BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038J11

Length=719
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007211435.1|  hypothetical protein PRUPE_ppa007161mg             243   1e-74   Prunus persica
ref|XP_008225315.1|  PREDICTED: shaggy-related protein kinase eta       242   2e-74   Prunus mume [ume]
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   242   3e-74   Citrus sinensis [apfelsine]
gb|KDO63406.1|  hypothetical protein CISIN_1g014750mg                   242   3e-74   Citrus sinensis [apfelsine]
ref|XP_003540001.1|  PREDICTED: shaggy-related protein kinase zet...    242   6e-74   Glycine max [soybeans]
ref|XP_006446814.1|  hypothetical protein CICLE_v10015375mg             242   9e-74   Citrus clementina [clementine]
ref|XP_003527338.1|  PREDICTED: shaggy-related protein kinase zet...    242   9e-74   Glycine max [soybeans]
gb|KDO63402.1|  hypothetical protein CISIN_1g014750mg                   241   1e-73   Citrus sinensis [apfelsine]
gb|KHN33940.1|  Shaggy-related protein kinase zeta                      241   1e-73   Glycine soja [wild soybean]
ref|XP_006468992.1|  PREDICTED: shaggy-related protein kinase zet...    241   1e-73   Citrus sinensis [apfelsine]
ref|XP_008383613.1|  PREDICTED: shaggy-related protein kinase eta       240   1e-73   
gb|KDO77890.1|  hypothetical protein CISIN_1g016950mg                   239   3e-73   Citrus sinensis [apfelsine]
ref|XP_006449528.1|  hypothetical protein CICLE_v10015608mg             239   3e-73   
gb|KDO77891.1|  hypothetical protein CISIN_1g016950mg                   238   3e-73   Citrus sinensis [apfelsine]
gb|KDO77889.1|  hypothetical protein CISIN_1g016950mg                   239   3e-73   Citrus sinensis [apfelsine]
ref|XP_006467630.1|  PREDICTED: shaggy-related protein kinase eta...    239   4e-73   Citrus sinensis [apfelsine]
ref|XP_006449527.1|  hypothetical protein CICLE_v10015608mg             239   4e-73   Citrus clementina [clementine]
gb|KDO77892.1|  hypothetical protein CISIN_1g016950mg                   236   4e-73   Citrus sinensis [apfelsine]
gb|AES66964.2|  shaggy-like kinase dzeta                                238   6e-73   Medicago truncatula
ref|XP_011082988.1|  PREDICTED: shaggy-related protein kinase eta       239   8e-73   Sesamum indicum [beniseed]
gb|AES66963.2|  shaggy-like kinase dzeta                                239   9e-73   Medicago truncatula
ref|XP_007048725.1|  SHAGGY-related protein kinase dZeta isoform 1      239   1e-72   Theobroma cacao [chocolate]
ref|XP_003596712.1|  Shaggy-related protein kinase                      239   1e-72   
gb|KHN34245.1|  Shaggy-related protein kinase zeta                      241   1e-72   Glycine soja [wild soybean]
ref|XP_003596713.1|  Shaggy-related protein kinase                      235   1e-72   
ref|XP_009352741.1|  PREDICTED: shaggy-related protein kinase eta...    237   1e-72   Pyrus x bretschneideri [bai li]
ref|XP_003633016.1|  PREDICTED: shaggy-related protein kinase eta...    236   4e-72   Vitis vinifera
ref|XP_010655538.1|  PREDICTED: shaggy-related protein kinase eta...    236   4e-72   Vitis vinifera
ref|XP_004487575.1|  PREDICTED: shaggy-related protein kinase zet...    237   5e-72   Cicer arietinum [garbanzo]
gb|AGJ98225.1|  BIN2-like protein PSK8                                  237   6e-72   Petunia x hybrida [garden petunia]
ref|XP_011466967.1|  PREDICTED: shaggy-related protein kinase zet...    235   7e-72   Fragaria vesca subsp. vesca
ref|XP_003522493.1|  PREDICTED: shaggy-related protein kinase eta...    236   8e-72   
ref|XP_010538570.1|  PREDICTED: shaggy-related protein kinase eta...    235   9e-72   Tarenaya hassleriana [spider flower]
emb|CAA72330.1|  shaggy-like kinase                                     232   9e-72   Ricinus communis
emb|CAN73053.1|  hypothetical protein VITISV_015513                     237   9e-72   Vitis vinifera
gb|KHN29604.1|  Shaggy-related protein kinase eta                       235   9e-72   Glycine soja [wild soybean]
ref|XP_002305736.1|  hypothetical protein POPTR_0004s05770g             235   1e-71   
gb|ABK95578.1|  unknown                                                 235   1e-71   Populus trichocarpa [western balsam poplar]
ref|XP_011466966.1|  PREDICTED: shaggy-related protein kinase zet...    235   1e-71   Fragaria vesca subsp. vesca
ref|XP_010538571.1|  PREDICTED: shaggy-related protein kinase eta...    235   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_008228935.1|  PREDICTED: shaggy-related protein kinase zet...    235   1e-71   Prunus mume [ume]
ref|XP_009351457.1|  PREDICTED: shaggy-related protein kinase eta       235   1e-71   Pyrus x bretschneideri [bai li]
ref|XP_007215447.1|  hypothetical protein PRUPE_ppa006349mg             236   2e-71   Prunus persica
ref|XP_010518815.1|  PREDICTED: shaggy-related protein kinase eta...    234   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_010518816.1|  PREDICTED: shaggy-related protein kinase eta...    234   2e-71   Tarenaya hassleriana [spider flower]
ref|XP_002522231.1|  Glycogen synthase kinase-3 beta, putative          234   2e-71   Ricinus communis
ref|XP_006348884.1|  PREDICTED: shaggy-related protein kinase zet...    236   2e-71   Solanum tuberosum [potatoes]
ref|XP_010052816.1|  PREDICTED: shaggy-related protein kinase eta       235   2e-71   Eucalyptus grandis [rose gum]
ref|XP_010999759.1|  PREDICTED: shaggy-related protein kinase eta       234   3e-71   Populus euphratica
ref|XP_004243275.1|  PREDICTED: shaggy-related protein kinase eta...    236   3e-71   Solanum lycopersicum
ref|XP_010246462.1|  PREDICTED: shaggy-related protein kinase eta       234   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_004303195.1|  PREDICTED: shaggy-related protein kinase eta...    235   4e-71   Fragaria vesca subsp. vesca
ref|XP_008228934.1|  PREDICTED: shaggy-related protein kinase eta...    234   5e-71   Prunus mume [ume]
ref|XP_009593781.1|  PREDICTED: shaggy-related protein kinase zet...    233   6e-71   
ref|XP_010529206.1|  PREDICTED: shaggy-related protein kinase eta...    233   7e-71   Tarenaya hassleriana [spider flower]
ref|XP_010529205.1|  PREDICTED: shaggy-related protein kinase eta...    233   7e-71   Tarenaya hassleriana [spider flower]
ref|XP_008371494.1|  PREDICTED: shaggy-related protein kinase eta...    233   7e-71   Malus domestica [apple tree]
ref|XP_010657061.1|  PREDICTED: shaggy-related protein kinase eta...    234   9e-71   Vitis vinifera
ref|XP_008345980.1|  PREDICTED: shaggy-related protein kinase eta       233   1e-70   
ref|XP_004293965.1|  PREDICTED: shaggy-related protein kinase eta       233   1e-70   Fragaria vesca subsp. vesca
gb|KHN07046.1|  Shaggy-related protein kinase eta                       233   1e-70   Glycine soja [wild soybean]
ref|XP_003526266.1|  PREDICTED: shaggy-related protein kinase eta...    233   1e-70   Glycine max [soybeans]
ref|XP_008343095.1|  PREDICTED: shaggy-related protein kinase zet...    232   1e-70   Malus domestica [apple tree]
ref|XP_002317404.1|  GSK3/SHAGGY-LIKE protein KINASE 1                  232   1e-70   Populus trichocarpa [western balsam poplar]
ref|XP_004485912.1|  PREDICTED: shaggy-related protein kinase eta...    232   2e-70   Cicer arietinum [garbanzo]
ref|XP_009378930.1|  PREDICTED: shaggy-related protein kinase zet...    232   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_010510261.1|  PREDICTED: shaggy-related protein kinase zeta      233   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010469777.1|  PREDICTED: shaggy-related protein kinase zet...    233   2e-70   Camelina sativa [gold-of-pleasure]
gb|AGJ98224.1|  BIN2-like protein PSK9                                  231   3e-70   Petunia x hybrida [garden petunia]
ref|XP_007136978.1|  hypothetical protein PHAVU_009G089900g             231   3e-70   Phaseolus vulgaris [French bean]
ref|XP_006643888.1|  PREDICTED: shaggy-related protein kinase eta...    230   3e-70   
ref|XP_009593779.1|  PREDICTED: shaggy-related protein kinase eta...    233   4e-70   Nicotiana tomentosiformis
gb|AGV54503.1|  shaggy-related protein kinase eta-like protein          231   4e-70   Phaseolus vulgaris [French bean]
ref|XP_009588662.1|  PREDICTED: shaggy-related protein kinase eta...    231   4e-70   Nicotiana tomentosiformis
ref|XP_007132829.1|  hypothetical protein PHAVU_011G128000g             232   5e-70   Phaseolus vulgaris [French bean]
ref|XP_008343093.1|  PREDICTED: shaggy-related protein kinase eta...    232   5e-70   Malus domestica [apple tree]
ref|XP_009801781.1|  PREDICTED: shaggy-related protein kinase eta...    232   5e-70   Nicotiana sylvestris
ref|XP_009378929.1|  PREDICTED: shaggy-related protein kinase eta...    232   6e-70   Pyrus x bretschneideri [bai li]
ref|XP_010414192.1|  PREDICTED: shaggy-related protein kinase zet...    231   6e-70   Camelina sativa [gold-of-pleasure]
ref|NP_180655.1|  Shaggy-related protein kinase zeta                    231   7e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011039408.1|  PREDICTED: shaggy-related protein kinase eta...    231   7e-70   Populus euphratica
gb|KJB68374.1|  hypothetical protein B456_010G241600                    231   7e-70   Gossypium raimondii
gb|AAM65084.1|  putative shaggy-like protein kinase dzeta               231   7e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KJB68372.1|  hypothetical protein B456_010G241600                    230   7e-70   Gossypium raimondii
ref|XP_004233047.1|  PREDICTED: shaggy-related protein kinase eta       230   8e-70   
gb|KJB34901.1|  hypothetical protein B456_006G089300                    229   9e-70   Gossypium raimondii
emb|CAA64408.1|  shaggy-like kinase dzeta                               231   1e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010274430.1|  PREDICTED: shaggy-related protein kinase eta...    231   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_002526643.1|  Glycogen synthase kinase-3 beta, putative          226   1e-69   
