7 [Rhizoctonia solani 
AG-3 Rhs1AP]
 gb|KEP52197.1| protein phosphatase 1 regulatory subunit 7 [Rhizoctonia solani 
123E]
Length=1176

 Score =   149 bits (376),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 69/159 (43%), Positives = 109/159 (69%), Gaps = 4/159 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+ L NL+ELWLG+N+I  +  L  LK ++ +SIQSNR+T ++GLEE  +LEE Y+S
Sbjct  222  IEGLEGLGNLEELWLGKNKITKLQGLETLKALRVLSIQSNRITKLEGLEELTSLEEFYIS  281

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNG+ K+EGL   + LR LDV+ N +TA+  +++L++LE+ W +DN I+++ D+   + G
Sbjct  282  HNGLSKIEGLEKNLKLRTLDVTGNTITAVEGLSHLSELEEFWASDNQIATLNDLGHELGG  341

Query  400  SLQKLTTLYLERNPCANSPN--YISTLRQIFPNIQQVDS  290
             ++  TT+YLERNPC  +    Y   +    P +QQ+D+
Sbjct  342  -IKSFTTIYLERNPCERNDQVGYRRKIMLALPQVQQIDA  379



>ref|XP_011399381.1| Protein phosphatase 1 regulatory subunit pprA [Auxenochlorella 
protothecoides]
 gb|KFM26449.1| Protein phosphatase 1 regulatory subunit pprA [Auxenochlorella 
protothecoides]
Length=285

 Score =   140 bits (353),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 99/160 (62%), Gaps = 1/160 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+ +  L  LWLGRNRI  IN L  L  + ++S+QSNRL  + GL  C ALEELYLS
Sbjct  123  IEGLEGMCLLDSLWLGRNRITQINGLSSLSRLIRLSLQSNRLARISGLSGCTALEELYLS  182

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNG+  +EGL  L NLR+LDV+ N+LT+++ +    +L DLW NDN ++S+++    +  
Sbjct  183  HNGLTTLEGLEGLANLRILDVANNRLTSLAGLQGFPQLTDLWANDNQLASLDEAGAELEH  242

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
                LT LYL  NPCA    Y   L    PN++Q+D  + 
Sbjct  243  VRDSLTCLYLGGNPCAKETQYRLRLEHTLPNLEQLDDSVL  282


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/117 (31%), Positives = 58/117 (50%), Gaps = 7/117 (6%)
 Frame = -1

Query  697  RAINLCGLKCIKKISIQSNRLTSMKGLEECVA--LEELYLSHNGIEKMEGLSTLVNLRVL  524
            R  N  G   +  + +  N+  S++ L       L  LY + N I  MEG++ L +LRVL
Sbjct  54   RVPNFRGFFSLTNLDMSYNQFVSLEALSSLPGPRLTHLYCAANKIASMEGIAHLESLRVL  113

Query  523  DVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERNPCA  353
            D+ +N+L  I  +  +  L+ LWL  N I+ +  ++     SL +L  L L+ N  A
Sbjct  114  DLGSNRLRCIEGLEGMCLLDSLWLGRNRITQINGLS-----SLSRLIRLSLQSNRLA  165



>emb|CDY39147.1| BnaA07g01430D [Brassica napus]
Length=115

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 83/121 (69%), Gaps = 26/121 (21%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            VM N+++LT L+ELWLGRNRI+ +NLCGL+CIKKIS+QSN+LTSMKG E+CVALEELYLS
Sbjct  11   VMVNMESLTKLEELWLGRNRIKVVNLCGLRCIKKISLQSNQLTSMKGFEDCVALEELYLS  70

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN                          + +I +LTKLEDLWLNDN I  +E I EAV G
Sbjct  71   HN--------------------------VDDIQSLTKLEDLWLNDNQIEILEAITEAVEG  104

Query  400  S  398
            S
Sbjct  105  S  105



>emb|CEL55522.1| hypothetical protein RSOLAG1IB_01534 [Rhizoctonia solani AG-1 
IB]
Length=394

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 108/160 (68%), Gaps = 4/160 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +E L+ L  L+ELWLG+N+I  +  L  LK ++ +SIQSNR+T ++GLEE   LEE Y+
Sbjct  229  TIEGLEGLGKLEELWLGKNKIATLQGLETLKSLRVLSIQSNRITKLEGLEELTNLEEFYI  288

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+ K+EGL   + LR  DVS N +TA+ N+++L++LE+ W +DN I+++ D+ E   
Sbjct  289  SHNGLNKIEGLEKNLKLRTFDVSGNTITAVENLSHLSELEEFWASDNQIATLNDL-EREL  347

Query  403  GSLQKLTTLYLERNPCA--NSPNYISTLRQIFPNIQQVDS  290
            G ++ L+T+YLERNPC   +   Y   +    P ++Q+D+
Sbjct  348  GGIKTLSTIYLERNPCEKDDPTGYRRKIMLALPQVKQIDA  387



>emb|CCA21457.1| protein phosphatase 1 regulatory subunit putative [Albugo laibachii 
Nc14]
Length=310

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 108/159 (68%), Gaps = 5/159 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            ++E L  L NL++LWLG+N+I  +  L  L  ++ +SIQSNRL  M+G+++   L+ELYL
Sbjct  150  LIEGLDHLENLEQLWLGKNKIEKMEGLEHLNSLRILSIQSNRLVEMEGMDQLTNLKELYL  209

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAV  407
            SHN IE ++ +  L+NL +LDV ANK+T I ++IA L +L+DLWLNDN I  +ED+    
Sbjct  210  SHNAIETLKNMENLINLEILDVGANKITRIPTDIAFLVELQDLWLNDNMIEQLEDVNNVK  269

Query  406  AGSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            A    K+TTLYLERNP +   NY   +  + P ++Q+D+
Sbjct  270  A---LKMTTLYLERNPVSKDENYRQKVIDMLPKLEQLDA  305


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (54%), Gaps = 1/112 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            M+ +++L +L  L L  NRI+ I  L  L  ++ + +  N +  +  +     L EL+++
Sbjct  63   MDEVESLRSLVHLELYDNRIKVIPCLDELVNLQVLDLSFNEIRVLPDMSHLPQLRELFVA  122

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE  425
             N +  + G+S L  L+ LD+ AN++  I  + +L  LE LWL  N I  +E
Sbjct  123  SNKLVTITGISKLSGLKKLDLGANRIRLIEGLDHLENLEQLWLGKNKIEKME  174



>gb|ETM45543.1| hypothetical protein L914_09442 [Phytophthora parasitica]
Length=353

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L  LT L+ELWLG+N+I AI  L  L  +K +S+QSNR+  + G E  V LEELYLS
Sbjct  187  IEGLDGLTELRELWLGKNKITAIQGLEKLTKLKIVSVQSNRVVKITGFENNVELEELYLS  246

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            HNGIEK+E +  L  L  +D++ N++T I S +A L +LEDLWLNDN I+   D+   V 
Sbjct  247  HNGIEKIENVEHLTKLTTMDLAGNRITNIPSTLAPLAQLEDLWLNDNQIAQYADVEHLVP  306

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              L  L TLYLERNP A    Y   L ++ P + Q+D+
Sbjct  307  --LAGLRTLYLERNPLAQDFEYRKKLEELLPELDQIDA  342


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = -1

Query  718  WLGRNRIRAINLCGLKCIK---KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS  548
            ++G   ++   L GL+ +    K+ ++SN L SM  +   V LE L L  N I+ +EG+ 
Sbjct  66   YVGTVGVKITELDGLENLPNLLKLHVRSNMLQSMASVASLVQLEHLELYDNQIQTLEGVQ  125

Query  547  TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             LVNL+VLD+S N++  I ++++LTKLE+L++ +N +  +  I
Sbjct  126  NLVNLKVLDLSFNEIRVIPDLSHLTKLEELYVANNKLKKISGI  168


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 15/131 (11%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI----NLCGLKCIKKISIQSNRLTSMKGLEECVALEEL  590
            M ++ +L  L+ L L  N+I+ +    NL  LK +    +  N +  +  L     LEEL
Sbjct  99   MASVASLVQLEHLELYDNQIQTLEGVQNLVNLKVL---DLSFNEIRVIPDLSHLTKLEEL  155

Query  589  YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            Y+++N ++K+ G+  L  L+ LD+ AN+L  I  +  LT+L +LWL  N I++++     
Sbjct  156  YVANNKLKKISGIENLTTLKKLDLGANRLRTIEGLDGLTELRELWLGKNKITAIQ-----  210

Query  409  VAGSLQKLTTL  377
                L+KLT L
Sbjct  211  ---GLEKLTKL  218



>gb|ETL92238.1| hypothetical protein L917_09407 [Phytophthora parasitica]
 gb|ETO74389.1| hypothetical protein F444_09865 [Phytophthora parasitica P1976]
 gb|ETP43633.1| hypothetical protein F442_09672 [Phytophthora parasitica P10297]
Length=353

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L  LT L+ELWLG+N+I AI  L  L  +K +S+QSNR+  + G E  V LEELYLS
Sbjct  187  IEGLDGLTELRELWLGKNKITAIQGLEKLTKLKIVSVQSNRVVKITGFENNVELEELYLS  246

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            HNGIEK+E +  L  L  +D++ N++T I S +A L +LEDLWLNDN I+   D+   V 
Sbjct  247  HNGIEKIENVEHLTKLTTMDLAGNRITNIPSTLAPLAQLEDLWLNDNQIAQYADVEHLVP  306

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              L  L TLYLERNP A    Y   L ++ P + Q+D+
Sbjct  307  --LAGLRTLYLERNPLAQDFEYRKKLEELLPELDQIDA  342


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = -1

Query  718  WLGRNRIRAINLCGLKCIK---KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS  548
            ++G   ++   L GL+ +    K+ ++SN L SM  +   V LE L L  N I+ +EG+ 
Sbjct  66   YVGTAGVKITELDGLENLPNLLKLHVRSNMLQSMASVASLVQLEHLELYDNQIQTLEGVQ  125

Query  547  TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             LVNL+VLD+S N++  I ++++LTKLE+L++ +N +  +  I
Sbjct  126  NLVNLKVLDLSFNEIRVIPDLSHLTKLEELYVANNKLKKISGI  168


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 15/131 (11%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI----NLCGLKCIKKISIQSNRLTSMKGLEECVALEEL  590
            M ++ +L  L+ L L  N+I+ +    NL  LK +    +  N +  +  L     LEEL
Sbjct  99   MASVASLVQLEHLELYDNQIQTLEGVQNLVNLKVL---DLSFNEIRVIPDLSHLTKLEEL  155

Query  589  YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            Y+++N ++K+ G+  L  L+ LD+ AN+L  I  +  LT+L +LWL  N I++++     
Sbjct  156  YVANNKLKKISGIENLTTLKKLDLGANRLRTIEGLDGLTELRELWLGKNKITAIQ-----  210

Query  409  VAGSLQKLTTL  377
                L+KLT L
Sbjct  211  ---GLEKLTKL  218



>gb|ETI45747.1| hypothetical protein F443_09768 [Phytophthora parasitica P1569]
 gb|ETK85696.1| hypothetical protein L915_09573 [Phytophthora parasitica]
 gb|ETL39125.1| hypothetical protein L916_09474 [Phytophthora parasitica]
 gb|ETP15570.1| hypothetical protein F441_09707 [Phytophthora parasitica CJ01A1]
Length=353

 Score =   140 bits (352),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L  LT L+ELWLG+N+I AI  L  L  +K +S+QSNR+  + G E  V LEELYLS
Sbjct  187  IEGLDGLTELRELWLGKNKITAIQGLEKLTKLKIVSVQSNRVVKITGFENNVELEELYLS  246

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            HNGIEK+E +  L  L  +D++ N++T I S +A L +LEDLWLNDN I+   D+   V 
Sbjct  247  HNGIEKIENVEHLTKLTTMDLAGNRITNIPSTLAPLAQLEDLWLNDNQIAQYADVEHLVP  306

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              L  L TLYLERNP A    Y   L ++ P + Q+D+
Sbjct  307  --LAGLRTLYLERNPLAQDFEYRKKLEELLPELDQIDA  342


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = -1

Query  718  WLGRNRIRAINLCGLKCIK---KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS  548
            ++G   ++   L GL+ +    K+ ++SN L SM  +   V LE L L  N I+ +EG+ 
Sbjct  66   YVGTAGVKITELDGLENLPNLLKLHVRSNMLQSMASVASLVQLEHLELYDNQIQTLEGVQ  125

Query  547  TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             LVNL+VLD+S N++  I ++++LTKLE+L++ +N +  +  I
Sbjct  126  NLVNLKVLDLSFNEIRVIPDLSHLTKLEELYVANNKLKKISGI  168


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 15/131 (11%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI----NLCGLKCIKKISIQSNRLTSMKGLEECVALEEL  590
            M ++ +L  L+ L L  N+I+ +    NL  LK +    +  N +  +  L     LEEL
Sbjct  99   MASVASLVQLEHLELYDNQIQTLEGVQNLVNLKVL---DLSFNEIRVIPDLSHLTKLEEL  155

Query  589  YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            Y+++N ++K+ G+  L  L+ LD+ AN+L  I  +  LT+L +LWL  N I++++     
Sbjct  156  YVANNKLKKISGIENLTTLKKLDLGANRLRTIEGLDGLTELRELWLGKNKITAIQ-----  210

Query  409  VAGSLQKLTTL  377
                L+KLT L
Sbjct  211  ---GLEKLTKL  218



>gb|KDQ14279.1| hypothetical protein BOTBODRAFT_174788 [Botryobasidium botryosum 
FD-172 SS1]
Length=433

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 76/174 (44%), Positives = 113/174 (65%), Gaps = 4/174 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL  L NL+ELWLG+N+I  + NL  L  ++ +SIQSNR+T ++GLE  V LE+ Y+S
Sbjct  242  IENLDALVNLEELWLGKNKITKLENLSTLGRLRILSIQSNRITKLEGLENLVNLEDFYIS  301

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNG+E++EGL   + L+ LDV  N + AI NI++LT+LE+LW+N+N I +V D+   + G
Sbjct  302  HNGVERLEGLENNLKLQTLDVGHNSIPAIENISHLTRLEELWINNNVIPNVHDLTPQL-G  360

Query  400  SLQKLTTLYLERNPC--ANSPNYISTLRQIFPNIQQVDSELFA**VILSQKPLI  245
             +  L T+YLE NPC   +   Y   +    P +QQ+D++      I S  PL+
Sbjct  361  HIATLKTIYLEGNPCQREDMSGYRRKIILALPQVQQIDAKYVIHSYISSPSPLL  414



>ref|XP_002837094.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81285.1| unnamed protein product [Tuber melanosporum]
Length=359

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 111/159 (70%), Gaps = 4/159 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+  LT LQELWLG+N+I  + NL  LK ++ +SIQSNRLTS+ GL+E  +LEELY+S
Sbjct  197  IENIGHLTALQELWLGKNKITELKNLSTLKNLRILSIQSNRLTSITGLDELTSLEELYIS  256

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN +  + GL T  NLRVLD+S N++  ++N+A+L  LE+LW ++N ++S E+I + + G
Sbjct  257  HNALTSIAGLDTNKNLRVLDISNNQIAQLANLAHLPHLEELWASNNKLASFEEIEQELGG  316

Query  400  SLQKLTTLYLERNPCAN--SPNYISTLRQIFPNIQQVDS  290
             L++L T+Y E NP     +  Y + ++   P I+Q+D+
Sbjct  317  -LEELVTVYFEGNPLMREAAAGYRTKIKLALPRIKQIDA  354


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 60/106 (57%), Gaps = 1/106 (1%)
 Frame = -1

Query  730  LQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEG  554
            L +L L  N I  I+ L  L  ++ + +  N L  +K +     L+ LY   N I ++EG
Sbjct  118  LVDLDLYDNHIAHIHGLEDLANLENLDLSFNNLKHIKRISHLAKLQNLYFVQNRISRIEG  177

Query  553  LSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L  L  LR L++ AN++  I NI +LT L++LWL  N I+ +++++
Sbjct  178  LEGLAVLRNLELGANRIREIENIGHLTALQELWLGKNKITELKNLS  223



>ref|XP_008332239.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Cynoglossus 
semilaevis]
 ref|XP_008332240.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Cynoglossus 
semilaevis]
Length=345

 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL TL++LQ L+LG N+I  + NL GL  +  +SIQSNR+T M+GL+  V L ELYL
Sbjct  185  VIENLDTLSSLQSLFLGTNKITKLQNLEGLHNLTVLSIQSNRITKMEGLQNLVNLRELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  245  SHNGIEIIEGLENNKKLTTLDIAANRIKKIENISHLTELQEFWMNDNQIDNWSDLDE--L  302

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  303  KNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  340


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 77/133 (58%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L +L+EL L  N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  98   IENLDSLNSLRELDLYDNQIRKLENLHNLTELEQLDVSFNILRKVEGLEKLTQLKKLFLL  157

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  +     L +L++ +N++  I N+  L+ L+ L+L  N I+ ++++      
Sbjct  158  HNKITTIGNVDHFTVLEMLELGSNRIRVIENLDTLSSLQSLFLGTNKITKLQNLE-----  212

Query  400  SLQKLTTLYLERN  362
             L  LT L ++ N
Sbjct  213  GLHNLTVLSIQSN  225


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 73/140 (52%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+ L   + L L +N I+ I NL  L  ++++ +  N++  ++ L     LE+L +S
Sbjct  76   IEGLEVLQKAKTLSLRQNLIKKIENLDSLNSLRELDLYDNQIRKLENLHNLTELEQLDVS  135

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N + K+EGL  L  L+ L +  NK+T I N+ + T LE L L  N I  +E++      
Sbjct  136  FNILRKVEGLEKLTQLKKLFLLHNKITTIGNVDHFTVLEMLELGSNRIRVIENL-----D  190

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L  N      N
Sbjct  191  TLSSLQSLFLGTNKITKLQN  210



>emb|CCM04306.1| predicted protein [Fibroporia radiculosa]
Length=372

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/159 (48%), Positives = 105/159 (66%), Gaps = 4/159 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL  L NLQELWLG+N+I  + NL  LK +K +SIQSNR+T ++GLE    LEELYLS
Sbjct  204  IENLDALVNLQELWLGKNKIVKLENLGSLKRLKILSIQSNRITKLEGLEGLDDLEELYLS  263

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE++EGL     LRVLDV  N + A+ N+++ T L +LW+NDN I ++ D  E    
Sbjct  264  HNGIERLEGLEKNTKLRVLDVGNNFVKALENLSHSTTLGELWINDNRIDTL-DTLEPQLK  322

Query  400  SLQKLTTLYLERNPCANSP--NYISTLRQIFPNIQQVDS  290
             ++ L T+YLERNP   S   NY   +    P ++Q+D+
Sbjct  323  HVETLRTIYLERNPVQASEGVNYRRKVMLALPQVEQLDA  361



>ref|XP_008892784.1| hypothetical protein PPTG_01292 [Phytophthora parasitica INRA-310]
 gb|ETN20937.1| hypothetical protein PPTG_01292 [Phytophthora parasitica INRA-310]
Length=353

 Score =   138 bits (347),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 101/158 (64%), Gaps = 4/158 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L  LT L+ELWLG+N+I AI  L  L  +K +S+QSNR+  + G E  V LEELYLS
Sbjct  187  IEGLDGLTELRELWLGKNKITAIQGLEKLTKLKIVSVQSNRVVKITGFENNVELEELYLS  246

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            HNGIEK+E +  L  L  +D++ N++T I S +A L +LEDLWLNDN I+   D+   V 
Sbjct  247  HNGIEKIENVEHLTKLTTMDLAGNRITNIPSTLAPLAQLEDLWLNDNQIAQYADVEHLVP  306

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              L  L TLYLERNP A    Y   L ++ P + ++D+
Sbjct  307  --LAGLRTLYLERNPLAQDFEYRKKLEELLPELDKIDA  342


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = -1

Query  718  WLGRNRIRAINLCGLKCIK---KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS  548
            ++G   ++   L GL+ +    K+ ++SN L SM  +   V LE L L  N I+ +EG+ 
Sbjct  66   YVGTAGVKITELDGLENLPNLLKLHVRSNMLQSMASVASLVQLEHLELYDNQIQTLEGVQ  125

Query  547  TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             LVNL+VLD+S N++  I ++++LTKLE+L++ +N +  +  I
Sbjct  126  NLVNLKVLDLSFNEIRVIPDLSHLTKLEELYVANNKLKKISGI  168


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 71/131 (54%), Gaps = 15/131 (11%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI----NLCGLKCIKKISIQSNRLTSMKGLEECVALEEL  590
            M ++ +L  L+ L L  N+I+ +    NL  LK +    +  N +  +  L     LEEL
Sbjct  99   MASVASLVQLEHLELYDNQIQTLEGVQNLVNLKVL---DLSFNEIRVIPDLSHLTKLEEL  155

Query  589  YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEA  410
            Y+++N ++K+ G+  L  L+ LD+ AN+L  I  +  LT+L +LWL  N I++++     
Sbjct  156  YVANNKLKKISGIENLTTLKKLDLGANRLRTIEGLDGLTELRELWLGKNKITAIQ-----  210

Query  409  VAGSLQKLTTL  377
                L+KLT L
Sbjct  211  ---GLEKLTKL  218



>ref|XP_008616913.1| hypothetical protein SDRG_12616 [Saprolegnia diclina VS20]
 gb|EQC29609.1| hypothetical protein SDRG_12616 [Saprolegnia diclina VS20]
Length=342

 Score =   137 bits (346),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/157 (48%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+ L NL++LWLG+N+I AI  L  L  ++ +SIQSNRL ++  L   VALEELYLS
Sbjct  180  IEGLEGLENLEQLWLGKNKITAIQGLDALAKLRVMSIQSNRLLAIDNLSANVALEELYLS  239

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +  L  L  L +LDV AN++ +I  +     LEDLWLNDN ISS +DI    + 
Sbjct  240  HNGIEALANLGHLTKLTILDVGANRIKSIPPMGANVALEDLWLNDNEISSFDDIQHLASN  299

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            S  KL TLYLERNP A+   Y   ++    ++QQ+D+
Sbjct  300  S--KLETLYLERNPLASDFEYRLKIQGALASVQQIDA  334


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 71/108 (66%), Gaps = 4/108 (4%)
 Frame = -1

Query  727  QELW-LGRNRIRAINLCGLKC---IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKM  560
            +E++ +G   ++A  L GL+    ++++ ++SN L  M G+E  V L  L L  N I+KM
Sbjct  55   EEIYHVGTAGLKARVLDGLEAMVQLRELHVRSNLLYKMTGIESLVNLTHLELYDNQIKKM  114

Query  559  EGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
             GL  LV LRVLD+S N++ +I ++++LT+LE+L++ +N ++ +  IA
Sbjct  115  VGLEKLVKLRVLDLSFNEIRSIPDLSHLTQLEELYVANNKLTHITGIA  162


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 71/133 (53%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRA-INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            M  +++L NL  L L  N+I+  + L  L  ++ + +  N + S+  L     LEELY++
Sbjct  92   MTGIESLVNLTHLELYDNQIKKMVGLEKLVKLRVLDLSFNEIRSIPDLSHLTQLEELYVA  151

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            +N +  + G++ L  L  LD+ AN++  I  +  L  LE LWL  N I++++ +      
Sbjct  152  NNKLTHITGIANLRTLVKLDLGANRIRTIEGLEGLENLEQLWLGKNKITAIQGL-----D  206

Query  400  SLQKLTTLYLERN  362
            +L KL  + ++ N
Sbjct  207  ALAKLRVMSIQSN  219



>emb|CAG07637.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=281

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  LT+LQ L+LG N+I  + NL GL  +  +SIQSNR+T ++GL+  ++L+ELYL
Sbjct  121  VIENLDGLTSLQSLFLGTNKITKLQNLDGLHNLTILSIQSNRITKLEGLQNLISLKELYL  180

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  181  SHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTELQEFWMNDNQIDNWSDLDE--L  238

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  239  KNAKSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  276


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 78/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +LT+L+EL L  N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  34   IENLDSLTSLRELDLYDNQIRKLENLHHLPELEQLDVSFNILRKVEGLEQLTRLKKLFLL  93

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L     L +L++ +N++  I N+  LT L+ L+L  N I+ ++++      
Sbjct  94   HNKISSIANLDHFKCLEMLELGSNRIRVIENLDGLTSLQSLFLGTNKITKLQNL-----D  148

Query  400  SLQKLTTLYLERN  362
             L  LT L ++ N
Sbjct  149  GLHNLTILSIQSN  161


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/90 (37%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = -1

Query  679  GLKCIKK---ISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN  509
            GL+ ++K   +S++ N L  ++ L+   +L EL L  N I K+E L  L  L  LDVS N
Sbjct  14   GLEVLRKAKTLSLRQNLLKKIENLDSLTSLRELDLYDNQIRKLENLHHLPELEQLDVSFN  73

Query  508  KLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             L  +  +  LT+L+ L+L  N ISS+ ++
Sbjct  74   ILRKVEGLEQLTRLKKLFLLHNKISSIANL  103



>ref|XP_001637000.1| predicted protein [Nematostella vectensis]
 gb|EDO44937.1| predicted protein [Nematostella vectensis]
Length=310

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 106/160 (66%), Gaps = 3/160 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+E L+ LT L+ L++G+N+I  + NL GL  +K +SIQSNR+  +KGLE   +LEELY+
Sbjct  151  VLEGLEHLTKLESLFVGKNKITELQNLSGLCSLKVLSIQSNRIVELKGLEHLDSLEELYI  210

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE+++GL +L  L  LD+++N++  ISN+ +L  LE+ W NDN +   ED+ E   
Sbjct  211  SHNGIEEIKGLESLTKLNTLDLASNRIKRISNVGHLLNLEEFWFNDNQLEHWEDLDE--L  268

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSEL  284
                KL T+YLERNP +    Y   ++   P ++Q+D+ L
Sbjct  269  AKCPKLHTVYLERNPLSRDTAYRRKVKLALPALKQIDATL  308


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 1/102 (1%)
 Frame = -1

Query  727  QELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGL  551
            +++ L   RI  I N   L+C+K + ++ N +  ++ LE   +LEEL    N I K+E L
Sbjct  30   EDVDLTHGRIDKIQNFERLRCVKSLCLRRNEIKKLENLETLTSLEELDFYDNQISKIENL  89

Query  550  STLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE  425
              LVNLR+LD+S N +  I N+ +LTKLE L+L  N I  +E
Sbjct  90   DRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLVQNKIGRIE  131


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/115 (35%), Positives = 71/115 (62%), Gaps = 1/115 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL+TLT+L+EL    N+I  I NL  L  ++ + +  N +  ++ L     LE+LYL 
Sbjct  64   LENLETLTSLEELDFYDNQISKIENLDRLVNLRILDLSFNVIKVIENLNSLTKLEKLYLV  123

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
             N I ++EGL  L  L ++++ ANK+  +  + +LTKLE L++  N I+ +++++
Sbjct  124  QNKIGRIEGLEHLTELTMVELGANKIRVLEGLEHLTKLESLFVGKNKITELQNLS  178



>ref|XP_002899652.1| protein phosphatase 1 regulatory subunit, putative [Phytophthora 
infestans T30-4]
 gb|EEY62012.1| protein phosphatase 1 regulatory subunit, putative [Phytophthora 
infestans T30-4]
Length=332

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 100/158 (63%), Gaps = 4/158 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L  LT L+ELWLG+N+I  I  L  L  +K IS+QSNR+  + G      LEELYLS
Sbjct  166  IEGLDGLTELKELWLGKNKITTIQGLEKLAKLKIISVQSNRVVKISGFATNFELEELYLS  225

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            HNGIEK+E +  L +L  +D + N++T I + +A LT+LEDLWLNDN I+   D+   + 
Sbjct  226  HNGIEKIENVDHLTHLTTMDFAGNRITNIPTTLAALTQLEDLWLNDNQIAQYADVEHLM-  284

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             SL  L TLYLERNP A    Y   L ++ P + Q+D+
Sbjct  285  -SLSGLRTLYLERNPLAQDFEYRKKLEELLPELDQIDA  321


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 68/115 (59%), Gaps = 7/115 (6%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI----NLCGLKCIKKISIQSNRLTSMKGLEECVALEEL  590
            M ++ +L +L+ L L  N+I+ +    NL  LK +    +  N +  +  L     LEEL
Sbjct  78   MASVASLVHLEHLELYDNQIQTLEGVQNLVNLKVL---DLSFNEIRVIPDLNHLTKLEEL  134

Query  589  YLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE  425
            Y+++N ++K+ G+ TL  L+ LD+ AN+L  I  +  LT+L++LWL  N I++++
Sbjct  135  YVANNKLKKISGIETLTTLKKLDLGANRLRTIEGLDGLTELKELWLGKNKITTIQ  189


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 62/103 (60%), Gaps = 3/103 (3%)
 Frame = -1

Query  718  WLGRNRIRAINLCGLKCIK---KISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS  548
            ++G   ++   L GL  +    ++ ++SN L SM  +   V LE L L  N I+ +EG+ 
Sbjct  45   YVGTAGVKITELDGLGSLPNLMRLHVRSNLLQSMASVASLVHLEHLELYDNQIQTLEGVQ  104

Query  547  TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             LVNL+VLD+S N++  I ++ +LTKLE+L++ +N +  +  I
Sbjct  105  NLVNLKVLDLSFNEIRVIPDLNHLTKLEELYVANNKLKKISGI  147



>ref|XP_003978239.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Takifugu 
rubripes]
Length=312

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L++LQ L+LG N+I  + NL GL  +  +SIQSNR+T ++GL+  V+L+ELYL
Sbjct  152  VIENLDALSSLQSLFLGTNKITKLQNLDGLHNLTVLSIQSNRITKLEGLQNLVSLKELYL  211

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LD++AN++  I NI +LT+L++ W+NDN I +  D+ E   
Sbjct  212  SHNGIEVIEGLENNKKLTTLDIAANRIKRIENIGHLTELQEFWMNDNQIDNWSDLDE--L  269

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  270  KNARSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  307


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +LT+L+EL L  N+IR + NL  L  ++++ +  N L  ++GLE+  +L++L+L 
Sbjct  65   IENLDSLTSLRELDLYDNQIRKLENLHQLTELEQLDVSFNILRKVEGLEQLTSLKKLFLL  124

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L     L +L++ +N++  I N+  L+ L+ L+L  N I+ ++++      
Sbjct  125  HNKISGIANLDHFTCLEMLELGSNRIRVIENLDALSSLQSLFLGTNKITKLQNL-----D  179

Query  400  SLQKLTTLYLERN  362
             L  LT L ++ N
Sbjct  180  GLHNLTVLSIQSN  192


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+ L   + L L +N I+ I NL  L  ++++ +  N++  ++ L +   LE+L +S
Sbjct  43   IEGLEVLQKAKTLSLRQNLIKKIENLDSLTSLRELDLYDNQIRKLENLHQLTELEQLDVS  102

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N + K+EGL  L +L+ L +  NK++ I+N+ + T LE L L  N I  +E++      
Sbjct  103  FNILRKVEGLEQLTSLKKLFLLHNKISGIANLDHFTCLEMLELGSNRIRVIENL-----D  157

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L  N      N
Sbjct  158  ALSSLQSLFLGTNKITKLQN  177



>ref|XP_011274445.1| hypothetical protein BN7_3294 [Wickerhamomyces ciferrii]
 emb|CCH43740.1| hypothetical protein BN7_3294 [Wickerhamomyces ciferrii]
Length=350

 Score =   137 bits (344),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/159 (47%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL  L NL+ELWLG+N+I R  NL  L+ +K +SIQSNR+T ++GLE  V LEELY+S
Sbjct  189  IENLDKLENLEELWLGKNKIPRFENLNPLRNLKILSIQSNRITKLEGLENLVNLEELYVS  248

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIEK+EGL     L  LD+++N++T + N+++LT+L DLW + N ISS  D  E    
Sbjct  249  HNGIEKIEGLENNKKLTTLDITSNRITDLENLSHLTELTDLWASSNKISSF-DQVEKELK  307

Query  400  SLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
             L++L T+Y E NP    N  +Y   L    P +Q++D+
Sbjct  308  DLKQLDTVYFEGNPLQLQNPTSYRRKLIMFLPQVQKIDA  346



>gb|EAW71245.1| protein phosphatase 1, regulatory subunit 7, isoform CRA_c [Homo 
sapiens]
Length=171

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  11   AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  70

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  71   SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  130