gb|KJB34899.1|  hypothetical protein B456_006G089300                    230   1e-69   Gossypium raimondii
gb|KJB34900.1|  hypothetical protein B456_006G089300                    230   1e-69   Gossypium raimondii
ref|XP_008789340.1|  PREDICTED: shaggy-related protein kinase eta       231   1e-69   Phoenix dactylifera
ref|XP_010104417.1|  Shaggy-related protein kinase zeta                 231   2e-69   
ref|XP_010915474.1|  PREDICTED: shaggy-related protein kinase eta...    230   2e-69   Elaeis guineensis
gb|KCW47358.1|  hypothetical protein EUGRSUZ_K01144                     229   2e-69   Eucalyptus grandis [rose gum]
ref|XP_009781118.1|  PREDICTED: shaggy-related protein kinase eta       229   2e-69   Nicotiana sylvestris
gb|AFK40474.1|  unknown                                                 229   2e-69   Medicago truncatula
ref|XP_010035873.1|  PREDICTED: shaggy-related protein kinase eta...    230   2e-69   Eucalyptus grandis [rose gum]
ref|XP_009136953.1|  PREDICTED: shaggy-related protein kinase eta...    229   3e-69   Brassica rapa
gb|ACJ84750.1|  unknown                                                 229   3e-69   Medicago truncatula
emb|CDX78886.1|  BnaA01g09530D                                          229   3e-69   
emb|CDY70859.1|  BnaAnng35300D                                          229   3e-69   Brassica napus [oilseed rape]
ref|XP_009132133.1|  PREDICTED: shaggy-related protein kinase eta       229   3e-69   Brassica rapa
ref|XP_002870026.1|  hypothetical protein ARALYDRAFT_914806             229   3e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_010925615.1|  PREDICTED: shaggy-related protein kinase eta...    229   3e-69   Elaeis guineensis
emb|CDY69647.1|  BnaAnng31110D                                          227   4e-69   Brassica napus [oilseed rape]
ref|XP_010449479.1|  PREDICTED: shaggy-related protein kinase eta       228   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002881146.1|  hypothetical protein ARALYDRAFT_902112             229   4e-69   Arabidopsis lyrata subsp. lyrata
ref|XP_007148029.1|  hypothetical protein PHAVU_006G1745001g            220   5e-69   Phaseolus vulgaris [French bean]
ref|XP_010439822.1|  PREDICTED: shaggy-related protein kinase eta...    228   5e-69   Camelina sativa [gold-of-pleasure]
ref|XP_008794094.1|  PREDICTED: shaggy-related protein kinase eta       229   6e-69   Phoenix dactylifera
emb|CDY34051.1|  BnaC03g62810D                                          228   6e-69   Brassica napus [oilseed rape]
ref|XP_009770234.1|  PREDICTED: shaggy-related protein kinase eta...    228   6e-69   Nicotiana sylvestris
gb|KHG08917.1|  Shaggy-related protein kinase eta                       228   6e-69   Gossypium arboreum [tree cotton]
dbj|BAH20356.1|  AT4G18710                                              226   6e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108386.1|  PREDICTED: shaggy-related protein kinase eta...    228   6e-69   Brassica rapa
ref|XP_009619543.1|  PREDICTED: shaggy-related protein kinase eta       228   7e-69   Nicotiana tomentosiformis
ref|XP_008790026.1|  PREDICTED: shaggy-related protein kinase eta...    228   8e-69   Phoenix dactylifera
emb|CAA64409.1|  shaggy-like kinase etha                                228   8e-69   Arabidopsis thaliana [mouse-ear cress]
ref|NP_193606.1|  Shaggy-related protein kinase eta                     228   9e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006285118.1|  hypothetical protein CARUB_v10006451mg             228   9e-69   Capsella rubella
dbj|BAH57105.1|  AT4G18710                                              228   9e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008439730.1|  PREDICTED: shaggy-related protein kinase eta       228   1e-68   Cucumis melo [Oriental melon]
ref|XP_004134656.1|  PREDICTED: shaggy-related protein kinase eta...    227   1e-68   Cucumis sativus [cucumbers]
gb|AFK46922.1|  unknown                                                 227   1e-68   Lotus japonicus
ref|XP_009144602.1|  PREDICTED: shaggy-related protein kinase zet...    226   1e-68   
gb|KFK31745.1|  hypothetical protein AALP_AA6G153600                    228   1e-68   Arabis alpina [alpine rockcress]
ref|XP_008365741.1|  PREDICTED: shaggy-related protein kinase eta...    228   1e-68   
ref|NP_001042341.1|  Os01g0205700                                       222   2e-68   
ref|XP_010496879.1|  PREDICTED: shaggy-related protein kinase eta...    227   2e-68   Camelina sativa [gold-of-pleasure]
emb|CDX99437.1|  BnaC01g11150D                                          226   2e-68   
dbj|BAJ33611.1|  unnamed protein product                                226   3e-68   Eutrema halophilum
gb|EMS65432.1|  Shaggy-related protein kinase iota                      227   3e-68   Triticum urartu
emb|CDY64921.1|  BnaC07g50210D                                          226   3e-68   Brassica napus [oilseed rape]
ref|XP_009365289.1|  PREDICTED: shaggy-related protein kinase zet...    226   3e-68   Pyrus x bretschneideri [bai li]
ref|XP_002889601.1|  hypothetical protein ARALYDRAFT_470656             227   3e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_006594547.1|  PREDICTED: shaggy-related protein kinase eta...    226   3e-68   
ref|XP_003542973.1|  PREDICTED: shaggy-related protein kinase eta...    226   4e-68   Glycine max [soybeans]
ref|XP_008448254.1|  PREDICTED: shaggy-related protein kinase zet...    225   6e-68   
gb|KHG20434.1|  Shaggy-related protein kinase eta                       225   6e-68   Gossypium arboreum [tree cotton]
gb|AGK41246.1|  SHAGGY-like kinase                                      226   7e-68   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010557132.1|  PREDICTED: shaggy-related protein kinase zet...    226   7e-68   Tarenaya hassleriana [spider flower]
ref|XP_004234083.1|  PREDICTED: shaggy-related protein kinase eta...    225   8e-68   Solanum lycopersicum
ref|XP_010920339.1|  PREDICTED: shaggy-related protein kinase eta       226   8e-68   Elaeis guineensis
gb|EMS48919.1|  Shaggy-related protein kinase eta                       224   9e-68   Triticum urartu
gb|AGJ93558.1|  SHAGGY-like kinase                                      226   9e-68   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010317426.1|  PREDICTED: shaggy-related protein kinase eta...    225   1e-67   Solanum lycopersicum
ref|XP_009392422.1|  PREDICTED: shaggy-related protein kinase eta...    226   1e-67   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT26120.1|  Shaggy-related protein kinase iota                      226   1e-67   
emb|CDM82043.1|  unnamed protein product                                225   1e-67   Triticum aestivum [Canadian hard winter wheat]
gb|EYU43326.1|  hypothetical protein MIMGU_mgv1a008172mg                225   1e-67   Erythranthe guttata [common monkey flower]
ref|XP_009365288.1|  PREDICTED: shaggy-related protein kinase eta...    226   1e-67   Pyrus x bretschneideri [bai li]
ref|XP_006367136.1|  PREDICTED: shaggy-related protein kinase eta...    225   1e-67   Solanum tuberosum [potatoes]
dbj|BAA92966.1|  putative shaggy-like kinase dzeta                      225   1e-67   Oryza sativa Japonica Group [Japonica rice]
gb|AAL77705.1|  AT4g18710/F28A21_120                                    224   1e-67   Arabidopsis thaliana [mouse-ear cress]
gb|ACN27271.1|  unknown                                                 218   1e-67   Zea mays [maize]
gb|EEC70138.1|  hypothetical protein OsI_00828                          225   2e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_011085977.1|  PREDICTED: shaggy-related protein kinase eta...    224   2e-67   Sesamum indicum [beniseed]
ref|XP_011085978.1|  PREDICTED: shaggy-related protein kinase eta...    224   2e-67   
ref|XP_004968576.1|  PREDICTED: shaggy-related protein kinase iot...    225   2e-67   Setaria italica
emb|CDY66894.1|  BnaCnng52760D                                          224   2e-67   Brassica napus [oilseed rape]
gb|AGJ93554.1|  SHAGGY-like kinase                                      224   2e-67   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010475366.1|  PREDICTED: shaggy-related protein kinase iot...    225   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010924595.1|  PREDICTED: shaggy-related protein kinase eta...    224   2e-67   Elaeis guineensis
ref|XP_009141120.1|  PREDICTED: shaggy-related protein kinase zeta      225   2e-67   Brassica rapa
dbj|BAJ91341.1|  predicted protein                                      224   3e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008448253.1|  PREDICTED: shaggy-related protein kinase eta...    225   3e-67   Cucumis melo [Oriental melon]
gb|AGK41245.1|  SHAGGY-like kinase                                      224   3e-67   Triticum aestivum [Canadian hard winter wheat]
gb|ACG34459.1|  shaggy-related protein kinase eta                       224   3e-67   Zea mays [maize]
ref|XP_010457765.1|  PREDICTED: shaggy-related protein kinase iota      224   4e-67   Camelina sativa [gold-of-pleasure]
gb|KFK42959.1|  hypothetical protein AALP_AA1G061200                    224   4e-67   Arabis alpina [alpine rockcress]
gb|EYU30768.1|  hypothetical protein MIMGU_mgv1a006689mg                225   4e-67   Erythranthe guttata [common monkey flower]
dbj|BAH19519.1|  AT1G06390                                              224   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172127.1|  shaggy-related protein kinase iota                    224   5e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KJB34905.1|  hypothetical protein B456_006G089400                    222   5e-67   Gossypium raimondii