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  131  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  166



>gb|ABQ22781.1| phosphatase 1 regulatory subunit 7 protein-like protein [Callithrix 
jacchus]
Length=173

 Score =   132 bits (331),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  13   AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  72

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  73   SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  132

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  133  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  168



>ref|XP_002125791.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like isoform 
X2 [Ciona intestinalis]
Length=331

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +E L+TL NLQEL+LG+N+I  I NL  LK +K +++ SNR+T ++GL+    LEELY+
Sbjct  167  AIEGLETLKNLQELYLGKNKITTIGNLSELKNLKILALMSNRITKIEGLDALTNLEELYM  226

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHN IEK+EGL    NL+ LDV+ NK+T + N+++L++LE+ W NDN I    D+ E   
Sbjct  227  SHNAIEKIEGLENNTNLQTLDVAGNKITRVENLSHLSELEEFWANDNKIHDWNDMDE--L  284

Query  403  GSLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
                KL T+YLE NP   +++  Y   L  I PN++Q+D+
Sbjct  285  KKCPKLITVYLEHNPLQTSHATQYRRRLMAIMPNLKQIDA  324


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 72/133 (54%), Gaps = 11/133 (8%)
 Frame = -1

Query  748  LQTLTNLQELWLGRNRIRAINLCGLKCIKK----ISIQSNRLTSMKGLEECVALEELYLS  581
             + L  ++EL L  N ++ I   GL C+      + +  NR+  ++ LE+ V LE L LS
Sbjct  60   FERLKKVEELCLRNNLLKQIQ--GLGCLASTLTSLDLYDNRIKKIENLEDLVLLESLDLS  117

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  LV L+ + +  NK T I N+++LT L  L L DN I ++E +      
Sbjct  118  FNLMRTIEGLENLVKLKKIYLLTNKFTKIQNLSHLTSLTMLELGDNRIRAIEGLE-----  172

Query  400  SLQKLTTLYLERN  362
            +L+ L  LYL +N
Sbjct  173  TLKNLQELYLGKN  185



>ref|XP_010205344.1| PREDICTED: protein phosphatase 1 regulatory subunit 7, partial 
[Colius striatus]
Length=215

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+  L+NL  L+LG+N+I  + NL  L  +  +SIQ+NRLT M+GL+  V L ELYL
Sbjct  55   VIENIDALSNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKMEGLQSLVNLRELYL  114

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++NK+  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  115  SHNGIEVIEGLENNNKLTMLDIASNKIKKIENISHLTELQEFWMNDNLVESWSDLDELKG  174

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  175  A--KNLETVYLERNPLQKDPQYRRKIVLALPSVRQIDA  210



>ref|XP_010741941.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Larimichthys 
crocea]
Length=345

 Score =   135 bits (341),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL TL++LQ L+LG N+I  + NL GL  +  +SIQSNR+T ++GL+  ++L ELYL
Sbjct  185  VIENLDTLSSLQSLFLGTNKITKLQNLEGLHNLTVLSIQSNRITKIEGLQNLLSLRELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LD++AN++  I NI++LT L++ W+NDN I +  D+ E   
Sbjct  245  SHNGIEVIEGLENNKKLTTLDIAANRIKKIENISHLTDLQEFWMNDNQIDNWSDLDE--L  302

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  303  KNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  340


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 42/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +LT+L+EL L  N+IR + NL  L  ++++ +  N L  ++GLE+   +++L+L 
Sbjct  98   IENLDSLTSLRELDLYDNQIRKLENLHHLTELEQLDVSFNILRRVEGLEQLTQVKKLFLL  157

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  + +L++ +N++  I N+  L+ L+ L+L  N I+ ++++      
Sbjct  158  HNKISSIANLEHLTGVEMLELGSNRIRVIENLDTLSSLQSLFLGTNKITKLQNLE-----  212

Query  400  SLQKLTTLYLERN  362
             L  LT L ++ N
Sbjct  213  GLHNLTVLSIQSN  225



>ref|XP_004225569.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like isoform 
X1 [Ciona intestinalis]
Length=333

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 107/160 (67%), Gaps = 5/160 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +E L+TL NLQEL+LG+N+I  I NL  LK +K +++ SNR+T ++GL+    LEELY+
Sbjct  169  AIEGLETLKNLQELYLGKNKITTIGNLSELKNLKILALMSNRITKIEGLDALTNLEELYM  228

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHN IEK+EGL    NL+ LDV+ NK+T + N+++L++LE+ W NDN I    D+ E   
Sbjct  229  SHNAIEKIEGLENNTNLQTLDVAGNKITRVENLSHLSELEEFWANDNKIHDWNDMDE--L  286

Query  403  GSLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
                KL T+YLE NP   +++  Y   L  I PN++Q+D+
Sbjct  287  KKCPKLITVYLEHNPLQTSHATQYRRRLMAIMPNLKQIDA  326


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 46/133 (35%), Positives = 72/133 (54%), Gaps = 11/133 (8%)
 Frame = -1

Query  748  LQTLTNLQELWLGRNRIRAINLCGLKCIKK----ISIQSNRLTSMKGLEECVALEELYLS  581
             + L  ++EL L  N ++ I   GL C+      + +  NR+  ++ LE+ V LE L LS
Sbjct  62   FERLKKVEELCLRNNLLKQIQ--GLGCLASTLTSLDLYDNRIKKIENLEDLVLLESLDLS  119

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  LV L+ + +  NK T I N+++LT L  L L DN I ++E +      
Sbjct  120  FNLMRTIEGLENLVKLKKIYLLTNKFTKIQNLSHLTSLTMLELGDNRIRAIEGLE-----  174

Query  400  SLQKLTTLYLERN  362
            +L+ L  LYL +N
Sbjct  175  TLKNLQELYLGKN  187



>ref|XP_005050840.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Ficedula albicollis]
Length=350

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TL NL  L+LG+N+I  + NL  L  +  +SIQ+NRLT M+GL+  V L ELYL
Sbjct  190  VIENIDTLANLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKMEGLQSLVNLRELYL  249

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN I S  D+ E + 
Sbjct  250  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLIESWSDLDE-LK  308

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  309  GA-KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  345


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  81   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLESLVDLEVLDIS  140

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N++NL  L+ L L  N I  +E+I      
Sbjct  141  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSNLQMLQMLELGSNRIRVIENI-----D  195

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  196  TLANLDSLFLGKNKITKLQN  215



>ref|XP_006000404.1| PREDICTED: LOW QUALITY PROTEIN: protein phosphatase 1 regulatory 
subunit 7 [Latimeria chalumnae]
Length=331

 Score =   135 bits (340),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TLT L  L+LG N+I  + NL GL  +  +SIQSNR+T ++GL+  + L ELY+
Sbjct  171  VIENIDTLTKLDSLFLGNNKIPKLQNLDGLTNLTVLSIQSNRITKIEGLQSLLNLRELYI  230

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L  LD++ANK+  I NI++LT+LE+ W+NDN I +  D+ E   
Sbjct  231  SHNGIEVIEGLESNKKLTTLDIAANKVKKIENISHLTELEEFWMNDNLIENWSDLDE--L  288

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + +KL T+YLERNP    P Y   +    P+++Q+D+
Sbjct  289  KNAKKLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  326



>ref|XP_009087555.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Serinus canaria]
Length=314

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  154  VIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  213

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  214  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLVESWSDLDE-LK  272

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  273  GA-KNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  309


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  45   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLEALVDLEVLDIS  104

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N+++L  L+ L L  N I  +E+I      
Sbjct  105  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSSLQTLQMLELGSNRIRVIENI-----D  159

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  160  TLTNLDSLFLGKNKITKLQN  179



>emb|CCI49593.1| unnamed protein product [Albugo candida]
Length=311

 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 103/158 (65%), Gaps = 5/158 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L  L NL++LWLG+N+I  I  L  L  ++ +SIQSNRL  ++GL +   L ELYLS
Sbjct  152  IEGLDQLENLEQLWLGKNKIEKIEKLECLNSLRILSIQSNRLVDIEGLNQLSNLTELYLS  211

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAI-SNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            HNGI+ ++ L  L  L +LDV AN++  I SNIA L  LEDLWLNDN I   +D+     
Sbjct  212  HNGIDTLKNLENLTKLEILDVGANEIIKIPSNIARLVNLEDLWLNDNKIERFDDVENLEP  271

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
                KLTTLYLERNP + + NY   + ++ PN++Q+D+
Sbjct  272  ---LKLTTLYLERNPVSKAENYRQKVIEMLPNLEQLDA  306


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/114 (31%), Positives = 62/114 (54%), Gaps = 1/114 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            M  +++L +L  L L  NRI++I+ L  L  ++ + +  N +  +  L +   L ELY++
Sbjct  64   MAGVESLKSLIHLELYDNRIKSISCLNELVNLQVLDLSFNEIRVLPDLSQLSQLRELYVA  123

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             N +  + G++ L  L+ LD+ AN++  I  +  L  LE LWL  N I  +E +
Sbjct  124  SNKLVAITGINRLSGLKKLDMGANRIRRIEGLDQLENLEQLWLGKNKIEKIEKL  177


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 64/103 (62%), Gaps = 3/103 (3%)
 Frame = -1

Query  718  WLGRNRIRAINLCGLKCIKKISI---QSNRLTSMKGLEECVALEELYLSHNGIEKMEGLS  548
            ++G +  +   L GL+ ++K+ I   +SN L+SM G+E   +L  L L  N I+ +  L+
Sbjct  31   YVGTSGQKVTQLNGLERMQKLKILQVRSNLLSSMAGVESLKSLIHLELYDNRIKSISCLN  90

Query  547  TLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
             LVNL+VLD+S N++  + +++ L++L +L++  N + ++  I
Sbjct  91   ELVNLQVLDLSFNEIRVLPDLSQLSQLRELYVASNKLVAITGI  133



>ref|XP_005050838.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Ficedula albicollis]
Length=355

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TL NL  L+LG+N+I  + NL  L  +  +SIQ+NRLT M+GL+  V L ELYL
Sbjct  195  VIENIDTLANLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKMEGLQSLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN I S  D+ E + 
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLIESWSDLDE-LK  313

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  314  GA-KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  350


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLESLVDLEVLDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N++NL  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSNLQMLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLANLDSLFLGKNKITKLQN  220



>ref|XP_005050839.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Ficedula albicollis]
Length=355

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TL NL  L+LG+N+I  + NL  L  +  +SIQ+NRLT M+GL+  V L ELYL
Sbjct  195  VIENIDTLANLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKMEGLQSLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN I S  D+ E + 
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLIESWSDLDE-LK  313

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  314  GA-KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  350


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLESLVDLEVLDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N++NL  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSNLQMLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLANLDSLFLGKNKITKLQN  220



>ref|XP_002113851.1| hypothetical protein TRIADDRAFT_26327 [Trichoplax adhaerens]
 gb|EDV24325.1| hypothetical protein TRIADDRAFT_26327, partial [Trichoplax adhaerens]
Length=279

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 105/160 (66%), Gaps = 3/160 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  Q L NL  L+LGRN+I +   +C L+ +K +SIQ NR+ S+ GL E V LEELY+S
Sbjct  121  IEGFQNLQNLTSLYLGRNKIASFEGICCLRGLKTLSIQCNRIESLLGLSELVNLEELYVS  180

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             NGI+ +EGL  L  L +LDV+AN+++ I N+ +LT LE+LW+N+N +    D+ E    
Sbjct  181  DNGIKTIEGLENLTKLTILDVAANRISKIQNLGHLTLLEELWMNNNQVQDWNDVKE--LD  238

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELF  281
            + +K+ T+YLE NP A+ P Y   L+   P++ Q+D+ L 
Sbjct  239  NCKKIKTIYLEANPIASDPMYRRKLKLALPSLTQIDATLI  278


 Score = 64.3 bits (155),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 46/139 (33%), Positives = 76/139 (55%), Gaps = 18/139 (13%)
 Frame = -1

Query  715  LGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLV  539
            +  +R++ I NL  L+ ++K+ ++ N +  ++ ++    L EL L  N +EK+E + TLV
Sbjct  3    IANSRLKKIENLDRLRRVEKLCLRQNLIKRIEAIDMLTTLTELDLYDNQLEKIENIDTLV  62

Query  538  NLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA---------------EAVA  404
            NLR LD+S N +  I N+    K+EDL+L +N I  +E++                  + 
Sbjct  63   NLRQLDLSFNGIKKIENLHQQDKVEDLYLCNNRIKVIENLENLKELKMLELGSNKIRKIE  122

Query  403  G--SLQKLTTLYLERNPCA  353
            G  +LQ LT+LYL RN  A
Sbjct  123  GFQNLQNLTSLYLGRNKIA  141


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/114 (32%), Positives = 64/114 (56%), Gaps = 1/114 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E +  LT L EL L  N++  I N+  L  ++++ +  N +  ++ L +   +E+LYL 
Sbjct  33   IEAIDMLTTLTELDLYDNQLEKIENIDTLVNLRQLDLSFNGIKKIENLHQQDKVEDLYLC  92

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDI  419
            +N I+ +E L  L  L++L++ +NK+  I    NL  L  L+L  N I+S E I
Sbjct  93   NNRIKVIENLENLKELKMLELGSNKIRKIEGFQNLQNLTSLYLGRNKIASFEGI  146



>ref|XP_009688823.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Struthio 
camelus australis]
 ref|XP_009688824.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Struthio 
camelus australis]
Length=292

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLDSLFLGKNKITKLQNLDALTNLSVLSIQSNRLTKIEGLQSLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  287


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N ++ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLVKRIENLEQLQTLRELDLYDNQIRKIENLEALAELEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N + ++EGL  L  L+ L +  NK+  I N++NL +L+ L L  N I ++E+I      
Sbjct  83   FNVLRQIEGLDRLTQLKKLFLVNNKIGKIENLSNLQQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLDSLFLGKNKITKLQN  157



>emb|CCA71895.1| probable SDS22-protein phosphatase 1, regulatory subunit 7 [Piriformospora 
indica DSM 11827]
Length=337

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 109/162 (67%), Gaps = 4/162 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L NL+ELWLG+N+I  + NL  L  ++ +SIQSNR+T ++GLE+ V LEELY+
Sbjct  174  VIENLDALVNLEELWLGKNKITKLENLDKLVKLRLLSIQSNRITRIEGLEKLVNLEELYM  233

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+EK+EGL   V L  LDV  N +TA+ N+++L+ L++ W + N I+ ++ I + + 
Sbjct  234  SHNGLEKIEGLENNVKLTTLDVGNNMITAVENVSHLSDLQEFWASYNQIADIKTIDKELG  293

Query  403  GSLQKLTTLYLERNPCANS--PNYISTLRQIFPNIQQVDSEL  284
            G L KL T+YLE NP   +   NY   L    P ++Q+D+ L
Sbjct  294  G-LAKLETVYLEGNPAQRTDMANYRRRLIIALPQLKQIDATL  334



>ref|XP_005721607.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Pundamilia 
nyererei]
Length=285

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL +LT+LQ L+LG N+I R  NL  L  +  +SIQSNR+T ++GL+  + L+ELYL
Sbjct  125  VIENLDSLTSLQSLFLGTNKITRLQNLDALHNLTVLSIQSNRITKIEGLQNLINLKELYL  184

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  185  SHNGVEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIDNWSDLDELKN  244

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             +   L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  245  AT--SLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  280


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L+ L+EL    N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  38   IENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDMSFNVLRKVEGLEQLTRLKKLFLL  97

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  L +L++ +N++  I N+ +LT L+ L+L  N I+ ++++      
Sbjct  98   HNKISSIANLEHLAGLEMLELGSNRIRVIENLDSLTSLQSLFLGTNKITRLQNL-----D  152

Query  400  SLQKLTTLYLERN  362
            +L  LT L ++ N
Sbjct  153  ALHNLTVLSIQSN  165



>ref|XP_007939645.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Orycteropus afer afer]
Length=317

 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 104/157 (66%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL  L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  158  IENIDTLTNLDSLFLGKNKITKLQNLDALSSLTVLSMQSNRLTKIEGLQSLVNLRELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL +   L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E    
Sbjct  218  HNGIEVIEGLESNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKGA  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  278  --RSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  312


 Score = 62.0 bits (149),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 79/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ L+    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLDALQSLRELDLYDNQIKKIENLQALTELEVLDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L++LR L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRSIEGLDRLIHLRKLFLVNNKISKIENVSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLDSLFLGKNKITKLQN  182



>ref|XP_001384275.2| regulatory subunit for the mitotic function of type I protein 
phosphatase [Scheffersomyces stipitis CBS 6054]
 gb|ABN66246.2| regulatory subunit for the mitotic function of type I protein 
phosphatase [Scheffersomyces stipitis CBS 6054]
Length=384

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 111/161 (69%), Gaps = 5/161 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            + ENL TL NLQ+LWLG+N+I    N+  L  ++ +SIQSNR+T ++GL++   LEELYL
Sbjct  220  ISENLNTLVNLQQLWLGKNKIHKFENMSNLVNLRVLSIQSNRITKIEGLDKLTNLEELYL  279

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIEK+E L    NL VLDV++NKLT + N+++LTKL D W + N+I++ E+I++ + 
Sbjct  280  SHNGIEKIENLDHNTNLNVLDVTSNKLTKLENLSHLTKLTDFWCSYNHIATFEEISKEL-  338

Query  403  GSLQKLTTLYLERNPC--ANSPNYISTLR-QIFPNIQQVDS  290
            G L +L T+Y E NP    N   Y   L+  + P++ ++D+
Sbjct  339  GKLPELDTVYFEGNPVQTQNMTAYRRKLKLNLGPSLTKIDA  379



>ref|XP_008688738.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Ursus 
maritimus]
Length=338

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYLS
Sbjct  179  IENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYLS  238

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LDV++N++  I NI++LT+L++ W+NDN + S  D+ E  A 
Sbjct  239  HNGIEVIEGLENNNKLTMLDVASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKAA  298

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  299  --KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  333


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 66/118 (56%), Gaps = 8/118 (7%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  62   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  121

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+I+     +LQ+L  L L  N
Sbjct  122  LEILDISFNLLRNIEGVDKLTRLKRLFLVNNKISKIENIS-----NLQQLQMLELGSN  174


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  69   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  128

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  129  FNLLRNIEGVDKLTRLKRLFLVNNKISKIENISNLQQLQMLELGSNRIRAIENI-----D  183

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  184  TLTSLESLFLGKNKITKLQN  203



>ref|XP_009087554.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Serinus canaria]
Length=350

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  190  VIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  249

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  250  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLVESWSDLDE-LK  308

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  309  GA-KNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  345


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  81   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLEALVDLEVLDIS  140

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N+++L  L+ L L  N I  +E+I      
Sbjct  141  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSSLQTLQMLELGSNRIRVIENI-----D  195

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  196  TLTNLDSLFLGKNKITKLQN  215



>ref|XP_005425122.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Geospiza 
fortis]
Length=355

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  195  VIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLVESWSDLDE-LK  313

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  314  GA-KNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  350


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLEALVDLEVLDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK+T I N+++L  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDRLTQLKKLFLVNNKITKIENLSSLQMLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLTNLDSLFLGKNKITKLQN  220



>ref|XP_009087553.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Serinus canaria]
Length=355

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  195  VIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLVESWSDLDE-LK  313

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  314  GA-KNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  350


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLEALVDLEVLDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N+++L  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSSLQTLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLTNLDSLFLGKNKITKLQN  220



>ref|XP_009087551.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Serinus canaria]
Length=356

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  196  VIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  255

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  256  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLVESWSDLDE-LK  314

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  315  GA-KNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  351


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  87   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLEALVDLEVLDIS  146

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N+++L  L+ L L  N I  +E+I      
Sbjct  147  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSSLQTLQMLELGSNRIRVIENI-----D  201

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  202  TLTNLDSLFLGKNKITKLQN  221



>ref|XP_009087552.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Serinus canaria]
Length=355

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  195  VIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELQEFWMNDNLVESWSDLDE-LK  313

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  314  GA-KNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  350


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIRKIENLEALVDLEVLDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N+++L  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLSSLQTLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLTNLDSLFLGKNKITKLQN  220



>gb|KIY43946.1| L domain-like protein [Fistulina hepatica ATCC 64428]
Length=367

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 107/159 (67%), Gaps = 4/159 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL TL NL+ELWLG+N+I R  NL  LK ++ +SIQSNR+T ++GLEE V L+ELY+S
Sbjct  206  IENLDTLVNLEELWLGKNKITRLENLGSLKKLRILSIQSNRITVLEGLEELVDLQELYVS  265

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             NGI++++GL   +NL  LDV +N +  I N+++L +LE+LW++ N I  + D+ E   G
Sbjct  266  DNGIKRIDGLQNNLNLTTLDVGSNFIEKIENVSHLQQLEELWMSGNKIPDLGDL-EPELG  324

Query  400  SLQKLTTLYLERNPC--ANSPNYISTLRQIFPNIQQVDS  290
             +  L T+YLE NPC  A+   Y   +    P + Q+D+
Sbjct  325  KISNLQTIYLEHNPCQTADPTGYRRKIMLALPQLTQIDA  363



>ref|XP_004412756.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Odobenus rosmarus divergens]
Length=317

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  157  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E  A
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKA  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  277  A--KSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  101  LEILDISFNLLRNIEGVEKLTRLKKLFLVNNKISKIENVS  140


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGVEKLTRLKKLFLVNNKISKIENVSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTSLESLFLGKNKITKLQN  182



>ref|XP_009506393.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Phalacrocorax 
carbo]
Length=174

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 102/157 (65%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TL NL  L+LG+N+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYLS
Sbjct  15   IENIDTLANLDSLFLGKNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYLS  74

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E    
Sbjct  75   HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKGA  134

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  135  --KNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  169



>ref|XP_008861707.1| hypothetical protein H310_00636 [Aphanomyces invadans]
 gb|ETW10296.1| hypothetical protein H310_00636 [Aphanomyces invadans]
Length=347

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 3/162 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+E L  L  L++LWLG+N+I  I  L  L  +K IS+QSNRL S+  L+    L+ELYL
Sbjct  188  VLEGLDNLIELEQLWLGKNKITKIQGLEALVKLKIISVQSNRLVSIDNLDANTELQELYL  247

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE ++ ++ L  L +LDV AN++  I ++A+L  LEDLWLNDNN++S +D+    +
Sbjct  248  SHNGIEAIQNVAHLSKLVILDVGANRIPHIPDMASLQALEDLWLNDNNVASFDDLLHLTS  307

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
             +   L TLYLERNP A+   Y   +    P + Q+D+   A
Sbjct  308  NT--SLQTLYLERNPLASDFEYRKRIHAALPFVSQIDATPIA  347


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 64/117 (55%), Gaps = 2/117 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH  578
            M  ++ L NL  L L  N+I+ +   GL  + K+      + ++  L     L+ELY+++
Sbjct  104  MTGIENLENLTHLELYDNQIKKV--AGLDRLVKLRYPFRPIRTIPDLSHLTQLQELYVAN  161

Query  577  NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV  407
            N +  + G+++L  L+ LD+ AN++  +  + NL +LE LWL  N I+ ++ +   V
Sbjct  162  NKLTHITGIASLSTLKKLDLGANRIRVLEGLDNLIELEQLWLGKNKITKIQGLEALV  218



>gb|EFB16581.1| hypothetical protein PANDA_012295 [Ailuropoda melanoleuca]
Length=282

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYLS
Sbjct  123  IENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYLS  182

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A 
Sbjct  183  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKAA  242

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  243  --KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  277


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  19   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDISFNLLRN  78

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+I+
Sbjct  79   IEGVDKLTRLKRLFLVNNKISKIENIS  105


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  13   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  72

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  73   FNLLRNIEGVDKLTRLKRLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  127

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  128  TLTSLESLFLGKNKITKLQN  147



>ref|XP_008861706.1| hypothetical protein H310_00635 [Aphanomyces invadans]
 gb|ETW10295.1| hypothetical protein H310_00635 [Aphanomyces invadans]
Length=356

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 103/162 (64%), Gaps = 3/162 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+E L  L  L++LWLG+N+I  I  L  L  +K IS+QSNRL S+  L+    L+ELYL
Sbjct  197  VLEGLDNLIELEQLWLGKNKITKIQGLEALVKLKIISVQSNRLVSIDNLDANTELQELYL  256

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE ++ ++ L  L +LDV AN++  I ++A+L  LEDLWLNDNN++S +D+    +
Sbjct  257  SHNGIEAIQNVAHLSKLVILDVGANRIPHIPDMASLQALEDLWLNDNNVASFDDLLHLTS  316

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSELFA  278
             +   L TLYLERNP A+   Y   +    P + Q+D+   A
Sbjct  317  NT--SLQTLYLERNPLASDFEYRKRIHAALPFVSQIDATPIA  356


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/126 (29%), Positives = 67/126 (53%), Gaps = 11/126 (9%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAINLCGLKCIKKI---------SIQSNRLTSMKGLEECV  605
            M  ++ L NL  L L  N+I+ +   GL  + K+         S  S+ + ++  L    
Sbjct  104  MTGIENLENLTHLELYDNQIKKV--AGLDRLVKLRYPFRPVLPSRNSSLIRTIPDLSHLT  161

Query  604  ALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVE  425
             L+ELY+++N +  + G+++L  L+ LD+ AN++  +  + NL +LE LWL  N I+ ++
Sbjct  162  QLQELYVANNKLTHITGIASLSTLKKLDLGANRIRVLEGLDNLIELEQLWLGKNKITKIQ  221

Query  424  DIAEAV  407
             +   V
Sbjct  222  GLEALV  227



>ref|XP_007939636.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Orycteropus afer afer]
Length=362

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  202  AIENIDTLTNLDSLFLGKNKITKLQNLDALSSLTVLSMQSNRLTKIEGLQSLVNLRELYL  261

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E   
Sbjct  262  SHNGIEVIEGLESNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKG  321

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  322  A--RSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  357


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 79/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ L+    LE L +S
Sbjct  93   IEGFEVLKKVKTLCLRQNLIKCIENLDALQSLRELDLYDNQIKKIENLQALTELEVLDIS  152

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L++LR L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  153  FNLLRSIEGLDRLIHLRKLFLVNNKISKIENVSNLHQLQMLELGSNRIRAIENI-----D  207

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  208  TLTNLDSLFLGKNKITKLQN  227



>gb|KDN44191.1| hypothetical protein RSAG8_05664, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=386

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 103/160 (64%), Gaps = 4/160 (3%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +E L+ L  L+ELWLG+N+I  +  L  L+ ++ +SIQSNR+T ++GLE    LEE Y+
Sbjct  223  TIEGLEGLGKLEELWLGKNKITKLQGLETLQALRVLSIQSNRITKLEGLEALTNLEEFYI  282

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+ K+EGL   V LR  DVS     A+  +++L++LE+ W +DN I+++ D+ E   
Sbjct  283  SHNGLSKIEGLEKNVKLRTFDVSXXXXXAVEGLSHLSELEEFWASDNQIATLNDL-EREL  341

Query  403  GSLQKLTTLYLERNPC--ANSPNYISTLRQIFPNIQQVDS  290
            G ++  +T+YLERNPC  A+   Y   +    P IQQ+D+
Sbjct  342  GGIKSFSTIYLERNPCERADQTGYRRKVMLALPQIQQIDA  381



>dbj|GAM28146.1| hypothetical protein SAMD00019534_113220 [Acytostelium subglobosum 
LB1]
Length=335

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/160 (44%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSM-KGLEECVALEELYL  584
            ++NL  L N++ LWLGRN+I +I N+  +K +  +S+QSNRLT +  GLE    L ELYL
Sbjct  175  IKNLDKLVNVKTLWLGRNKITSIQNVNHMKNLTILSLQSNRLTEIGNGLEGLTNLTELYL  234

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGI  M+G+ +L+NL++LD+SANK+  +  +  LT LE+LW NDN    +++I + + 
Sbjct  235  SHNGITNMDGVQSLINLQILDISANKIKQLVGVDKLTNLEELWCNDNECDDMDNIEQQIT  294

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDSEL  284
             S   +T LY ERNP A    Y      +FPN++Q+D+ +
Sbjct  295  KS---ITCLYFERNPVAQHQQYRRIFINMFPNLKQLDATM  331



>gb|KIK45072.1| hypothetical protein CY34DRAFT_22738 [Suillus luteus UH-Slu-Lm8-n1]
Length=356

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/159 (45%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L  L NL+ELWLG+N++  + NL  L  +K +S+QSNR+T ++GL++   LEELYLS
Sbjct  193  IEGLDALVNLEELWLGKNKLTKLENLSTLSRLKILSLQSNRITKIEGLDQLADLEELYLS  252

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNG+E++EGL + V LR LDV AN + AI NI++L  LE+LWLN+N I+ +  + E    
Sbjct  253  HNGVERLEGLESNVKLRTLDVGANFVPAIENISHLVLLEELWLNNNKITDLRAL-EPQLK  311

Query  400  SLQKLTTLYLERNPC--ANSPNYISTLRQIFPNIQQVDS  290
            ++  L T+YLE NPC      +Y   +    P ++Q+D+
Sbjct  312  NMTDLETIYLEGNPCQQVEGASYRRKIMLALPQVKQIDA  350



>emb|CDS07272.1| hypothetical protein LRAMOSA01221 [Absidia idahoensis var. thermophila]
Length=333

 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 107/162 (66%), Gaps = 6/162 (4%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L NL +LWLG+N+I R  NL  L+ ++ +SIQSNR+T ++GLEE   L+ELYL
Sbjct  169  VIENLDKLVNLTKLWLGKNKITRLENLSPLRNLQILSIQSNRITKLEGLEELHNLQELYL  228

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHN IEK+EGL   + L+ LDV+ NK+  I N+++LT+LED W N+N   + E  AE   
Sbjct  229  SHNAIEKIEGLENNLKLKTLDVANNKIKHIENMSHLTQLEDFWANNNQFEN-ECFAELTK  287

Query  403  --GSLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
              G ++ L T+YLE NP   AN   Y + +    P ++Q+D+
Sbjct  288  ELGGIKTLDTIYLEGNPMQTANRATYRNKVHLALPQVKQIDA  329


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 64/115 (56%), Gaps = 1/115 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  L EL L  N+I+ +  L  +  ++ + +  N++  +K +++   L +L+  
Sbjct  82   IEGFEGLEKLVELDLYDNKIKHVRGLNQITSLQYLDLSFNKIKHIKNIDQLTNLTDLFFV  141

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
             N I K+E L TLV L  L++ ANK+  I N+  L  L  LWL  N I+ +E+++
Sbjct  142  SNRISKIENLDTLVKLDNLELGANKIRVIENLDKLVNLTKLWLGKNKITRLENLS  196


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 6/130 (5%)
 Frame = -1

Query  748  LQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG  572
            L  +T+LQ L L  N+I+ I N+  L  +  +   SNR++ ++ L+  V L+ L L  N 
Sbjct  107  LNQITSLQYLDLSFNKIKHIKNIDQLTNLTDLFFVSNRISKIENLDTLVKLDNLELGANK  166

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ  392
            I  +E L  LVNL  L +  NK+T + N++ L  L+ L +  N I+ +E + E     L 
Sbjct  167  IRVIENLDKLVNLTKLWLGKNKITRLENLSPLRNLQILSIQSNRITKLEGLEE-----LH  221

Query  391  KLTTLYLERN  362
             L  LYL  N
Sbjct  222  NLQELYLSHN  231



>ref|XP_003438187.2| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Oreochromis 
niloticus]
Length=365

 Score =   134 bits (338),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL +LT+LQ L+LG N+I R  NL  L  +  +SIQSNR+T ++GL+  V L+ELYL
Sbjct  205  VIENLDSLTSLQSLFLGTNKITRLQNLDALHNLTVLSIQSNRITKIEGLQNLVNLKELYL  264

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  265  SHNGVEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIDNWSDLDELKN  324

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             +   L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  325  AT--SLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  360


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L+ L+EL    N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  118  IENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDVSFNVLRKVEGLEQLTRLKKLFLL  177

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  L +L++ +N++  I N+ +LT L+ L+L  N I+ ++++      
Sbjct  178  HNKISSIGNLEHLTGLEMLELGSNRIRVIENLDSLTSLQSLFLGTNKITRLQNL-----D  232

Query  400  SLQKLTTLYLERN  362
            +L  LT L ++ N
Sbjct  233  ALHNLTVLSIQSN  245


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 8/102 (8%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            L+  K +S++ N +  ++ L+   AL EL    N I K+E L  L  L  LDVS N L  
Sbjct  102  LQKAKTLSLRQNLIKKIENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDVSFNVLRK  161