ref|XP_010231609.1|  PREDICTED: shaggy-related protein kinase eta       224   6e-67   Brachypodium distachyon [annual false brome]
ref|XP_006647108.1|  PREDICTED: shaggy-related protein kinase zet...    223   7e-67   Oryza brachyantha
ref|XP_010486052.1|  PREDICTED: shaggy-related protein kinase iot...    224   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010686226.1|  PREDICTED: shaggy-related protein kinase eta       223   8e-67   Beta vulgaris subsp. vulgaris [field beet]
emb|CDO96835.1|  unnamed protein product                                223   9e-67   Coffea canephora [robusta coffee]
ref|XP_004149276.1|  PREDICTED: shaggy-related protein kinase zet...    224   9e-67   Cucumis sativus [cucumbers]
ref|XP_006307671.1|  hypothetical protein CARUB_v10009298mg             223   1e-66   Capsella rubella
gb|KJB34902.1|  hypothetical protein B456_006G089400                    222   1e-66   Gossypium raimondii
gb|KHN28622.1|  Shaggy-related protein kinase eta                       222   1e-66   Glycine soja [wild soybean]
gb|AGJ93556.1|  SHAGGY-like kinase                                      223   1e-66   Triticum aestivum [Canadian hard winter wheat]
gb|KDP21116.1|  hypothetical protein JCGZ_21587                         222   1e-66   Jatropha curcas
ref|XP_003546036.1|  PREDICTED: shaggy-related protein kinase eta...    222   1e-66   Glycine max [soybeans]
ref|XP_004951349.1|  PREDICTED: shaggy-related protein kinase eta...    223   1e-66   Setaria italica
ref|XP_006417928.1|  hypothetical protein EUTSA_v10007772mg             223   1e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010522087.1|  PREDICTED: shaggy-related protein kinase iota      223   1e-66   Tarenaya hassleriana [spider flower]
ref|NP_001131812.1|  putative glycogen synthase kinase family pro...    223   1e-66   Zea mays [maize]
gb|KGN46984.1|  hypothetical protein Csa_6G157100                       224   2e-66   Cucumis sativus [cucumbers]
ref|XP_009394828.1|  PREDICTED: shaggy-related protein kinase eta       223   2e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW71144.1|  putative glycogen synthase kinase family protein        223   2e-66   
gb|ABG74917.1|  BIN2-like protein                                       222   2e-66   Brassica napus [oilseed rape]
ref|XP_006654148.1|  PREDICTED: shaggy-related protein kinase zet...    220   2e-66   
ref|NP_001149983.1|  shaggy-related protein kinase eta                  222   2e-66   Zea mays [maize]
gb|EMT19129.1|  Shaggy-related protein kinase iota                      221   2e-66   
ref|XP_010557131.1|  PREDICTED: shaggy-related protein kinase zet...    222   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_002454973.1|  hypothetical protein SORBIDRAFT_03g002380          221   5e-66   Sorghum bicolor [broomcorn]
ref|XP_010689734.1|  PREDICTED: shaggy-related protein kinase eta       221   5e-66   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC72801.1|  hypothetical protein OsI_06492                          220   5e-66   Oryza sativa Indica Group [Indian rice]
gb|EEC78696.1|  hypothetical protein OsI_18849                          216   6e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_002453590.1|  hypothetical protein SORBIDRAFT_04g008580          221   6e-66   Sorghum bicolor [broomcorn]
gb|ACG33866.1|  shaggy-related protein kinase eta                       220   9e-66   Zea mays [maize]
ref|NP_001149135.1|  shaggy-related protein kinase eta                  220   1e-65   Zea mays [maize]
gb|AGJ93555.1|  SHAGGY-like kinase                                      220   1e-65   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001130511.1|  uncharacterized protein LOC100191610               221   1e-65   Zea mays [maize]
ref|XP_008672878.1|  PREDICTED: shaggy-related protein kinase eta...    221   1e-65   Zea mays [maize]
gb|ACG33869.1|  shaggy-related protein kinase eta                       220   1e-65   Zea mays [maize]
ref|XP_003565257.1|  PREDICTED: shaggy-related protein kinase eta...    219   2e-65   Brachypodium distachyon [annual false brome]
ref|XP_009416503.1|  PREDICTED: shaggy-related protein kinase eta...    220   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP15948.1|  unnamed protein product                                220   2e-65   Coffea canephora [robusta coffee]
ref|XP_009394192.1|  PREDICTED: shaggy-related protein kinase eta...    219   3e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE62704.1|  hypothetical protein OsJ_17507                          218   6e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009396521.1|  PREDICTED: shaggy-related protein kinase eta...    218   6e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001054901.1|  Os05g0207500                                       218   6e-65   
gb|EYU28104.1|  hypothetical protein MIMGU_mgv1a008133mg                216   3e-64   Erythranthe guttata [common monkey flower]
gb|AFM94293.1|  glycogen synthase kinase                                215   6e-64   Oncidium hybrid cultivar
ref|XP_006833052.1|  hypothetical protein AMTR_s00170p00028260          213   2e-63   
emb|CDY52692.1|  BnaC04g54320D                                          204   3e-63   Brassica napus [oilseed rape]
ref|XP_009410924.1|  PREDICTED: shaggy-related protein kinase iot...    213   5e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410923.1|  PREDICTED: shaggy-related protein kinase eta...    213   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001046390.1|  Os02g0236200                                       209   1e-61   
ref|XP_009415683.1|  PREDICTED: uncharacterized protein LOC103996486    219   2e-61   
gb|EAZ22360.1|  hypothetical protein OsJ_06019                          208   4e-61   Oryza sativa Japonica Group [Japonica rice]
gb|KHN36706.1|  Shaggy-related protein kinase zeta                      205   3e-60   Glycine soja [wild soybean]
ref|XP_007149727.1|  hypothetical protein PHAVU_005G094100g             206   6e-60   Phaseolus vulgaris [French bean]
ref|XP_006594816.1|  PREDICTED: shaggy-related protein kinase zet...    204   7e-60   Glycine max [soybeans]
ref|XP_006594815.1|  PREDICTED: shaggy-related protein kinase zet...    205   8e-60   Glycine max [soybeans]
gb|KDO66104.1|  hypothetical protein CISIN_1g0141742mg                  198   9e-60   Citrus sinensis [apfelsine]
ref|XP_003540409.1|  PREDICTED: shaggy-related protein kinase zet...    204   2e-59   Glycine max [soybeans]
ref|XP_004965568.1|  PREDICTED: shaggy-related protein kinase zet...    203   4e-59   Setaria italica
ref|XP_009380485.1|  PREDICTED: shaggy-related protein kinase eta...    203   6e-59   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    203   7e-59   Citrus sinensis [apfelsine]
ref|NP_001131188.1|  putative glycogen synthase kinase family pro...    202   1e-58   Zea mays [maize]
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    203   2e-58   Nelumbo nucifera [Indian lotus]
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    202   2e-58   Selaginella moellendorffii
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             201   2e-58   
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    201   3e-58   Prunus mume [ume]
ref|NP_001167685.1|  shaggy-related protein kinase eta                  201   4e-58   
emb|CAA73848.1|  shaggy-like kinase etha (OSKetha)                      200   5e-58   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001057824.1|  Os06g0547900                                       200   6e-58   
gb|ABK24355.1|  unknown                                                 198   1e-57   Picea sitchensis
ref|XP_007025342.1|  Kinase superfamily protein isoform 1               198   1e-57   
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             200   2e-57   Citrus clementina [clementine]
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    199   2e-57   
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    199   2e-57   Cucumis melo [Oriental melon]
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    199   2e-57   
ref|XP_006446533.1|  hypothetical protein CICLE_v10015323mg             199   2e-57   
ref|XP_001763270.1|  predicted protein                                  199   2e-57   
ref|XP_004164819.1|  PREDICTED: shaggy-related protein kinase eps...    199   2e-57   
gb|KGN59685.1|  hypothetical protein Csa_3G838640                       199   2e-57   Cucumis sativus [cucumbers]
ref|XP_007031507.1|  Shaggy-like kinase 13 isoform 4                    197   3e-57   
gb|AAQ23111.1|  shaggy-related protein kinase 1                         199   3e-57   Physcomitrella patens
gb|AAQ23110.1|  shaggy-related protein kinase 5                         197   3e-57   Physcomitrella patens
gb|EEC80781.1|  hypothetical protein OsI_23306                          198   4e-57   Oryza sativa Indica Group [Indian rice]
ref|XP_001765207.1|  predicted protein                                  198   5e-57   
ref|XP_008795406.1|  PREDICTED: shaggy-related protein kinase eps...    193   5e-57   
gb|AAQ23108.1|  shaggy-related protein kinase 3                         197   9e-57   Physcomitrella patens
gb|AAX92712.1|  shaggy-related protein kinase 5                         189   1e-56   Picea abies
ref|XP_010933863.1|  PREDICTED: shaggy-related protein kinase eps...    198   1e-56   Elaeis guineensis
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    196   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009412822.1|  PREDICTED: shaggy-related protein kinase alp...    198   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    196   2e-56   
gb|AAQ23107.1|  shaggy-related protein kinase 2                         197   2e-56   Physcomitrella patens
ref|XP_009412821.1|  PREDICTED: shaggy-related protein kinase alp...    198   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001763265.1|  predicted protein                                  197   2e-56   