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYL  371
            +  +  LT+L+ L+L  N ISS+        G+L+ LT L +
Sbjct  162  VEGLEQLTRLKKLFLLHNKISSI--------GNLEHLTGLEM  195



>ref|XP_004743830.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Mustela putorius furo]
Length=317

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 106/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYLS
Sbjct  158  IENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A 
Sbjct  218  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKAA  277

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  278  --RNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  312


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  54   LKKVKTLCLRQNLIKYIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDISFNLLRN  113

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+I+
Sbjct  114  IEGVDKLTRLKKLFLVNNKISKIENIS  140


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E    L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFDVLKKVKTLCLRQNLIKYIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+ L +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENISTLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTSLESLFLGKNKITKLQN  182



>ref|XP_004412755.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Odobenus rosmarus divergens]
Length=360

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  200  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E  A
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKA  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A--KSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  355


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRNIEGVEKLTRLKKLFLVNNKISKIENVS  183


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVEKLTRLKKLFLVNNKISKIENVSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTSLESLFLGKNKITKLQN  225



>ref|XP_005151059.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Melopsittacus undulatus]
Length=353

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ +LTNL  L+LGRN+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  193  VIENIDSLTNLDSLFLGRNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  252

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I N+++LT+L++ W+NDN + S  D+ E + 
Sbjct  253  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENVSHLTELQEFWMNDNLVESWSDLDE-LK  311

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  312  GA-KNLETVYLERNPLQKDPQYRRKIVLALPTVRQIDA  348


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L LS
Sbjct  84   IEGFEVLKKVKTLCLRQNLIKRIENLEQLQTLRELDLYDNQIRKIENLESLVELEILDLS  143

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL     L+ L +  NK++ I N++NL  L+ L L  N I  +E+I      
Sbjct  144  FNVLRHIEGLDQFSQLKKLFLVNNKISKIENLSNLQMLQMLELGSNRIRVIENI-----D  198

Query  400  SLQKLTTLYLERNPCANSPN  341
            SL  L +L+L RN      N
Sbjct  199  SLTNLDSLFLGRNKITKLQN  218



>ref|XP_004905713.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Heterocephalus glaber]
 ref|XP_004868532.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Heterocephalus glaber]
Length=292

 Score =   132 bits (333),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ +A+ G
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDL-DALKG  251

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  252  A-RSLETVYLERNPLHRDPQYRRKVMLALPSVRQIDA  287


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  29   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  88

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  I  LT+L+ L+L +N IS +E+++
Sbjct  89   IEGIDQLTQLKKLFLVNNKISKIENLS  115


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  83   FNLLRNIEGIDQLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLESLFLGKNKITKLQN  157



>ref|XP_005151057.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Melopsittacus undulatus]
Length=355

 Score =   134 bits (337),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ +LTNL  L+LGRN+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  195  VIENIDSLTNLDSLFLGRNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I N+++LT+L++ W+NDN + S  D+ E + 
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENVSHLTELQEFWMNDNLVESWSDLDE-LK  313

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  314  GA-KNLETVYLERNPLQKDPQYRRKIVLALPTVRQIDA  350


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L LS
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKRIENLEQLQTLRELDLYDNQIRKIENLESLVELEILDLS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL     L+ L +  NK++ I N++NL  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDQFSQLKKLFLVNNKISKIENLSNLQMLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            SL  L +L+L RN      N
Sbjct  201  SLTNLDSLFLGRNKITKLQN  220



>ref|XP_011228086.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Ailuropoda melanoleuca]
Length=317

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  157  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKA  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  277  A--KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+I+
Sbjct  101  LEILDISFNLLRNIEGVDKLTRLKRLFLVNNKISKIENIS  140


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGVDKLTRLKRLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTSLESLFLGKNKITKLQN  182



>ref|XP_004637423.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Octodon degus]
Length=317

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 109/158 (69%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  217  SHNGIEVIEGLESNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LK  275

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  276  GA-RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N IS +E+++
Sbjct  101  LEILDISFNLLRTIEGIDKLTQLKKLFLVNNKISKIENLS  140


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRTIEGIDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_005151058.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Melopsittacus undulatus]
Length=355

 Score =   134 bits (336),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ +LTNL  L+LGRN+I  + NL  L  +  +SIQ+NRLT ++GL+  V L ELYL
Sbjct  195  VIENIDSLTNLDSLFLGRNKITKLQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I N+++LT+L++ W+NDN + S  D+ E   
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENVSHLTELQEFWMNDNLVESWSDLDELKG  314

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  315  A--KNLETVYLERNPLQKDPQYRRKIVLALPTVRQIDA  350


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/140 (33%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L LS
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKRIENLEQLQTLRELDLYDNQIRKIENLESLVELEILDLS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL     L+ L +  NK++ I N++NL  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDQFSQLKKLFLVNNKISKIENLSNLQMLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            SL  L +L+L RN      N
Sbjct  201  SLTNLDSLFLGRNKITKLQN  220



>ref|XP_004743829.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Mustela putorius furo]
 ref|XP_004809709.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Mustela putorius furo]
Length=360

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 106/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYLS
Sbjct  201  IENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A 
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKAA  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  321  --RNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  355


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  97   LKKVKTLCLRQNLIKYIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDISFNLLRN  156

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+I+
Sbjct  157  IEGVDKLTRLKKLFLVNNKISKIENIS  183


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E    L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFDVLKKVKTLCLRQNLIKYIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+ L +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENISTLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTSLESLFLGKNKITKLQN  225



>ref|XP_008136695.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Eptesicus fuscus]
Length=317

 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT M+GL+  V L ELYL
Sbjct  157  AIENIDTLTNLDSLFLGKNKITKLQNLDALSNLTVLSIQSNRLTKMEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L + W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELLEFWMNDNLLESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  277  A--KNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 27/134 (20%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN----  509
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L TL  L +LD+S N    
Sbjct  54   LKKVKTLCLRQNLIKCIENLEELHSLRELDLYDNQIKKIENLDTLTELEILDISFNLLRN  113

Query  508  ------------------KLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT  383
                              K+  I N++NL +LE L L  N I ++E+I      +L  L 
Sbjct  114  IEGVDKLTKLKKLFLVNNKINKIENLSNLCQLEMLELGSNRIRAIENI-----DTLTNLD  168

Query  382  TLYLERNPCANSPN  341
            +L+L +N      N
Sbjct  169  SLFLGKNKITKLQN  182



>ref|XP_006786565.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like isoform 
X2 [Neolamprologus brichardi]
Length=345

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL +LT+LQ L+LG N+I R  NL  L  +  +SIQSNR+T ++GL+  + L ELYL
Sbjct  185  VIENLDSLTSLQSLFLGTNKITRLQNLDALHNLTVLSIQSNRITKIEGLQNLINLRELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  245  SHNGVEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIDNWSDLDELKN  304

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             +   L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  305  AT--SLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  340


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L+ L+EL    N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  98   IENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDVSFNVLRKVEGLEQLTRLKKLFLL  157

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  L +L++ +N++  I N+ +LT L+ L+L  N I+ ++++      
Sbjct  158  HNKISSIANLEHLTGLEMLELGSNRIRVIENLDSLTSLQSLFLGTNKITRLQNL-----D  212

Query  400  SLQKLTTLYLERN  362
            +L  LT L ++ N
Sbjct  213  ALHNLTVLSIQSN  225



>ref|XP_004542733.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Maylandia 
zebra]
Length=368

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL +LT+LQ L+LG N+I R  NL  L  +  +SIQSNR+T ++GL+  + L+ELYL
Sbjct  208  VIENLDSLTSLQSLFLGTNKITRLQNLDALHNLTVLSIQSNRITKIEGLQNLINLKELYL  267

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  268  SHNGVEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIDNWSDLDELKN  327

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             +   L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  328  AT--SLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  363


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L+ L+EL    N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  121  IENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDMSFNVLRKVEGLEQLTRLKKLFLL  180

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  L +L++ +N++  I N+ +LT L+ L+L  N I+ ++++      
Sbjct  181  HNKISSIANLEHLTGLEMLELGSNRIRVIENLDSLTSLQSLFLGTNKITRLQNL-----D  235

Query  400  SLQKLTTLYLERN  362
            +L  LT L ++ N
Sbjct  236  ALHNLTVLSIQSN  248



>ref|XP_004386537.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Trichechus manatus latirostris]
Length=317

 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLDSLFLGKNKITKLQNLDALTSLTVLSMQSNRLTKIEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDLASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  277  A--RSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  312


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  M+ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEALQSLRELDLYDNQIRKMENLEALTGLEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLDSLFLGKNKITKLQN  182



>emb|CDH49670.1| protein phosphatase pp1 regulatory subunit [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=334

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 75/162 (46%), Positives = 106/162 (65%), Gaps = 6/162 (4%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L NL +LWLG+N+I R  NL  L+ ++ +SIQSNR+T ++GLEE   L+ELYL
Sbjct  170  VIENLDQLVNLTKLWLGKNKITRLENLSPLRNLQILSIQSNRITKLEGLEELHNLQELYL  229

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHN IEK+EGL   + L+ LDV+ NK+  I N+++LT+LED W N NN+   E   E   
Sbjct  230  SHNAIEKIEGLENNLKLKTLDVANNKIKHIENMSHLTQLEDFWAN-NNLFESECFGELTK  288

Query  403  --GSLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
              G ++ L T+YLE NP   AN   Y + +    P ++Q+D+
Sbjct  289  ELGDIKTLDTIYLEGNPMQAANRATYRNKVHLALPQVRQIDA  330


 Score = 60.1 bits (144),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 64/115 (56%), Gaps = 1/115 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  L EL L  N+I+ +  L  +  ++ + +  N++  +K +++   L +L+  
Sbjct  83   IEGFEGLDKLVELDLYDNKIKHVRGLNQITSLQYLDLSFNKIKHIKNIDQLTNLSDLFFV  142

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
             N I K+E L TLV L  L++ ANK+  I N+  L  L  LWL  N I+ +E+++
Sbjct  143  SNRISKIENLDTLVQLDNLELGANKIRVIENLDQLVNLTKLWLGKNKITRLENLS  197


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 45/130 (35%), Positives = 69/130 (53%), Gaps = 6/130 (5%)
 Frame = -1

Query  748  LQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNG  572
            L  +T+LQ L L  N+I+ I N+  L  +  +   SNR++ ++ L+  V L+ L L  N 
Sbjct  108  LNQITSLQYLDLSFNKIKHIKNIDQLTNLSDLFFVSNRISKIENLDTLVQLDNLELGANK  167

Query  571  IEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQ  392
            I  +E L  LVNL  L +  NK+T + N++ L  L+ L +  N I+ +E + E     L 
Sbjct  168  IRVIENLDQLVNLTKLWLGKNKITRLENLSPLRNLQILSIQSNRITKLEGLEE-----LH  222

Query  391  KLTTLYLERN  362
             L  LYL  N
Sbjct  223  NLQELYLSHN  232



>ref|XP_005912848.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Haplochromis 
burtoni]
Length=368

 Score =   134 bits (336),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL +LT+LQ L+LG N+I R  NL  L  +  +SIQSNR+T ++GL+  + L+ELYL
Sbjct  208  VIENLDSLTSLQSLFLGTNKITRLQNLDALHNLTVLSIQSNRITKIEGLQNLINLKELYL  267

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  268  SHNGVEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIDNWSDLDELKN  327

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             +   L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  328  AT--SLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  363


 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L+ L+EL    N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  121  IENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDVSFNVLRKVEGLEQLTRLKKLFLL  180

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  L +L++ +N++  I N+ +LT L+ L+L  N I+ ++++      
Sbjct  181  HNKISSIANLEHLSGLEMLELGSNRIRVIENLDSLTSLQSLFLGTNKITRLQNL-----D  235

Query  400  SLQKLTTLYLERN  362
            +L  LT L ++ N
Sbjct  236  ALHNLTVLSIQSN  248


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            L+  K +S++ N +  ++ L+   AL EL    N I K+E L  L  L  LDVS N L  
Sbjct  105  LQKAKTLSLRQNLIKKIENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDVSFNVLRK  164

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            +  +  LT+L+ L+L  N ISS+ ++ E ++G
Sbjct  165  VEGLEQLTRLKKLFLLHNKISSIANL-EHLSG  195



>gb|KDO20340.1| hypothetical protein SPRG_13486 [Saprolegnia parasitica CBS 223.65]
Length=1231

 Score =   138 bits (347),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 76/157 (48%), Positives = 100/157 (64%), Gaps = 3/157 (2%)
 Frame = -1

Query  757   MENLQTLTNLQELWLGRNRIRAIN-LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
             +E L  L NL++LWLG+N+I AI  L  L  ++ +SIQSNRL ++  L   VALEELYLS
Sbjct  1068  IEGLDHLENLEQLWLGKNKITAIQGLGALTKLRVMSIQSNRLLAIDNLSANVALEELYLS  1127

Query  580   HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             HNGIE +  L  L  L +LDV AN++  I ++     LEDLWLNDN ISS +DI    A 
Sbjct  1128  HNGIEALANLDHLTKLTILDVGANRIKTIPHMGANVALEDLWLNDNEISSFDDIQHLAAN  1187

Query  400   SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
                KL TLYLERNP A+   Y   ++    ++QQ+D+
Sbjct  1188  V--KLETLYLERNPLASDFEYRLKIQGALASVQQIDA  1222


 Score = 69.3 bits (168),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 44/121 (36%), Positives = 74/121 (61%), Gaps = 8/121 (7%)
 Frame = -1

Query  715   LGRNRIRAINLCGLKC---IKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLST  545
             +G   ++A  L GL+    ++++ ++SN L  M G+E  V L  L L  N I+KM GL  
Sbjct  948   VGTAGLKARVLDGLEAMVQLRELHVRSNLLYKMTGIESLVNLTHLELYDNQIKKMVGLEK  1007

Query  544   LVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLER  365
             LV LRVLD+S N++ +I ++++LT+LE+L++ +N ++ +  I     G+L+ L  L L  
Sbjct  1008  LVKLRVLDLSFNEIRSIPDLSHLTQLEELYVANNKLTHITGI-----GNLRTLVKLDLGA  1062

Query  364   N  362
             N
Sbjct  1063  N  1063


 Score = 67.4 bits (163),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/133 (30%), Positives = 72/133 (54%), Gaps = 6/133 (5%)
 Frame = -1

Query  757   MENLQTLTNLQELWLGRNRIRA-INLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
             M  +++L NL  L L  N+I+  + L  L  ++ + +  N + S+  L     LEELY++
Sbjct  980   MTGIESLVNLTHLELYDNQIKKMVGLEKLVKLRVLDLSFNEIRSIPDLSHLTQLEELYVA  1039

Query  580   HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             +N +  + G+  L  L  LD+ AN++  I  + +L  LE LWL  N I++++ +     G
Sbjct  1040  NNKLTHITGIGNLRTLVKLDLGANRIRTIEGLDHLENLEQLWLGKNKITAIQGL-----G  1094

Query  400   SLQKLTTLYLERN  362
             +L KL  + ++ N
Sbjct  1095  ALTKLRVMSIQSN  1107



>ref|XP_004667875.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Jaculus jaculus]
Length=317

 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE--L  274

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             S + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  275  KSARNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 64/118 (54%), Gaps = 8/118 (7%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE   L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQGLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            L +LD+S N L  I  I  LT+L+ L+L +N IS +E+++     SL +L  L L  N
Sbjct  101  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKISKIENLS-----SLHQLQMLELGSN  153


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQGLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N+++L +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTRLKKLFLVNNKISKIENLSSLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_004743828.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Mustela putorius furo]
Length=364

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 106/158 (67%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  204  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  263

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A
Sbjct  264  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKA  323

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  324  A--RNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  359


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  101  LKKVKTLCLRQNLIKYIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDISFNLLRN  160

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+I+
Sbjct  161  IEGVDKLTRLKKLFLVNNKISKIENIS  187


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E    L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  95   IEGFDVLKKVKTLCLRQNLIKYIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  154

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+ L +L+ L L  N I ++E+I      
Sbjct  155  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENISTLHQLQMLELGSNRIRAIENI-----D  209

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  210  TLTSLESLFLGKNKITKLQN  229



>ref|XP_010792283.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Notothenia 
coriiceps]
Length=345