gb|AFW67021.1|  putative glycogen synthase kinase family protein        188   2e-56   
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    196   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    196   3e-56   Vitis vinifera
ref|XP_010919260.1|  PREDICTED: shaggy-related protein kinase NtK...    196   3e-56   Elaeis guineensis
ref|XP_008795404.1|  PREDICTED: shaggy-related protein kinase the...    195   3e-56   
ref|XP_010255498.1|  PREDICTED: shaggy-related protein kinase eps...    197   5e-56   Nelumbo nucifera [Indian lotus]
ref|XP_010255500.1|  PREDICTED: shaggy-related protein kinase the...    194   5e-56   Nelumbo nucifera [Indian lotus]
gb|AAQ23109.1|  shaggy-related protein kinase 4                         196   6e-56   Physcomitrella patens
ref|XP_001762052.1|  predicted protein                                  196   6e-56   
ref|XP_010255499.1|  PREDICTED: shaggy-related protein kinase eps...    196   6e-56   
ref|XP_001781586.1|  predicted protein                                  195   7e-56   
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    195   8e-56   
ref|XP_001781582.1|  predicted protein                                  195   8e-56   
ref|XP_004141099.1|  PREDICTED: shaggy-related protein kinase eps...    194   1e-55   
emb|CDP02094.1|  unnamed protein product                                194   1e-55   
ref|XP_010919259.1|  PREDICTED: shaggy-related protein kinase eps...    196   2e-55   
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    194   2e-55   
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    194   2e-55   
gb|AAT81407.1|  shaggy-related protein kinase 6                         195   2e-55   
ref|XP_002511803.1|  Glycogen synthase kinase-3 beta, putative          195   3e-55   
ref|XP_004229833.1|  PREDICTED: shaggy-related protein kinase eps...    195   3e-55   
ref|XP_006339456.1|  PREDICTED: shaggy-related protein kinase the...    194   4e-55   
gb|ABK24513.1|  unknown                                                 193   5e-55   
gb|AFN42826.1|  GSK3-like protein                                       192   5e-55   
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    192   5e-55   
gb|KJB68373.1|  hypothetical protein B456_010G241600                    192   6e-55   
ref|XP_006445137.1|  hypothetical protein CICLE_v10020026mg             194   6e-55   
gb|KFK30649.1|  hypothetical protein AALP_AA6G009500                    194   7e-55   
ref|XP_008644282.1|  PREDICTED: uncharacterized protein LOC542518...    192   8e-55   
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             192   8e-55   
ref|XP_009790920.1|  PREDICTED: shaggy-related protein kinase eps...    194   8e-55   
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    192   8e-55   
ref|XP_008799541.1|  PREDICTED: shaggy-related protein kinase alp...    193   9e-55   
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    192   9e-55   
ref|XP_008232743.1|  PREDICTED: shaggy-related protein kinase the...    193   1e-54   
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    192   1e-54   
ref|XP_008644283.1|  PREDICTED: uncharacterized protein LOC542518...    191   1e-54   
emb|CAA11860.1|  shaggy-like kinase 91                                  193   1e-54   
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    192   1e-54   
ref|XP_006396267.1|  hypothetical protein EUTSA_v10028631mg             193   1e-54   
ref|XP_002873682.1|  kinase family protein                              191   1e-54   
ref|NP_001105536.1|  uncharacterized protein LOC542518                  192   1e-54   
gb|ABR16348.1|  unknown                                                 192   1e-54   
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    191   2e-54   
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    191   2e-54   
emb|CDX78587.1|  BnaA03g04990D                                          191   2e-54   
emb|CDX70574.1|  BnaC03g06580D                                          191   2e-54   
ref|XP_009602858.1|  PREDICTED: shaggy-related protein kinase eps...    192   2e-54   
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             192   2e-54   
ref|XP_004306833.1|  PREDICTED: shaggy-related protein kinase the...    192   2e-54   
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    191   2e-54   
ref|XP_008644280.1|  PREDICTED: uncharacterized protein LOC542518...    191   2e-54   
gb|KDO63404.1|  hypothetical protein CISIN_1g014750mg                   191   3e-54   
gb|ACN34914.1|  unknown                                                 191   3e-54   
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    192   4e-54   
gb|KDP28680.1|  hypothetical protein JCGZ_14451                         192   5e-54   
dbj|BAH56785.1|  AT1G09840                                              182   5e-54   
ref|NP_001051854.1|  Os03g0841800                                       190   6e-54   
ref|XP_006841582.1|  hypothetical protein AMTR_s00003p00196730          190   6e-54   
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    191   6e-54   
ref|XP_006289072.1|  hypothetical protein CARUB_v10002475mg             191   7e-54   
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    190   7e-54   
ref|XP_010940878.1|  PREDICTED: shaggy-related protein kinase eps...    191   7e-54   
ref|XP_008365740.1|  PREDICTED: shaggy-related protein kinase zet...    188   8e-54   
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     191   8e-54   
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    189   8e-54   
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    191   8e-54   
ref|XP_007222549.1|  hypothetical protein PRUPE_ppa006218mg             190   9e-54   
ref|XP_003531262.1|  PREDICTED: shaggy-related protein kinase eta...    189   9e-54   
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              198   1e-53   
ref|NP_191981.1|  Shaggy-related protein kinase theta                   191   1e-53   
ref|XP_002872933.1|  hypothetical protein ARALYDRAFT_490498             191   1e-53   
ref|XP_010427333.1|  PREDICTED: shaggy-related protein kinase the...    191   1e-53   
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    189   1e-53   
ref|XP_011035087.1|  PREDICTED: shaggy-related protein kinase theta     191   1e-53   
gb|EMS50941.1|  Shaggy-related protein kinase kappa                     188   1e-53   
ref|XP_002320754.2|  hypothetical protein POPTR_0014s07120g             191   1e-53   
ref|XP_006375322.1|  shaggy-related protein kinase theta                190   1e-53   
ref|XP_007218957.1|  hypothetical protein PRUPE_ppa003552mg             192   1e-53   
ref|XP_008799540.1|  PREDICTED: shaggy-related protein kinase alp...    190   2e-53   
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    189   2e-53   
ref|XP_004147888.1|  PREDICTED: shaggy-related protein kinase kap...    189   2e-53   
ref|NP_001240918.1|  uncharacterized protein LOC100820098               189   2e-53   
ref|XP_002301334.1|  hypothetical protein POPTR_0002s15640g             189   2e-53   
emb|CDY51144.1|  BnaA09g51790D                                          190   2e-53   
ref|XP_004981107.1|  PREDICTED: shaggy-related protein kinase del...    189   2e-53   
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             188   2e-53   
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     188   2e-53   
ref|XP_006345509.1|  PREDICTED: shaggy-related protein kinase the...    189   2e-53   
emb|CDX74346.1|  BnaA03g27010D                                          189   2e-53   
ref|XP_009134534.1|  PREDICTED: shaggy-related protein kinase theta     189   3e-53   
emb|CAA58594.1|  Petunia Shaggy kinase 4                                188   3e-53   
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    188   3e-53   
ref|XP_007134960.1|  hypothetical protein PHAVU_010G090200g             189   3e-53   
ref|XP_009111468.1|  PREDICTED: shaggy-related protein kinase theta     189   3e-53   
gb|KHN06407.1|  Shaggy-related protein kinase eta                       187   3e-53   
gb|KDO39707.1|  hypothetical protein CISIN_1g014595mg                   186   3e-53   
ref|XP_004485442.1|  PREDICTED: shaggy-related protein kinase kap...    189   4e-53   
ref|XP_010245514.1|  PREDICTED: shaggy-related protein kinase kap...    187   4e-53   
ref|XP_010523040.1|  PREDICTED: shaggy-related protein kinase theta     189   4e-53   
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             187   4e-53   
ref|XP_003592909.1|  Glycogen synthase kinase-3-like protein            188   4e-53   
gb|EMT16766.1|  Shaggy-related protein kinase delta                     188   4e-53   
ref|XP_011092295.1|  PREDICTED: shaggy-related protein kinase del...    187   4e-53   
ref|XP_006580172.1|  PREDICTED: shaggy-related protein kinase eta...    187   4e-53   
ref|XP_010245515.1|  PREDICTED: shaggy-related protein kinase kap...    187   4e-53   
gb|AAN63591.1|AF432225_1  GSK-3-like protein MsK4                       188   5e-53   
ref|XP_010490391.1|  PREDICTED: shaggy-related protein kinase kap...    188   5e-53   
ref|XP_010245511.1|  PREDICTED: shaggy-related protein kinase kap...    188   5e-53   
ref|XP_011092292.1|  PREDICTED: shaggy-related protein kinase kap...    188   5e-53   
ref|XP_010458292.1|  PREDICTED: shaggy-related protein kinase kappa     187   5e-53   
ref|XP_006307622.1|  hypothetical protein CARUB_v10009250mg             187   5e-53   
ref|XP_003562606.1|  PREDICTED: shaggy-related protein kinase kappa     187   5e-53   
ref|XP_010245513.1|  PREDICTED: shaggy-related protein kinase kap...    187   5e-53   
emb|CDX91895.1|  BnaC03g31970D                                          189   6e-53   
ref|XP_010456251.1|  PREDICTED: shaggy-related protein kinase theta     189   6e-53   
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                187   6e-53   
ref|NP_196968.2|  Shaggy-related protein kinase 13                      187   6e-53   
ref|XP_009396814.1|  PREDICTED: shaggy-related protein kinase kap...    187   6e-53   
gb|KHN43365.1|  Glycogen synthase kinase-3 like MsK-1                   179   6e-53   
sp|O04160.2|KSGT_BRANA  RecName: Full=Shaggy-related protein kina...    189   6e-53   
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    187   7e-53   
gb|EPS68300.1|  hypothetical protein M569_06467                         187   7e-53   
dbj|BAJ89558.1|  predicted protein                                      187   8e-53   
ref|XP_010030186.1|  PREDICTED: shaggy-related protein kinase kappa     187   8e-53   
ref|XP_006650875.1|  PREDICTED: shaggy-related protein kinase kap...    187   1e-52   
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    187   1e-52   
ref|XP_004300628.1|  PREDICTED: shaggy-related protein kinase kappa     187   1e-52   
ref|XP_002463546.1|  hypothetical protein SORBIDRAFT_01g001760          187   1e-52   
ref|XP_002526439.1|  Glycogen synthase kinase-3 beta, putative          182   1e-52   
gb|KDO39711.1|  hypothetical protein CISIN_1g014595mg                   186   1e-52   
emb|CDY10766.1|  BnaA05g11700D                                          181   1e-52   
gb|KDO39708.1|  hypothetical protein CISIN_1g014595mg                   186   1e-52   
ref|XP_008347928.1|  PREDICTED: shaggy-related protein kinase kap...    181   1e-52   
gb|AAB60754.1|  Identical to A. thaliana AtK-1 (gb|X79279)              187   1e-52   
ref|NP_172455.1|  Shaggy-related protein kinase kappa                   186   1e-52   
ref|XP_002892530.1|  hypothetical protein ARALYDRAFT_471093             186   1e-52   
gb|KDO39706.1|  hypothetical protein CISIN_1g014595mg                   186   1e-52   
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    186   2e-52   
ref|XP_006417527.1|  hypothetical protein EUTSA_v10007729mg             186   2e-52   
emb|CDY07202.1|  BnaCnng02170D                                          187   2e-52   
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    186   2e-52   
emb|CDY05202.1|  BnaC05g46010D                                          186   2e-52   
ref|XP_010540275.1|  PREDICTED: shaggy-related protein kinase the...    187   2e-52   
ref|NP_001241073.1|  uncharacterized protein LOC100799387               186   2e-52   
gb|EYU32069.1|  hypothetical protein MIMGU_mgv1a006024mg                187   2e-52   
ref|XP_006858581.1|  hypothetical protein AMTR_s00071p00186380          187   2e-52   
ref|XP_006431595.1|  hypothetical protein CICLE_v10001277mg             186   2e-52   
ref|XP_007148571.1|  hypothetical protein PHAVU_006G219700g             186   2e-52   
ref|NP_176096.1|  shaggy-related protein kinase delta                   186   3e-52   
ref|XP_003534597.1|  PREDICTED: shaggy-related protein kinase theta     186   3e-52   
ref|XP_002886726.1|  hypothetical protein ARALYDRAFT_475455             186   3e-52   
gb|KJB16215.1|  hypothetical protein B456_002G218100                    186   3e-52   
ref|XP_008460173.1|  PREDICTED: shaggy-related protein kinase theta     187   3e-52   
gb|KHN29413.1|  Shaggy-related protein kinase theta                     186   3e-52   
ref|XP_004144981.1|  PREDICTED: shaggy-related protein kinase the...    187   3e-52   
ref|XP_009393923.1|  PREDICTED: shaggy-related protein kinase eps...    187   3e-52   
ref|XP_004168158.1|  PREDICTED: shaggy-related protein kinase the...    187   3e-52   
ref|XP_009773710.1|  PREDICTED: shaggy-related protein kinase eps...    187   3e-52   
emb|CAA05329.1|  shaggy-like kinase 59                                  187   3e-52   
ref|XP_003521276.1|  PREDICTED: shaggy-related protein kinase theta     187   3e-52   
ref|XP_007051908.1|  Shaggy-like protein kinase 32 isoform 1            188   3e-52   
ref|XP_010414797.1|  PREDICTED: shaggy-related protein kinase del...    185   4e-52   
emb|CAA11862.1|  shaggy kinase 7                                        186   4e-52   
ref|XP_010475837.1|  PREDICTED: shaggy-related protein kinase kap...    185   4e-52   
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                185   4e-52   
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                185   4e-52   
gb|KHN27286.1|  Shaggy-related protein kinase theta                     186   4e-52   
ref|XP_010511361.1|  PREDICTED: shaggy-related protein kinase del...    185   4e-52   
ref|XP_010470311.1|  PREDICTED: LOW QUALITY PROTEIN: shaggy-relat...    185   4e-52   
ref|XP_011093165.1|  PREDICTED: shaggy-related protein kinase alpha     186   4e-52   
ref|XP_010511360.1|  PREDICTED: shaggy-related protein kinase del...    185   4e-52   
ref|XP_007041204.1|  Shaggy-like protein kinase 41 isoform 1            185   4e-52   
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                187   4e-52   
emb|CAA11861.1|  shaggy kinase 6                                        186   4e-52   
emb|CDP08875.1|  unnamed protein product                                186   5e-52   
ref|XP_006302308.1|  hypothetical protein CARUB_v10020358mg             185   5e-52   
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    185   5e-52   
ref|NP_001185256.1|  shaggy-related protein kinase delta                186   6e-52   
ref|NP_001042602.1|  Os01g0252100                                       184   6e-52   
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    184   6e-52   
gb|EPS63039.1|  hypothetical protein M569_11747                         183   6e-52   
ref|XP_008447666.1|  PREDICTED: glycogen synthase kinase-3 homolo...    179   7e-52   
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   184   7e-52   
ref|XP_003528879.1|  PREDICTED: shaggy-related protein kinase the...    186   7e-52   
ref|XP_009598595.1|  PREDICTED: shaggy-related protein kinase kappa     185   7e-52   
gb|KGN58535.1|  hypothetical protein Csa_3G664590                       183   7e-52   
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          184   7e-52   
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    184   8e-52   
ref|XP_002272112.1|  PREDICTED: shaggy-related protein kinase theta     186   8e-52   
ref|XP_007048726.1|  GSK3/SHAGGY-like protein kinase 1 isoform 2        184   8e-52   
gb|ACF82147.1|  unknown                                                 175   8e-52   
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    184   9e-52   
ref|XP_009355333.1|  PREDICTED: shaggy-related protein kinase kappa     184   9e-52   
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     184   9e-52   
ref|XP_003566380.1|  PREDICTED: shaggy-related protein kinase alpha     184   9e-52   
gb|EYU33277.1|  hypothetical protein MIMGU_mgv1a007009mg                184   1e-51   
emb|CAA55866.1|  K-1                                                    184   1e-51   
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     184   1e-51   
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    184   1e-51   
gb|EYU35066.1|  hypothetical protein MIMGU_mgv1a0059281mg               182   1e-51   
gb|EPS63877.1|  hypothetical protein M569_10905                         184   1e-51   
gb|AFH00876.1|  glycogen synthase kinase-3                              184   1e-51   
emb|CAA68872.1|  shaggy-like kinase kappa                               183   1e-51   
ref|XP_009148291.1|  PREDICTED: shaggy-related protein kinase kappa     184   1e-51   
emb|CAA58595.1|  Petunia Shaggy kinase 6                                184   1e-51   
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     184   1e-51   
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    184   1e-51   
emb|CDY49981.1|  BnaC03g34380D                                          184   1e-51   
ref|XP_008339410.1|  PREDICTED: shaggy-related protein kinase kappa     184   1e-51   
ref|XP_009110795.1|  PREDICTED: shaggy-related protein kinase kap...    184   1e-51   
emb|CDY31060.1|  BnaA08g26100D                                          184   1e-51   
ref|XP_010544097.1|  PREDICTED: shaggy-related protein kinase kappa     184   1e-51   
emb|CDY65729.1|  BnaCnng48480D                                          184   1e-51   
ref|NP_001242661.1|  glycogen synthase kinase-3                         184   1e-51   
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    184   2e-51   
ref|XP_009353785.1|  PREDICTED: shaggy-related protein kinase kap...    184   2e-51   
ref|XP_003552357.1|  PREDICTED: shaggy-related protein kinase the...    185   2e-51   
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    184   2e-51   
gb|ACQ91102.1|  glycogen synthase kinase                                183   2e-51   
ref|XP_008803035.1|  PREDICTED: shaggy-related protein kinase eps...    184   2e-51   
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    183   2e-51   
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     183   2e-51   
ref|XP_011091732.1|  PREDICTED: shaggy-related protein kinase alp...    184   2e-51   
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    183   2e-51   
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             183   2e-51   
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             183   2e-51   
ref|XP_010682020.1|  PREDICTED: shaggy-related protein kinase kap...    183   2e-51   
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    183   2e-51   
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             183   2e-51   
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     183   2e-51   
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    183   2e-51   