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            ++ENL TL++LQ L+LG N+I  + NL GL  +  +SIQSNR+T ++GL+  + L ELYL
Sbjct  185  ILENLDTLSSLQSLFLGTNKITTLQNLDGLHNLTVLSIQSNRITKIEGLQNLLNLRELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LD++AN++  I NI +LT L++ W+NDN I +  D+ E   
Sbjct  245  SHNGIEVIEGLENNKKLTTLDIAANRVKKIENINHLTDLQEFWMNDNQIDNWSDLDE--L  302

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  303  KNAKSLETVYLERNPVQKDPQYRRKIMLALPSVRQIDA  340


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 78/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L +L+EL L  N+IR + NL  L  I ++ +  N L  ++GLE+   L++L+L 
Sbjct  98   IENLDSLRSLRELDLYDNQIRKLENLQNLTEIDQLDVSFNMLRKVEGLEQLTQLKKLFLL  157

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  L +L++ +N++  + N+  L+ L+ L+L  N I++++++      
Sbjct  158  HNKIGSIANLDHLTGLDMLELGSNRIRILENLDTLSSLQSLFLGTNKITTLQNL-----D  212

Query  400  SLQKLTTLYLERN  362
             L  LT L ++ N
Sbjct  213  GLHNLTVLSIQSN  225



>ref|XP_011228085.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Ailuropoda melanoleuca]
Length=350

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYLS
Sbjct  191  IENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYLS  250

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A 
Sbjct  251  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKAA  310

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  311  --KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  345


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  87   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDISFNLLRN  146

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+I+
Sbjct  147  IEGVDKLTRLKRLFLVNNKISKIENIS  173


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  81   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  140

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  141  FNLLRNIEGVDKLTRLKRLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  195

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  196  TLTSLESLFLGKNKITKLQN  215



>ref|XP_005411200.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Chinchilla lanigera]
Length=292

 Score =   132 bits (331),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --RNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  287


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L VLD+S N L  
Sbjct  29   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNLLRN  88

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  I  LT+L+ L+L +N IS +E+++
Sbjct  89   IEGIDKLTQLKKLFLVNNKISKIENLS  115


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  83   FNLLRNIEGIDKLTQLKKLFLVNNKISKIENLSNLNQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLESLFLGKNKITKLQN  157



>ref|XP_007085112.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Panthera tigris altaica]
Length=360

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYLS
Sbjct  201  IENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A 
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKAA  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  321  --KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  355


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  97   LKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDISFNLLRN  156

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            I  +  LT+L+ L+L +N IS +E+I+     SL +L  L L  N
Sbjct  157  IEGVDKLTRLKKLFLVNNKISKIENIS-----SLHQLQMLELGSN  196


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI++L +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENISSLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTSLESLFLGKNKITKLQN  225



>ref|XP_003991355.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Felis catus]
Length=360

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYLS
Sbjct  201  IENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A 
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKAA  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  321  --KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  355


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  97   LKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDISFNLLRN  156

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            I  +  LT+L+ L+L +N IS +E+I+     SL +L  L L  N
Sbjct  157  IEGVDKLTRLKKLFLVNNKISKIENIS-----SLHQLQMLELGSN  196


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI++L +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENISSLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTSLESLFLGKNKITKLQN  225



>ref|XP_004905711.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Heterocephalus glaber]
 ref|XP_004868530.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Heterocephalus glaber]
Length=354

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 109/158 (69%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  194  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  253

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ +A+ 
Sbjct  254  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDL-DALK  312

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  313  GA-RSLETVYLERNPLHRDPQYRRKVMLALPSVRQIDA  349


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  78   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  137

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N IS +E+++
Sbjct  138  LEILDISFNLLRNIEGIDQLTQLKKLFLVNNKISKIENLS  177


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  85   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  144

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  145  FNLLRNIEGIDQLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  199

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  200  TLTNLESLFLGKNKITKLQN  219



>ref|XP_008136693.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Eptesicus fuscus]
Length=360

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT M+GL+  V L ELYL
Sbjct  200  AIENIDTLTNLDSLFLGKNKITKLQNLDALSNLTVLSIQSNRLTKMEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L + W+NDN + S  D+ E   
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELLEFWMNDNLLESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A--KNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 27/134 (20%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN----  509
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L TL  L +LD+S N    
Sbjct  97   LKKVKTLCLRQNLIKCIENLEELHSLRELDLYDNQIKKIENLDTLTELEILDISFNLLRN  156

Query  508  ------------------KLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT  383
                              K+  I N++NL +LE L L  N I ++E+I      +L  L 
Sbjct  157  IEGVDKLTKLKKLFLVNNKINKIENLSNLCQLEMLELGSNRIRAIENI-----DTLTNLD  211

Query  382  TLYLERNPCANSPN  341
            +L+L +N      N
Sbjct  212  SLFLGKNKITKLQN  225



>ref|XP_004637422.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Octodon degus]
Length=360

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL +   L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + G
Sbjct  261  HNGIEVIEGLESNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LKG  319

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A-RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRTIEGIDKLTQLKKLFLVNNKISKIENLS  183


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRTIEGIDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_004427807.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Ceratotherium simum simum]
Length=317

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LDV++N++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  217  SHNGIEVIEGLENNNKLTMLDVASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LK  275

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  276  GA-KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  312


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+++
Sbjct  101  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENVS  140


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENVSNLRQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_002923185.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Ailuropoda melanoleuca]
Length=360

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  200  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKA  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  320  A--KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  355


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+I+
Sbjct  144  LEILDISFNLLRNIEGVDKLTRLKRLFLVNNKISKIENIS  183


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTRLKRLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTSLESLFLGKNKITKLQN  225



>ref|XP_009236624.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Pongo abelii]
Length=292

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  287


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  29   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  88

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  89   IEGVDKLTQLKKLFLVNNKISKIENLS  115


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  83   FNLLRNIEGVDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLESLFLGKNKITKLQN  157



>ref|XP_008136694.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Eptesicus fuscus]
Length=359

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT M+GL+  V L ELYL
Sbjct  199  AIENIDTLTNLDSLFLGKNKITKLQNLDALSNLTVLSIQSNRLTKMEGLQSLVNLRELYL  258

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD++AN++  I NI++LT+L + W+NDN + S  D+ E   
Sbjct  259  SHNGIEVIEGLENNNKLTMLDIAANRIKKIENISHLTELLEFWMNDNLLESWSDLDELKG  318

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  319  A--KNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  354


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 65/134 (49%), Gaps = 27/134 (20%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN----  509
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L TL  L +LD+S N    
Sbjct  96   LKKVKTLCLRQNLIKCIENLEELHSLRELDLYDNQIKKIENLDTLTELEILDISFNLLRN  155

Query  508  ------------------KLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLT  383
                              K+  I N++NL +LE L L  N I ++E+I      +L  L 
Sbjct  156  IEGVDKLTKLKKLFLVNNKINKIENLSNLCQLEMLELGSNRIRAIENI-----DTLTNLD  210

Query  382  TLYLERNPCANSPN  341
            +L+L +N      N
Sbjct  211  SLFLGKNKITKLQN  224



>ref|XP_007362441.1| L domain-like protein [Dichomitus squalens LYAD-421 SS1]
 gb|EJF64645.1| L domain-like protein [Dichomitus squalens LYAD-421 SS1]
Length=377

 Score =   133 bits (335),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 106/159 (67%), Gaps = 4/159 (3%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+ L NL+ELW+G+N+I  + NL  LK ++ +SIQSNR+T ++GLE    LEE Y+S
Sbjct  212  LEGLEALVNLEELWVGKNKITKLENLDTLKKLRILSIQSNRITKIEGLENLENLEEFYIS  271

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNG++++EGL   + LR LDV  N +  + N+++LT LE+LW+NDN I+++ D+ E    
Sbjct  272  HNGVQRLEGLEKNIKLRTLDVGNNFIERVENVSHLTSLEELWINDNKITTLLDL-EPQLK  330

Query  400  SLQKLTTLYLERNP--CANSPNYISTLRQIFPNIQQVDS  290
             ++ L T+YLERNP        Y   +  + P IQQ+D+
Sbjct  331  HIETLETIYLERNPVQATEGAAYRRKIILLLPQIQQLDA  369



>ref|XP_006267104.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Alligator 
mississippiensis]
Length=355

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT ++GL+  V L ELYL
Sbjct  195  AIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQSNRLTKIEGLQNLVNLRELYL  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E   
Sbjct  255  SHNGVEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKG  314

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  315  A--KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  350


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 78/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKQIANLEQLQTLRELDLYDNQIRKIENLESLTELEILDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N + ++EGL  L  L+ L +  NK++ I N+++L +L+ L L  N I ++E+I      
Sbjct  146  FNILRRIEGLDRLTQLKKLFLVNNKISKIENLSSLQQLQMLELGSNRIRAIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLTNLDSLFLGKNKITKLQN  220



>gb|EDL91951.1| protein phosphatase 1, regulatory (inhibitor) subunit 7, isoform 
CRA_b [Rattus norvegicus]
Length=317

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALSNLTVLSMQSNRLTKIEGLQNLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  277  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKSLCLRQNLIKCIENLDELQSLRELDLYDNQIKKIENLEALTELEVLDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+ L +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTQLKKLFLVNNKINKIENISTLQQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_007085111.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Panthera tigris altaica]
Length=364

 Score =   133 bits (334),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  204  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  263

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A
Sbjct  264  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKA  323

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  324  A--KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  359


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 65/118 (55%), Gaps = 8/118 (7%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  88   NHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  147

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+I+     SL +L  L L  N
Sbjct  148  LEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENIS-----SLHQLQMLELGSN  200


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  95   IEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  154

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI++L +L+ L L  N I ++E+I      
Sbjct  155  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENISSLHQLQMLELGSNRIRAIENI-----D  209

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  210  TLTSLESLFLGKNKITKLQN  229



>ref|XP_010604936.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Fukomys damarensis]
Length=292

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  287


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  29   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  88

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  I  LT+L+ L+L +N IS +E+I+
Sbjct  89   IEGIDQLTQLKKLFLVNNKISKIENIS  115


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  83   FNLLRNIEGIDQLTQLKKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLESLFLGKNKITKLQN  157



>ref|XP_006935810.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Felis catus]
Length=364

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  204  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  263

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A
Sbjct  264  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKA  323

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  324  A--KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  359


 Score = 58.9 bits (141),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 65/118 (55%), Gaps = 8/118 (7%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  88   NHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  147

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+I+     SL +L  L L  N
Sbjct  148  LEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENIS-----SLHQLQMLELGSN  200


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  95   IEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  154

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI++L +L+ L L  N I ++E+I      
Sbjct  155  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENISSLHQLQMLELGSNRIRAIENI-----D  209

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  210  TLTSLESLFLGKNKITKLQN  229



>ref|XP_007067430.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Chelonia mydas]
Length=292

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN  TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT ++GL+  V L ELYLS
Sbjct  133  IENTDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQSNRLTKIEGLQNLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN I S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLIESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  287


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N ++ I NL  L+ ++++ +  N++  ++ LE    +E L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLVKCIENLEQLQTLRELDLYDNQIRKIENLEALTDVEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK+  I N++NL +L+ L L  N I ++E+       
Sbjct  83   FNLLRHIEGLDRLTQLKKLFLVNNKIGKIENLSNLQQLQMLELGSNRIRAIEN-----TD  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLDSLFLGKNKITKLQN  157



>ref|XP_004386536.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Trichechus manatus latirostris]
Length=360

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLDSLFLGKNKITKLQNLDALTSLTVLSMQSNRLTKIEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E   
Sbjct  260  SHNGIEVIEGLENNNKLTMLDLASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A--RSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  355


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  M+ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEALQSLRELDLYDNQIRKMENLEALTGLEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLDSLFLGKNKITKLQN  225


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LE   +L EL L  N I KME L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEALQSLRELDLYDNQIRKMENLEALTG  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRNIEGIDKLTQLKKLFLVNNKISKIENLS  183



>ref|XP_004905709.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004868528.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Heterocephalus glaber]
 gb|EHB16176.1| Protein phosphatase 1 regulatory subunit 7 [Heterocephalus glaber]
Length=360

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ +A+ G
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDL-DALKG  319

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A-RSLETVYLERNPLHRDPQYRRKVMLALPSVRQIDA  355


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRNIEGIDQLTQLKKLFLVNNKISKIENLS  183


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDQLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_005301181.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Chrysemys picta bellii]
Length=292

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN  TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT ++GL+  V L ELYLS
Sbjct  133  IENTDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQSNRLTKIEGLQNLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN I S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLIESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  287


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N ++ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLVKCIENLEQLQTLRELDLYDNQIRKIENLEALTDLEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+       
Sbjct  83   FNLLRHIEGLDRLTQLKKLFLVNNKISKIENLSNLQQLQMLELGSNRIRAIEN-----TD  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLDSLFLGKNKITKLQN  157



>ref|XP_011228084.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Ailuropoda melanoleuca]
Length=364

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  204  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  263

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A
Sbjct  264  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKA  323

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  324  A--KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  359


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  88   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  147

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+I+
Sbjct  148  LEILDISFNLLRNIEGVDKLTRLKRLFLVNNKISKIENIS  187


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  95   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  154

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  155  FNLLRNIEGVDKLTRLKRLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  209

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  210  TLTSLESLFLGKNKITKLQN  229



>ref|NP_001269342.1| protein phosphatase 1 regulatory subunit 7 isoform 6 [Homo sapiens]
Length=301

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  142  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  201

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  202  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  261

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  262  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  296


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  38   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  97

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  98   IEGVDKLTRLKKLFLVNNKISKIENLS  124


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  32   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  91

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  92   FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  146

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  147  TLTNLESLFLGKNKITKLQN  166



>ref|XP_008250385.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Oryctolagus cuniculus]
Length=292

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E    
Sbjct  193  HNGIEVIEGLDNNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLDSWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  287


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAINLCG-LKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            ME +    + +++ L   RI  I   G LK +K + ++ N +  ++ LEE  +L EL L 
Sbjct  1    METINLDRDAEDVDLNHYRIGKIEGFGVLKKVKTLCLRQNLIKCIENLEELQSLRELDLY  60

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N I K+E L +L  L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I     G
Sbjct  61   DNQIRKIENLESLAELEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENI-----G  115

Query  400  SLQKLTTLYLERN  362
            +L +L  L L  N
Sbjct  116  TLHQLQMLELGSN  128


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E    L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFGVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIRKIENLESLAELEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI  L +L+ L L  N I ++E+I      
Sbjct  83   FNLLRNIEGIDKLTRLKKLFLVNNKINKIENIGTLHQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLESLFLGKNKITKLQN  157



>ref|XP_004905710.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Heterocephalus glaber]
 ref|XP_004868529.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Heterocephalus glaber]
Length=355

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  196  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  255

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ +A+ G
Sbjct  256  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDL-DALKG  314

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  315  A-RSLETVYLERNPLHRDPQYRRKVMLALPSVRQIDA  350


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  92   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  151

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  I  LT+L+ L+L +N IS +E+++
Sbjct  152  IEGIDQLTQLKKLFLVNNKISKIENLS  178


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  146  FNLLRNIEGIDQLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLTNLESLFLGKNKITKLQN  220



>ref|XP_007965163.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Chlorocebus sabaeus]
Length=292

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  287


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  29   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  88

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  89   IEGVDKLTRLKKLFLVNNKISKIENLS  115


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  83   FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLRQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLESLFLGKNKITKLQN  157



>ref|XP_008283975.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Stegastes 
partitus]
Length=345

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/158 (45%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L++LQ L+LG N+I  + NL GL  +  +SIQSNR+T ++GL+  V L ELYL
Sbjct  185  VIENLDALSSLQSLFLGTNKITKLQNLEGLHNLTVLSIQSNRITKIEGLQNLVNLRELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LD++AN++  I NI +LT L++ W+NDN I +  D+ E   
Sbjct  245  SHNGIEVIEGLENNKKLTTLDIAANRVKKIENINHLTDLQEFWMNDNQIDNWSDLDE--L  302

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  303  KNAKSLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  340


 Score = 62.0 bits (149),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L++L+EL L  N+IR + NL  L  ++++ +  N L  ++GLE+   +++L+L 
Sbjct  98   IENLDSLSSLRELDLYDNQIRKLENLHSLTELEQLDVSFNILRKVEGLEQLTQIKKLFLL  157