>ref|XP_007211435.1| hypothetical protein PRUPE_ppa007161mg [Prunus persica]
 gb|EMJ12634.1| hypothetical protein PRUPE_ppa007161mg [Prunus persica]
Length=379

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQ+L+GASPELINRLIPEHV+RQMGLNF HP G
Sbjct  321  PFFDELREPNARLPNGRPFPPLFNFKQDLSGASPELINRLIPEHVKRQMGLNFLHPAG  378



>ref|XP_008225315.1| PREDICTED: shaggy-related protein kinase eta [Prunus mume]
Length=379

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQ+L+GASPELINRLIPEHV+RQMGLNF HP G
Sbjct  321  PFFDELREPNARLPNGRPFPPLFNFKQDLSGASPELINRLIPEHVKRQMGLNFLHPAG  378



>gb|KDO63403.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=375

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  257  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  316

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQ GL+ PH  G
Sbjct  317  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQTGLSMPHSAG  374



>gb|KDO63406.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=376

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  258  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  317

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQ GL+ PH  G
Sbjct  318  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQTGLSMPHSAG  375



>ref|XP_003540001.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=420

 Score =   242 bits (618),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  302  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  361

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQELAGASPELINRLIPEH+RRQMGL+FPH  G
Sbjct  362  PFFDELREPNARLPNGRPLPPLFNFKQELAGASPELINRLIPEHIRRQMGLSFPHSAG  419



>ref|XP_006446814.1| hypothetical protein CICLE_v10015375mg [Citrus clementina]
 gb|ESR60054.1| hypothetical protein CICLE_v10015375mg [Citrus clementina]
Length=419

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  301  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  360

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQ GL+ PH  G
Sbjct  361  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQTGLSMPHSAG  418



>ref|XP_003527338.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=419

 Score =   242 bits (617),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  301  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  360

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNG P PPLFNFKQELAGASPELINRLIPEH+RRQMGL+FPH  G
Sbjct  361  PFFDELREPNARLPNGHPLPPLFNFKQELAGASPELINRLIPEHIRRQMGLSFPHSAG  418



>gb|KDO63402.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=419

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  301  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  360

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQ GL+ PH  G
Sbjct  361  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQTGLSMPHSAG  418



>gb|KHN33940.1| Shaggy-related protein kinase zeta [Glycine soja]
Length=415

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  297  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  356

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNG P PPLFNFKQELAGASPELINRLIPEH+RRQMGL+FPH  G
Sbjct  357  PFFDELREPNARLPNGHPLPPLFNFKQELAGASPELINRLIPEHIRRQMGLSFPHSAG  414



>ref|XP_006468992.1| PREDICTED: shaggy-related protein kinase zeta-like [Citrus sinensis]
Length=419

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  301  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  360

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQ GL+ PH  G
Sbjct  361  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQTGLSMPHSAG  418



>ref|XP_008383613.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
 ref|XP_008366041.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
Length=379

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFD+LREPNARLPNGRPFPPLFNFKQEL+GA+PELINRLIP+HV+RQMGLNF HP G
Sbjct  321  SFFDDLREPNARLPNGRPFPPLFNFKQELSGATPELINRLIPDHVKRQMGLNFSHPAG  378



>gb|KDO77890.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=374

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GLNF HP G
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG  373



>ref|XP_006449528.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
 gb|ESR62768.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
Length=374

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GLNF HP G
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG  373



>gb|KDO77891.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=353

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  235  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  294

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GLNF HP G
Sbjct  295  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG  352



>gb|KDO77889.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=376

 Score =   239 bits (609),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  258  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  317

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GLNF HP G
Sbjct  318  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG  375



>ref|XP_006467630.1| PREDICTED: shaggy-related protein kinase eta-like [Citrus sinensis]
 gb|KDO77887.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=380

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GLNF HP G
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG  379



>ref|XP_006449527.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
 gb|ESR62767.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
Length=380

 Score =   239 bits (610),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GLNF HP G
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG  379



>gb|KDO77892.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=296

 Score =   236 bits (602),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  178  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  237

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GLNF HP G
Sbjct  238  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPDHVKRQLGLNFLHPAG  295



>gb|AES66964.2| shaggy-like kinase dzeta [Medicago truncatula]
Length=372

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC+ALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCSALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIPEHVRRQ GL FP+PG
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPEHVRRQTGLGFPYPG  372



>ref|XP_011082988.1| PREDICTED: shaggy-related protein kinase eta [Sesamum indicum]
Length=430