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  +  L  L +L++ +N++  I N+  L+ L+ L+L  N I+ ++++      
Sbjct  158  HNKINGISNVDHLSVLEMLELGSNRIRVIENLDALSSLQSLFLGTNKITKLQNLE-----  212

Query  400  SLQKLTTLYLERN  362
             L  LT L ++ N
Sbjct  213  GLHNLTVLSIQSN  225


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 74/140 (53%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E L+ L   + L L +N I+ I NL  L  ++++ +  N++  ++ L     LE+L +S
Sbjct  76   IEGLEVLQKAKTLSLRQNLIKKIENLDSLSSLRELDLYDNQIRKLENLHSLTELEQLDVS  135

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N + K+EGL  L  ++ L +  NK+  ISN+ +L+ LE L L  N I  +E++      
Sbjct  136  FNILRKVEGLEQLTQIKKLFLLHNKINGISNVDHLSVLEMLELGSNRIRVIENL-----D  190

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L  N      N
Sbjct  191  ALSSLQSLFLGTNKITKLQN  210



>ref|XP_009181801.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Papio anubis]
 ref|XP_009181802.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Papio anubis]
Length=292

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  133  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  192

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  193  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  252

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  253  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  287


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  29   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  88

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  89   IEGVDKLTRLKKLFLVNNKISKIENLS  115


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  23   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  82

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  83   FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  137

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  138  TLTNLESLFLGKNKITKLQN  157



>ref|XP_005796060.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Xiphophorus 
maculatus]
Length=345

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L++LQ L+LG N+I  + NL  L  +  +SIQSNR+T ++GL+  + L+ELYL
Sbjct  185  VIENLDALSSLQSLFLGTNKITKLQNLDSLHNLTVLSIQSNRITKIEGLQNLINLKELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LDV+AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  245  SHNGIEVLEGLENNKKLSTLDVAANRVKKIENISHLTELQEFWMNDNQIDNWSDLDE--L  302

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  303  KNAKSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  340


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = -1

Query  706  NRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLR  530
            N+IR + NL  LK ++ + +  N L  ++ LEE   +++L+L HN +  +  +  L +L 
Sbjct  115  NQIRKLENLSNLKELELLDVSFNILRKVENLEELTKIKKLFLVHNKVTAISNMDHLTSLE  174

Query  529  VLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            +L++ +N++  I N+  L+ L+ L+L  N I+ ++++      SL  LT L ++ N
Sbjct  175  MLELGSNRIRVIENLDALSSLQSLFLGTNKITKLQNL-----DSLHNLTVLSIQSN  225



>ref|XP_004905712.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Heterocephalus glaber]
 ref|XP_004868531.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Heterocephalus glaber]
Length=353

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 109/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  194  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  253

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ +A+ G
Sbjct  254  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDL-DALKG  312

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  313  A-RSLETVYLERNPLHRDPQYRRKVMLALPSVRQIDA  348


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  90   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  149

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  I  LT+L+ L+L +N IS +E+++
Sbjct  150  IEGIDQLTQLKKLFLVNNKISKIENLS  176


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  84   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  143

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  144  FNLLRNIEGIDQLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  198

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  199  TLTNLESLFLGKNKITKLQN  218



>ref|XP_005411199.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Chinchilla lanigera]
Length=317

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LK  275

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  276  GA-RNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L VLD+S N L  I  I  LT+L+ L+L +N IS +E+++
Sbjct  101  LEVLDISFNLLRNIEGIDKLTQLKKLFLVNNKISKIENLS  140


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTQLKKLFLVNNKISKIENLSNLNQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_006209214.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Vicugna pacos]
Length=317

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  158  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  217

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL +   L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E + G
Sbjct  218  HNGIEVIEGLDSNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDE-LKG  276

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  277  A-RNLETVYLERNPLQRDPQYRRKVMLALPTVRQIDA  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I+
Sbjct  101  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENIS  140


 Score = 54.7 bits (130),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+ L +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENISTLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_009236623.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Pongo abelii]
Length=317

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  277  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  101  LEILDISFNLLRNIEGVDKLTQLKKLFLVNNKISKIENLS  140


 Score = 56.2 bits (134),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGVDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_001158513.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Pan troglodytes]
Length=317

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  277  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKNLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  101  LEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLS  140


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKNLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_004667874.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Jaculus jaculus]
Length=360

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 106/157 (68%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE--LK  318

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            S + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  319  SARNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 60/105 (57%), Gaps = 5/105 (5%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE   L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  97   LKKVKTLCLRQNLIKCIENLEELQGLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  156

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            I  I  LT+L+ L+L +N IS +E+++     SL +L  L L  N
Sbjct  157  IEGIDKLTRLKKLFLVNNKISKIENLS-----SLHQLQMLELGSN  196


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQGLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N+++L +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTRLKKLFLVNNKISKIENLSSLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|NP_001269338.1| protein phosphatase 1 regulatory subunit 7 isoform 2 [Homo sapiens]
 ref|XP_003813114.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Pan paniscus]
 ref|XP_004033525.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Gorilla gorilla gorilla]
 ref|XP_004092113.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Nomascus 
leucogenys]
 gb|AAD26610.1| protein phosphatase-1 regulatory subunit 7 alpha2 [Homo sapiens]
 gb|EAW71243.1| protein phosphatase 1, regulatory subunit 7, isoform CRA_a [Homo 
sapiens]
 dbj|BAG57395.1| unnamed protein product [Homo sapiens]
Length=317

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  277  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  41   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  100

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  101  LEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLS  140


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_005339689.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Ictidomys 
tridecemlineatus]
Length=360

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDL-EELK  318

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+   L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  319  GA-HSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQ  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I+
Sbjct  144  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENIS  183


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTQLEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_007427574.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Python 
bivittatus]
Length=365

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/157 (45%), Positives = 103/157 (66%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            ++N+ TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT ++GL+  V L ELYLS
Sbjct  206  IQNIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQSNRLTKIEGLQNLVNLRELYLS  265

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD++AN++  I NI +LT+L++ W+NDN I    D+ E    
Sbjct  266  HNGIEVIEGLENNNKLTMLDIAANRIKKIENITHLTELQEFWMNDNLIECWSDLDELKGA  325

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              +KL T+YLERNP    P Y   +    P+++Q+D+
Sbjct  326  --KKLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  360


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ +K++ +  N++  ++ LE    LE L +S
Sbjct  96   IEGFEVLKKVKTLCLRQNLIKCIENLEQLQTLKELDLYDNQIRKIENLEALTGLEILDIS  155

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N++NL +L+ L L  N I ++++I      
Sbjct  156  FNVLRHVEGLDQLTQLKKLFLVNNKISKIENLSNLQQLQMLELGSNRIRAIQNI-----D  210

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  211  TLTNLDSLFLGKNKITKLQN  230



>ref|XP_006786564.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like isoform 
X1 [Neolamprologus brichardi]
Length=388

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRI-RAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL +LT+LQ L+LG N+I R  NL  L  +  +SIQSNR+T ++GL+  + L ELYL
Sbjct  228  VIENLDSLTSLQSLFLGTNKITRLQNLDALHNLTVLSIQSNRITKIEGLQNLINLRELYL  287

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L  LD++AN++  I NI++LT+L++ W+NDN I +  D+ E   
Sbjct  288  SHNGVEVIEGLENNKKLTTLDIAANRVKKIENISHLTELQEFWMNDNQIDNWSDLDELKN  347

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             +   L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  348  AT--SLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  383


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 79/133 (59%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL +L+ L+EL    N+IR + NL  L  ++++ +  N L  ++GLE+   L++L+L 
Sbjct  141  IENLDSLSALRELDFYDNQIRKLENLHNLTELEQLDVSFNVLRKVEGLEQLTRLKKLFLL  200

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN I  +  L  L  L +L++ +N++  I N+ +LT L+ L+L  N I+ ++++      
Sbjct  201  HNKISSIANLEHLTGLEMLELGSNRIRVIENLDSLTSLQSLFLGTNKITRLQNL-----D  255

Query  400  SLQKLTTLYLERN  362
            +L  LT L ++ N
Sbjct  256  ALHNLTVLSIQSN  268



>ref|XP_004701754.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Echinops 
telfairi]
Length=360

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L +LD+++N++  I NI +LT+L++ W+NDN I S  D+ E   
Sbjct  260  SHNGIEAIEGLESNNKLTMLDIASNRIKKIENINHLTELQEFWMNDNLIESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  320  A--RNLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  355


 Score = 59.7 bits (143),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 78/140 (56%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  M+ L   +ALE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLETLQSLRELDLYDNQIRRMENLGTLMALEVLDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRSIEGLDELTQLKKLFLVNNKISKIENVSNLRQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLDSLFLGKNKITKLQN  225


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 59/100 (59%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LE   +L EL L  N I +ME L TL+ 
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLETLQSLRELDLYDNQIRRMENLGTLMA  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L VLD+S N L +I  +  LT+L+ L+L +N IS +E+++
Sbjct  144  LEVLDISFNLLRSIEGLDELTQLKKLFLVNNKISKIENVS  183



>ref|XP_005654258.1| PREDICTED: protein phosphatase 1, regulatory (inhibitor) subunit 
7 isoform X1 [Sus scrofa]
Length=317

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENVDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLDSNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  277  A--KSLETVYLERNPLQKDPQYRRKILLALPTVRQIDA  312


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLRKVKTLCLRQNLIKCIENLEALQSLRELDLYDNQIRKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I N+++L +L+ L L  N I ++E++      
Sbjct  108  FNLLRSIEGVDKLTRLKKLFLVNNKINKIENLSSLRQLQMLELGSNRIRAIENV-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_008432357.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Poecilia 
reticulata]
Length=345

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L++LQ L+LG N+I  + NL  L  +  +SIQSNR+T ++GL+  V L+ELYL
Sbjct  185  VIENLDALSSLQSLFLGTNKITKLQNLDSLHNLTVLSIQSNRITKIEGLQNLVNLKELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LDV+AN++  I N+++LT+L++ W+NDN I +  D+ E   
Sbjct  245  SHNGIEVIEGLENNKKLTTLDVAANRVKKIENVSHLTELQEFWMNDNQIDNWSDLDE--L  302

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  303  KNAKSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  340


 Score = 70.5 bits (171),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 44/133 (33%), Positives = 81/133 (61%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL++L++LQEL L  N+IR + NL  LK ++ + +  N L  M+ LEE   +++L+L 
Sbjct  98   IENLESLSSLQELDLYDNQIRKLENLSNLKELEMLDVSFNILRKMENLEELTKIKKLFLV  157

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HN +  +  +  L +L +L++ +N++  I N+  L+ L+ L+L  N I+ ++++      
Sbjct  158  HNKVTAISNMDHLTSLEMLELGSNRIRVIENLDALSSLQSLFLGTNKITKLQNL-----D  212

Query  400  SLQKLTTLYLERN  362
            SL  LT L ++ N
Sbjct  213  SLHNLTVLSIQSN  225


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -1

Query  679  GLKCIKK---ISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSAN  509
            GL+ ++K   +S++ N +  ++ LE   +L+EL L  N I K+E LS L  L +LDVS N
Sbjct  78   GLEVLQKAKTLSLRQNLIKKIENLESLSSLQELDLYDNQIRKLENLSNLKELEMLDVSFN  137

Query  508  KLTAISNIANLTKLEDLWLNDNNISSV  428
             L  + N+  LTK++ L+L  N ++++
Sbjct  138  ILRKMENLEELTKIKKLFLVHNKVTAI  164



>ref|XP_009009789.1| hypothetical protein HELRODRAFT_63747, partial [Helobdella robusta]
 gb|ESO13069.1| hypothetical protein HELRODRAFT_63747, partial [Helobdella robusta]
Length=287

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 107/165 (65%), Gaps = 11/165 (7%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENLQ+L NL  L+LG+N+I  I NL   K +  +S+QSNR+  M+ LE  + L++LYLS
Sbjct  121  IENLQSLVNLTSLYLGKNKIDKIENLNVFKNLTILSLQSNRIVRMENLENLINLDQLYLS  180

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIEK+EGL  L  L +LDV+AN++  I N+ +++ LE+ W NDN IS+ +D+   V  
Sbjct  181  HNGIEKIEGLEKLTKLTILDVAANRIKKIENVNHISTLEEFWCNDNQISNWDDLHHLVP-  239

Query  400  SLQKLTTLYLERN--------PCANSPNYISTLRQIFPNIQQVDS  290
             L+KL T+YLERN        P   +P Y   +  + P I+Q+D+
Sbjct  240  -LKKLNTIYLERNIIWMSSDDPEKINPMYRKKIMLVLPWIKQIDA  283


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 51/139 (37%), Positives = 75/139 (54%), Gaps = 5/139 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAINLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSH  578
            +ENL+ LT L+ L L +N I  I       ++++ +  N +T ++ LEE V L  L LS 
Sbjct  12   IENLENLTQLERLCLRQNLIEKIENLHNVSLQELDLYDNVITKIENLEELVNLTILDLSF  71

Query  577  NGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAGS  398
            N I ++E L  L NL  L +  NK++ I N++ LTKL  L L  N I  +E++      S
Sbjct  72   NRISRIENLDVLTNLNKLFLVQNKISKIENLSKLTKLTMLELGSNRIRKIENLQ-----S  126

Query  397  LQKLTTLYLERNPCANSPN  341
            L  LT+LYL +N      N
Sbjct  127  LVNLTSLYLGKNKIDKIEN  145



>ref|XP_004427806.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Ceratotherium simum simum]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LDV++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  260  SHNGIEVIEGLENNNKLTMLDVASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  320  A--KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  355


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+++
Sbjct  144  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENVS  183


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENVSNLRQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_005411198.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Chinchilla lanigera]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + G
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LKG  319

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A-RNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L VLD+S N L  I  I  LT+L+ L+L +N IS +E+++
Sbjct  144  LEVLDISFNLLRNIEGIDKLTQLKKLFLVNNKISKIENLS  183


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTQLKKLFLVNNKISKIENLSNLNQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|NP_001269341.1| protein phosphatase 1 regulatory subunit 7 isoform 5 [Homo sapiens]
Length=344

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  185  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  244

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  245  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  304

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  305  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  339


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  81   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  140

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  141  IEGVDKLTRLKKLFLVNNKISKIENLS  167


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  75   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  134

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  135  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  189

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  190  TLTNLESLFLGKNKITKLQN  209



>ref|XP_006181900.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Camelus 
ferus]
 ref|XP_010986781.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Camelus dromedarius]
Length=346

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  186  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  245

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E   
Sbjct  246  SHNGIEVIEGLDSNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKG  305

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  306  A--RNLETVYLERNPLQRDPQYRRKVMLALPTVRQIDA  341


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  70   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  129

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I+
Sbjct  130  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENIS  169


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  77   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  136

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+ L +L+ L L  N I ++E+I      
Sbjct  137  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENISTLHQLQMLELGSNRIRAIENI-----D  191

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  192  TLTNLESLFLGKNKITKLQN  211



>ref|NP_001009825.1| protein phosphatase 1 regulatory subunit 7 [Rattus norvegicus]
 sp|Q5HZV9.1|PP1R7_RAT RecName: Full=Protein phosphatase 1 regulatory subunit 7; AltName: 
Full=Protein phosphatase 1 regulatory subunit 22 [Rattus 
norvegicus]
 gb|AAH88868.1| Protein phosphatase 1, regulatory (inhibitor) subunit 7 [Rattus 
norvegicus]
 gb|EDL91950.1| protein phosphatase 1, regulatory (inhibitor) subunit 7, isoform 
CRA_a [Rattus norvegicus]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 108/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLESLFLGKNKITKLQNLDALSNLTVLSMQSNRLTKIEGLQNLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + 
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LK  318

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  319  GA-RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKSLCLRQNLIKCIENLDELQSLRELDLYDNQIKKIENLEALTELEVLDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+ L +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTQLKKLFLVNNKINKIENISTLQQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_007559514.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Poecilia 
formosa]
Length=345

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+ENL  L++LQ L+LG N+I  + NL  L  +  +SIQSNR+T ++GL+  V L+ELYL
Sbjct  185  VIENLDALSSLQSLFLGTNKITKLQNLDSLHNLTVLSIQSNRITKIEGLQNLVNLKELYL  244

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L  LDV+AN++  I N+++LT+L++ W+NDN I +  D+ E   
Sbjct  245  SHNGIEVIEGLENNKKLTTLDVAANRVKKIENVSHLTELQEFWMNDNQIDNWSDLDE--L  302