 Score =   239 bits (611),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 116/120 (97%), Gaps = 2/120 (2%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  310  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  369

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFP--HPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELIN+LIPEH+RRQ GLNFP  HP G
Sbjct  370  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINKLIPEHIRRQAGLNFPVSHPAG  429



>gb|AES66963.2| shaggy-like kinase dzeta [Medicago truncatula]
Length=426

 Score =   239 bits (610),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC+ALEACAH
Sbjct  310  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCSALEACAH  369

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIPEHVRRQ GL FP+PG
Sbjct  370  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPEHVRRQTGLGFPYPG  426



>ref|XP_007048725.1| SHAGGY-related protein kinase dZeta isoform 1 [Theobroma cacao]
 gb|EOX92882.1| SHAGGY-related protein kinase dZeta isoform 1 [Theobroma cacao]
Length=409

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQ+KAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEA AH
Sbjct  291  REEIRCMNPNYTDFRFPQVKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEALAH  350

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPN RP PPLFNFKQELAGASPELINRLIPEHVRRQMGL FPHP G
Sbjct  351  PFFDELREPNARLPNCRPLPPLFNFKQELAGASPELINRLIPEHVRRQMGLGFPHPAG  408



>ref|XP_003596712.1| Shaggy-related protein kinase [Medicago truncatula]
Length=423

 Score =   239 bits (610),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC+ALEACAH
Sbjct  307  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCSALEACAH  366

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIPEHVRRQ GL FP+PG
Sbjct  367  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPEHVRRQTGLGFPYPG  423



>gb|KHN34245.1| Shaggy-related protein kinase zeta [Glycine soja]
Length=502

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  384  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  443

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQELAGASPELINRLIPEH+RRQMGL+FPH  G
Sbjct  444  PFFDELREPNARLPNGRPLPPLFNFKQELAGASPELINRLIPEHIRRQMGLSFPHSAG  501



>ref|XP_003596713.1| Shaggy-related protein kinase [Medicago truncatula]
Length=294

 Score =   235 bits (599),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC+ALEACAH
Sbjct  178  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCSALEACAH  237

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIPEHVRRQ GL FP+PG
Sbjct  238  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPEHVRRQTGLGFPYPG  294



>ref|XP_009352741.1| PREDICTED: shaggy-related protein kinase eta-like [Pyrus x bretschneideri]
Length=379

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFD+LREPNARLPNGRPFPPLFNF+QEL+G +PELINRLIP+HV+RQMGLNF HP G
Sbjct  321  SFFDDLREPNARLPNGRPFPPLFNFRQELSGTTPELINRLIPDHVKRQMGLNFSHPAG  378



>ref|XP_003633016.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Vitis 
vinifera]
 emb|CBI30705.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   236 bits (603),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPSYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIPEHVRRQ+GL+F HP G
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPEHVRRQIGLSFFHPAG  379



>ref|XP_010655538.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Vitis 
vinifera]
Length=376

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  258  REEIRCMNPSYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  317

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPEL+N+LIPEHVRRQ+GL+F HP G
Sbjct  318  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELVNKLIPEHVRRQIGLSFFHPAG  375



>ref|XP_004487575.1| PREDICTED: shaggy-related protein kinase zeta-like [Cicer arietinum]
Length=420

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/117 (93%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNY+DFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC+ALEACAH
Sbjct  304  REEIRCMNPNYSDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCSALEACAH  363

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIPEHVRRQ GL FP+PG
Sbjct  364  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPEHVRRQTGLGFPYPG  420



>gb|AGJ98225.1| BIN2-like protein PSK8 [Petunia x hybrida]
Length=420

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  302  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  361

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFKQEL GASPEL+N+LIPEHV RQ+GLNFP+PG 
Sbjct  362  SFFDELREPNARLPNGRPFPPLFNFKQELTGASPELVNKLIPEHVWRQIGLNFPYPGA  419



>ref|XP_011466967.1| PREDICTED: shaggy-related protein kinase zeta isoform X3 [Fragaria 
vesca subsp. vesca]
Length=374

 Score =   235 bits (600),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL GASPELI+RLIPEH+R+Q+GL FPHP G
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQELNGASPELISRLIPEHMRQQIGLGFPHPAG  373



>ref|XP_003522493.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   236 bits (601),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GASPEL+N+LIP+HV+RQMGL F H GG
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDHVKRQMGLQFMHLGG  379



>ref|XP_010538570.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Tarenaya hassleriana]
Length=380

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCT LEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTMLEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELR+PNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+HV+RQ+GL F HP G
Sbjct  322  PFFDELRDPNARLPNGRPFPPLFNFKQEIAGASPELVNKLIPDHVKRQLGLGFMHPTG  379



>emb|CAA72330.1| shaggy-like kinase [Ricinus communis]
Length=277

 Score =   232 bits (592),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  159  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  218

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL GASPEL+N+LIP+H++RQMGLNF H  G
Sbjct  219  PFFDELREPNARLPNGRPLPPLFNFKQELNGASPELVNKLIPDHMKRQMGLNFLHLAG  276



>emb|CAN73053.1| hypothetical protein VITISV_015513 [Vitis vinifera]
Length=435

 Score =   237 bits (604),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEA+DLASRLLQYSPSLRCTALEACAH
Sbjct  267  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEALDLASRLLQYSPSLRCTALEACAH  326

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRP PPLFNFKQELA ASPEL++RLIPEHVRRQ+GL+FPHP G
Sbjct  327  SFFDELREPNARLPNGRPLPPLFNFKQELAAASPELLHRLIPEHVRRQVGLSFPHPAG  384



>gb|KHN29604.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   235 bits (600),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GASPEL+N+LIP+HV+RQMGL F H GG
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDHVKRQMGLQFMHLGG  373



>ref|XP_002305736.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 ref|XP_006384065.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 ref|XP_006384066.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 gb|EEE86247.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 gb|ERP61862.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 gb|ERP61863.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
Length=380

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP P LFNFKQEL GASPEL+N+LIPEHV+RQMGLNF H  G
Sbjct  322  PFFDELREPNARLPNGRPLPSLFNFKQELNGASPELVNKLIPEHVKRQMGLNFMHLAG  379



>gb|ABK95578.1| unknown [Populus trichocarpa]
Length=380

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP P LFNFKQEL GASPEL+N+LIPEHV+RQMGLNF H  G
Sbjct  322  PFFDELREPNARLPNGRPLPSLFNFKQELNGASPELVNKLIPEHVKRQMGLNFMHLAG  379



>ref|XP_011466966.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  268  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  327

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL GASPELI+RLIPEH+R+Q+GL FPHP G
Sbjct  328  PFFDELREPNARLPNGRPLPPLFNFKQELNGASPELISRLIPEHMRQQIGLGFPHPAG  385



>ref|XP_010538571.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCT LEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTMLEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELR+PNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+HV+RQ+GL F HP G
Sbjct  316  PFFDELRDPNARLPNGRPFPPLFNFKQEIAGASPELVNKLIPDHVKRQLGLGFMHPTG  373



>ref|XP_008228935.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Prunus 
mume]
Length=374

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELINRLIPE++R+Q GL FPHP G
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEYMRQQTGLGFPHPVG  373



>ref|XP_009351457.1| PREDICTED: shaggy-related protein kinase eta [Pyrus x bretschneideri]
Length=378

 Score =   235 bits (599),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFKQEL+GA+PELINRLIP+HV+RQMGLN  HP G
Sbjct  321  SFFDELREPNARLPNGRPFPPLFNFKQELSGATPELINRLIPDHVKRQMGLNL-HPAG  377



>ref|XP_007215447.1| hypothetical protein PRUPE_ppa006349mg [Prunus persica]
 gb|EMJ16646.1| hypothetical protein PRUPE_ppa006349mg [Prunus persica]
Length=416

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  298  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  357

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIPEH+R+Q GL FPHP G
Sbjct  358  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPEHMRQQTGLGFPHPVG  415



>ref|XP_010518815.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Tarenaya 
hassleriana]
Length=380

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPSYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+ +LIP+H++RQ+GL+F HP G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQEIAGASPELVTKLIPDHIKRQLGLSFLHPTG  379



>ref|XP_010518816.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Tarenaya 
hassleriana]
Length=374

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPSYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+ +LIP+H++RQ+GL+F HP G
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKQEIAGASPELVTKLIPDHIKRQLGLSFLHPTG  373



>ref|XP_002522231.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF40089.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=380

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL GASPEL+N+LIP+H++RQMGLNF H  G
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELNGASPELVNKLIPDHMKRQMGLNFLHLAG  379



>ref|XP_006348884.1| PREDICTED: shaggy-related protein kinase zeta-like [Solanum tuberosum]
Length=434

 Score =   236 bits (602),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  316  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  375