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
             + + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  303  KNAKSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  340



>ref|XP_008250383.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Oryctolagus cuniculus]
Length=346

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  187  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  246

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E    
Sbjct  247  HNGIEVIEGLDNNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLDSWSDLDELKGA  306

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  307  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  341


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/133 (35%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAINLCG-LKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            ME +    + +++ L   RI  I   G LK +K + ++ N +  ++ LEE  +L EL L 
Sbjct  55   METINLDRDAEDVDLNHYRIGKIEGFGVLKKVKTLCLRQNLIKCIENLEELQSLRELDLY  114

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N I K+E L +L  L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I     G
Sbjct  115  DNQIRKIENLESLAELEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENI-----G  169

Query  400  SLQKLTTLYLERN  362
            +L +L  L L  N
Sbjct  170  TLHQLQMLELGSN  182


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 73/140 (52%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E    L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  77   IEGFGVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIRKIENLESLAELEILDIS  136

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI  L +L+ L L  N I ++E+I      
Sbjct  137  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENIGTLHQLQMLELGSNRIRAIENI-----D  191

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  192  TLTNLESLFLGKNKITKLQN  211



>ref|XP_008499068.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Calypte 
anna]
Length=355

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 103/158 (65%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            V+EN+ TL NL  L+LG+N+I  I NL  L  +  +SIQ+NRLT ++GL+  V L ELY+
Sbjct  195  VIENIDTLANLDSLFLGKNKITKIQNLDALTNLTVLSIQNNRLTKIEGLQSLVNLRELYI  254

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  255  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLVESWSDLDELKG  314

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P I+Q+D+
Sbjct  315  A--KNLETVYLERNPLQKDPQYRRKIMLALPTIRQIDA  350


 Score = 57.0 bits (136),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 44/140 (31%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE  V LE L +S
Sbjct  86   IEGFEVLKKVKTLCLRQNLIKHIENLEQLQTLRELDLYDNQIQKIENLESLVELEILDIS  145

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N+ NL  L+ L L  N I  +E+I      
Sbjct  146  FNVLRHIEGLDRLTQLKKLFLVNNKISKIENLNNLQMLQMLELGSNRIRVIENI-----D  200

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  201  TLANLDSLFLGKNKITKIQN  220



>ref|XP_003936819.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Saimiri boliviensis boliviensis]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRNIEGVDKLTQLKKLFLVNNKISKIENLS  183


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_006209213.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Vicugna pacos]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E   
Sbjct  260  SHNGIEVIEGLDSNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  320  A--RNLETVYLERNPLQRDPQYRRKVMLALPTVRQIDA  355


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I+
Sbjct  144  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENIS  183


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+ L +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENISTLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|NP_001230831.1| protein phosphatase 1, regulatory (inhibitor) subunit 7 [Sus 
scrofa]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENVDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL +   L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E    
Sbjct  261  HNGIEVIEGLDSNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKGA  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  321  --KSLETVYLERNPLQKDPQYRRKILLALPTVRQIDA  355


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/140 (29%), Positives = 76/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLRKVKTLCLRQNLIKCIGNLEALQSLRELDLYDNQIRKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I N+++L +L+ L L  N I ++E++      
Sbjct  151  FNLLRSIEGVDKLTRLKKLFLVNNKINKIENLSSLRQLQMLELGSNRIRAIENV-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_006034956.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Alligator 
sinensis]
Length=380

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL  L+LG+N+I  + NL  L  +  +SIQSNRLT ++GL+  V L ELYL
Sbjct  220  AIENIDTLTNLDSLFLGKNKITKLQNLDALTNLTVLSIQSNRLTKIEGLQNLVNLRELYL  279

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNG+E +EGL     L +LD+++N++  I NI++LT+L++ W+NDN I S  D+ E   
Sbjct  280  SHNGVEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLIESWSDLDELKG  339

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  340  A--KNLETVYLERNPLQKDPQYRRKIMLALPSVRQIDA  375


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  111  IEGFEVLKKVKILCLRQNLIKHIANLEQLQTLRELDLYDNQIRKIENLESLTELEILDIS  170

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EGL  L  L+ L +  NK++ I N+++L +L+ L L  N I ++E+I      
Sbjct  171  FNILRCIEGLDRLTQLKKLFLVNNKISKIENLSSLQQLQMLELGSNRIRAIENI-----D  225

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  226  TLTNLDSLFLGKNKITKLQN  245



>ref|XP_006989655.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Peromyscus maniculatus bairdii]
Length=360

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A--RNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 56.6 bits (135),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I+
Sbjct  144  LEILDISFNLLRNIEGIDKLTQLKKLFLVNNKINKIENIS  183


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+ L +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDKLTQLKKLFLVNNKINKIENISTLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_010986780.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Camelus dromedarius]
Length=350

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  190  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  249

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL +   L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E   
Sbjct  250  SHNGIEVIEGLDSNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKG  309

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  310  A--RNLETVYLERNPLQRDPQYRRKVMLALPTVRQIDA  345


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  74   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  133

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N I+ +E+I+
Sbjct  134  LEILDISFNLLRNIEGIDKLTRLKKLFLVNNKINKIENIS  173


 Score = 53.9 bits (128),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 75/140 (54%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  81   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  140

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI+ L +L+ L L  N I ++E+I      
Sbjct  141  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENISTLHQLQMLELGSNRIRAIENI-----D  195

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  196  TLTNLESLFLGKNKITKLQN  215



>ref|XP_009442992.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Pan troglodytes]
Length=344

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  185  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  244

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  245  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  304

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  305  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  339


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  81   LKKVKNLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  140

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  141  IEGVDKLTRLKKLFLVNNKISKIENLS  167


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  75   IEGFEVLKKVKNLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  134

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  135  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  189

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  190  TLTNLESLFLGKNKITKLQN  209



>ref|XP_005636024.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Canis lupus familiaris]
Length=364

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLT+L+ L+LG+N+I  + NL  L  +  +S+QSNRLT M+GL+  V L ELYL
Sbjct  204  AIENIDTLTSLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKMEGLQSLVNLRELYL  263

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I N+++LT+L++ W+NDN + S  D+ E  A
Sbjct  264  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENVSHLTELQEFWMNDNLLESWSDLDELKA  323

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P ++Q+D+
Sbjct  324  A--KSLETVYLERNPLQKDPQYRRKIMLALPTVRQIDA  359


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/133 (32%), Positives = 76/133 (57%), Gaps = 6/133 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  95   IEGFEVLKKVKTLCLRQNLIKCIENLGELQSLRELDLYDNQIKKIENLEALTHLEILDIS  154

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  LR L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  155  FNLLRNIEGVDKLTRLRKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  209

Query  400  SLQKLTTLYLERN  362
            +L  L +L+L +N
Sbjct  210  TLTSLESLFLGKN  222



>ref|XP_009236626.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Pongo abelii]
Length=360

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  200  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  259

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  260  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  319

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRNIEGVDKLTQLKKLFLVNNKISKIENLS  183


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_007374707.1| hypothetical protein SPAPADRAFT_60516, partial [Spathaspora passalidarum 
NRRL Y-27907]
 gb|EGW33192.1| hypothetical protein SPAPADRAFT_60516, partial [Spathaspora passalidarum 
NRRL Y-27907]
Length=352

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 2/135 (1%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +ENL    N+++LWLG+NRI    NL  +  ++ +SIQSNR+T ++GLE  + LEELYLS
Sbjct  207  IENLDNNVNIEQLWLGKNRIYKFENLNHMVNLRVLSIQSNRITKIEGLENLINLEELYLS  266

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIEK+E L   VNL+VLDV++NKL  I N+ +LTKL D W + N ISS E+I + + G
Sbjct  267  HNGIEKIENLEHNVNLQVLDVTSNKLKHIENLKHLTKLTDFWCSYNQISSFEEIGKEL-G  325

Query  400  SLQKLTTLYLERNPC  356
             L++L T+Y E NP 
Sbjct  326  KLEELDTVYFEGNPV  340


 Score = 55.8 bits (133),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/110 (34%), Positives = 56/110 (51%), Gaps = 2/110 (2%)
 Frame = -1

Query  730  LQELWLGRNRIRAIN--LCGLKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKME  557
            L EL L  NRI  I+  +  L  +K +    N + ++K +E  V LE LY   N I+ ++
Sbjct  127  LTELDLYDNRINHISSSIKHLTKLKNLDFSFNLIKNIKNIETLVELENLYFVQNKIKHIQ  186

Query  556  GLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAV  407
             L  L  L+ L++  NK+  I N+ N   +E LWL  N I   E++   V
Sbjct  187  NLENLTKLKNLELGGNKIEKIENLDNNVNIEQLWLGKNRIYKFENLNHMV  236



>ref|XP_005077259.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Mesocricetus auratus]
Length=317

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 107/158 (68%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT L++ W+NDN + S  D+ E + 
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTDLQEFWMNDNLLESWSDLDE-LK  275

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            G+ + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  276  GA-RNLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  312


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 41/105 (39%), Positives = 61/105 (58%), Gaps = 5/105 (5%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L VLD+S N L  
Sbjct  54   LKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDISFNLLRN  113

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIAEAVAGSLQKLTTLYLERN  362
            I  I  LT+L+ L+L +N I+ +E+I     G+L +L  L L  N
Sbjct  114  IEGIDKLTRLKKLFLVNNKINKIENI-----GTLHQLQMLELGSN  153


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 74/140 (53%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKSLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEVLDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK+  I NI  L +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTRLKKLFLVNNKINKIENIGTLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLESLFLGKNKITKLQN  182



>ref|XP_010604935.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Fukomys damarensis]
Length=360

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + G
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LKG  319

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  320  A-RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  I  LT+L+ L+L +N IS +E+I+
Sbjct  144  LEILDISFNLLRNIEGIDQLTQLKKLFLVNNKISKIENIS  183


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/140 (31%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I NI+NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGIDQLTQLKKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_008998061.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Callithrix 
jacchus]
Length=361

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/157 (45%), Positives = 108/157 (69%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  202  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  261

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E + G
Sbjct  262  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDE-LKG  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
            + + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  321  A-RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  356


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 75/141 (53%), Gaps = 7/141 (5%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAINLC--GLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
            +E  + L  ++ L L +N I+ I      L+ ++++ +  N++  ++ LE    LE L +
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIERVVEELQSLRELDLXDNQIKKIENLEALTELEILDI  150

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            S N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I     
Sbjct  151  SFNLLRNIEGVDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----  205

Query  403  GSLQKLTTLYLERNPCANSPN  341
             +L  L +L+L +N      N
Sbjct  206  DTLTNLESLFLGKNKITKLQN  226



>ref|NP_002703.1| protein phosphatase 1 regulatory subunit 7 isoform 1 [Homo sapiens]
 ref|XP_003813113.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Pan paniscus]
 ref|XP_004033524.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Gorilla gorilla gorilla]
 sp|Q15435.1|PP1R7_HUMAN RecName: Full=Protein phosphatase 1 regulatory subunit 7; AltName: 
Full=Protein phosphatase 1 regulatory subunit 22 [Homo 
sapiens]
 emb|CAA90626.1| yeast sds22 homolog [Homo sapiens]
 gb|AAD26611.1| protein phosphatase-1 regulatory subunit 7 alpha1 [Homo sapiens]
 gb|AAH00910.1| Protein phosphatase 1, regulatory (inhibitor) subunit 7 [Homo 
sapiens]
 gb|AAV38936.1| protein phosphatase 1, regulatory subunit 7 [Homo sapiens]
 gb|AAX41197.1| protein phosphatase 1 regulatory subunit 7 [synthetic construct]
 gb|EAW71244.1| protein phosphatase 1, regulatory subunit 7, isoform CRA_b [Homo 
sapiens]
 dbj|BAG11439.1| protein phosphatase 1 regulatory subunit 7 [synthetic construct]
 prf||2124310A sds22 gene
Length=360

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  321  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLS  183


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_003278941.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Nomascus leucogenys]
Length=360

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  321  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 56.6 bits (135),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 58/100 (58%), Gaps = 3/100 (3%)
 Frame = -1

Query  706  NRIRAINLCGLKCIKKIS---IQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVN  536
            N  R   + G + +KK+    ++ N +  ++ LEE  +L EL L  N I+K+E L  L  
Sbjct  84   NHYRIGKIEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTE  143

Query  535  LRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIA  416
            L +LD+S N L  I  +  LT+L+ L+L +N IS +E+++
Sbjct  144  LEILDISFNLLRNIEGVDKLTRLKKLFLVNNKISKIENLS  183


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_001158701.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Pan troglodytes]
Length=360

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/157 (44%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYLS
Sbjct  201  IENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYLS  260

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
            HNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E    
Sbjct  261  HNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKGA  320

Query  400  SLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
              + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  321  --RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  355


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  97   LKKVKNLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  156

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  157  IEGVDKLTRLKKLFLVNNKISKIENLS  183


 Score = 56.2 bits (134),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  91   IEGFEVLKKVKNLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  150

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  151  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  205

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  206  TLTNLESLFLGKNKITKLQN  225



>ref|XP_005574921.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Macaca fascicularis]
 ref|XP_010375306.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Rhinopithecus roxellana]
Length=332

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 105/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNL+ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  172  AIENIDTLTNLESLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQNLVNLRELYL  231

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  232  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  291

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLERNP    P Y   +    P+++Q+D+
Sbjct  292  A--RSLETVYLERNPLQKDPQYRRKVMLALPSVRQIDA  327


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  69   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  128

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  +  LT+L+ L+L +N IS +E+++
Sbjct  129  IEGVDKLTRLKKLFLVNNKISKIENLS  155


 Score = 55.8 bits (133),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  63   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  122

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  123  FNLLRNIEGVDKLTRLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  177

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  178  TLTNLESLFLGKNKITKLQN  197



>ref|XP_005005742.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Cavia porcellus]
Length=317

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 104/158 (66%), Gaps = 3/158 (2%)
 Frame = -1

Query  760  VMENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYL  584
             +EN+ TLTNLQ L+LG+N+I  + NL  L  +  +S+QSNRLT ++GL+  V L ELYL
Sbjct  157  AIENIDTLTNLQSLFLGKNKITKLQNLDALTNLTVLSMQSNRLTKIEGLQSLVNLRELYL  216

Query  583  SHNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVA  404
            SHNGIE +EGL     L +LD+++N++  I NI++LT+L++ W+NDN + S  D+ E   
Sbjct  217  SHNGIEVIEGLENNNKLTMLDIASNRIKKIENISHLTELQEFWMNDNLLESWSDLDELKG  276

Query  403  GSLQKLTTLYLERNPCANSPNYISTLRQIFPNIQQVDS  290
               + L T+YLE NP    P Y   +    P+++Q+D+
Sbjct  277  A--RSLETVYLEHNPLQRDPQYRRKVMLALPSVRQIDA  312


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = -1

Query  676  LKCIKKISIQSNRLTSMKGLEECVALEELYLSHNGIEKMEGLSTLVNLRVLDVSANKLTA  497
            LK +K + ++ N +  ++ LEE  +L EL L  N I+K+E L  L  L +LD+S N L  
Sbjct  54   LKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDISFNLLRN  113

Query  496  ISNIANLTKLEDLWLNDNNISSVEDIA  416
            I  I  LT+L+ L+L +N IS +E+++
Sbjct  114  IEGIDKLTQLKKLFLVNNKISKIENLS  140


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 77/140 (55%), Gaps = 6/140 (4%)
 Frame = -1

Query  757  MENLQTLTNLQELWLGRNRIRAI-NLCGLKCIKKISIQSNRLTSMKGLEECVALEELYLS  581
            +E  + L  ++ L L +N I+ I NL  L+ ++++ +  N++  ++ LE    LE L +S
Sbjct  48   IEGFEVLKKVKTLCLRQNLIKCIENLEELQSLRELDLYDNQIKKIENLEALTELEILDIS  107

Query  580  HNGIEKMEGLSTLVNLRVLDVSANKLTAISNIANLTKLEDLWLNDNNISSVEDIAEAVAG  401
             N +  +EG+  L  L+ L +  NK++ I N++NL +L+ L L  N I ++E+I      
Sbjct  108  FNLLRNIEGIDKLTQLKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI-----D  162

Query  400  SLQKLTTLYLERNPCANSPN  341
            +L  L +L+L +N      N
Sbjct  163  TLTNLQSLFLGKNKITKLQN  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427696849470