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFKQEL GASP+L+N+LIPEHV RQ+GLNFP PG 
Sbjct  376  SFFDELREPNARLPNGRPFPPLFNFKQELTGASPDLVNKLIPEHVWRQLGLNFPFPGA  433



>ref|XP_010052816.1| PREDICTED: shaggy-related protein kinase eta [Eucalyptus grandis]
 gb|KCW89654.1| hypothetical protein EUGRSUZ_A01926 [Eucalyptus grandis]
Length=419

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/115 (97%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  301  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  360

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPH  374
            PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVR+Q  LNFPH
Sbjct  361  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRKQNILNFPH  415



>ref|XP_010999759.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
 ref|XP_010999761.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
 ref|XP_010999762.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
Length=380

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP P LFNFKQEL GASPEL+N+LIP+HV+RQMGLNF H  G
Sbjct  322  PFFDELREPNARLPNGRPLPSLFNFKQELNGASPELVNKLIPDHVKRQMGLNFMHLAG  379



>ref|XP_004243275.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum lycopersicum]
Length=437

 Score =   236 bits (601),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  319  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  378

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFKQEL GASP+L+N+LIPEHV RQ+GLNFP PG 
Sbjct  379  SFFDELREPNARLPNGRPFPPLFNFKQELTGASPDLVNKLIPEHVWRQLGLNFPFPGA  436



>ref|XP_010246462.1| PREDICTED: shaggy-related protein kinase eta [Nelumbo nucifera]
Length=405

 Score =   234 bits (598),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  287  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  346

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFKQEL+GASPELIN+L+PEHVRRQ G NF HP G
Sbjct  347  SFFDELREPNARLPNGRPFPPLFNFKQELSGASPELINKLVPEHVRRQFGTNFLHPAG  404



>ref|XP_004303195.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Fragaria 
vesca subsp. vesca]
Length=417

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  299  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  358

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL GASPELI+RLIPEH+R+Q+GL FPHP G
Sbjct  359  PFFDELREPNARLPNGRPLPPLFNFKQELNGASPELISRLIPEHMRQQIGLGFPHPAG  416



>ref|XP_008228934.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Prunus 
mume]
Length=416

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  298  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  357

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELINRLIPE++R+Q GL FPHP G
Sbjct  358  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEYMRQQTGLGFPHPVG  415



>ref|XP_009593781.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   233 bits (594),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQ KAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  258  REEIRCMNPNYTDFRFPQRKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  317

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL GASP+L+++LIPEHV RQ GLNFP+PG 
Sbjct  318  PFFDELREPNARLPNGRPFPPLFNFKQELTGASPDLVSKLIPEHVWRQTGLNFPYPGA  375



>ref|XP_010529206.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC ALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCNALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK E+AGASPEL+N+LIP+H++RQ+GL F HP G
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKHEIAGASPELVNKLIPDHIKRQLGLGFLHPTG  373



>ref|XP_010529205.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Tarenaya hassleriana]
Length=380

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC ALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCNALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK E+AGASPEL+N+LIP+H++RQ+GL F HP G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKHEIAGASPELVNKLIPDHIKRQLGLGFLHPTG  379



>ref|XP_008371494.1| PREDICTED: shaggy-related protein kinase eta-like [Malus domestica]
Length=378

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFD+LREPNARLPNGRPFPPLFNFKQEL+GA+PEL+NRLIP+HV+RQMGLN  HP G
Sbjct  321  SFFDDLREPNARLPNGRPFPPLFNFKQELSGATPELVNRLIPDHVKRQMGLNL-HPAG  377



>ref|XP_010657061.1| PREDICTED: shaggy-related protein kinase eta-like [Vitis vinifera]
Length=413

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEA+DLASRLLQYSPSLRCTALEACAH
Sbjct  295  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEALDLASRLLQYSPSLRCTALEACAH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRP PPLFNFKQELA ASPEL++RLIPEHVRRQ+GL+FPHP G
Sbjct  355  SFFDELREPNARLPNGRPLPPLFNFKQELAAASPELLHRLIPEHVRRQVGLSFPHPAG  412



>ref|XP_008345980.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
Length=379

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFD+LREPNARLPNGRPFPPLFNFKQEL+GA+PEL+NRLIP+HV+RQMGLN  HP G
Sbjct  322  SFFDDLREPNARLPNGRPFPPLFNFKQELSGATPELVNRLIPDHVKRQMGLNL-HPAG  378



>ref|XP_004293965.1| PREDICTED: shaggy-related protein kinase eta [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGR FPPLFNFKQEL+ ASPEL+N+LIP+HV+RQMGL F HP G
Sbjct  321  PFFDELREPNARLPNGRAFPPLFNFKQELSSASPELVNKLIPDHVKRQMGLAFLHPPG  378



>gb|KHN07046.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GAS EL+N+LIP+HV+RQMG+ F H GG
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKQELSGASSELVNKLIPDHVKRQMGIQFMHLGG  373



>ref|XP_003526266.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GAS EL+N+LIP+HV+RQMG+ F H GG
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSGASSELVNKLIPDHVKRQMGIQFMHLGG  379



>ref|XP_008343095.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Malus 
domestica]
Length=374

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFD+LREPNARLPNGRP PPLFNFKQEL G SPELI RLIPEHVR+Q GL FPHP G
Sbjct  316  PFFDDLREPNARLPNGRPLPPLFNFKQELNGVSPELIKRLIPEHVRQQAGLGFPHPVG  373



>ref|XP_002317404.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 gb|EEE98016.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
Length=380

 Score =   232 bits (592),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP P LFNFKQEL GASPEL+N+LIP+HV+RQMGLN  H  G
Sbjct  322  PFFDELREPNARLPNGRPLPALFNFKQELNGASPELVNKLIPDHVKRQMGLNLMHLAG  379



>ref|XP_004485912.1| PREDICTED: shaggy-related protein kinase eta-like [Cicer arietinum]
Length=379

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GASPEL+N+LIP+HV+RQ+GL F  P G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDHVKRQIGLQFVQPAG  379



>ref|XP_009378930.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Pyrus 
x bretschneideri]
Length=374

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFD+LREPNARLPNGRP PPLFNFKQEL G SPELI RLIPEHVR+Q GL FPHP G
Sbjct  316  PFFDDLREPNARLPNGRPLPPLFNFKQELNGVSPELIKRLIPEHVRQQAGLGFPHPVG  373



>ref|XP_010510261.1| PREDICTED: shaggy-related protein kinase zeta [Camelina sativa]
Length=411

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  293  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  352

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNGRP PPLFNFKQELAGASPELINRLIPEHVRRQM   FP   GP
Sbjct  353  PFFNELREPNARLPNGRPLPPLFNFKQELAGASPELINRLIPEHVRRQMNGGFPFQAGP  411



>ref|XP_010469777.1| PREDICTED: shaggy-related protein kinase zeta-like [Camelina 
sativa]
Length=411

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  293  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  352

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNGRP PPLFNFKQELAGASPELINRLIPEHVRRQM   FP   GP
Sbjct  353  PFFNELREPNARLPNGRPLPPLFNFKQELAGASPELINRLIPEHVRRQMNGGFPFQAGP  411



>gb|AGJ98224.1| BIN2-like protein PSK9 [Petunia x hybrida]
Length=376

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL+G+SP+LINRLIPEH++RQMGL F
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQELSGSSPDLINRLIPEHIKRQMGLQF  368



>ref|XP_007136978.1| hypothetical protein PHAVU_009G089900g [Phaseolus vulgaris]
 gb|ESW08972.1| hypothetical protein PHAVU_009G089900g [Phaseolus vulgaris]
Length=380

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL GASPEL+N+LIP+HV+RQ+GL F H GG
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELTGASPELVNKLIPDHVKRQIGLQFIHLGG  379



>ref|XP_006643888.1| PREDICTED: shaggy-related protein kinase eta-like [Oryza brachyantha]
Length=339

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  222  REEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  281

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK ELAGASPELI+RLIPEH+RRQ GLNF H G 
Sbjct  282  PFFDELREPNARLPNGRPFPPLFNFKHELAGASPELIHRLIPEHIRRQNGLNFVHAGS  339



>ref|XP_009593779.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Nicotiana 
tomentosiformis]
Length=430

 Score =   233 bits (593),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQ KAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  312  REEIRCMNPNYTDFRFPQRKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  371

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL GASP+L+++LIPEHV RQ GLNFP+PG 
Sbjct  372  PFFDELREPNARLPNGRPFPPLFNFKQELTGASPDLVSKLIPEHVWRQTGLNFPYPGA  429



>gb|AGV54503.1| shaggy-related protein kinase eta-like protein [Phaseolus vulgaris]
Length=380

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL GASPEL+N+LIP+HV+RQ+GL F H GG
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELTGASPELVNKLIPDHVKRQIGLQFIHLGG  379



>ref|XP_009588662.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
tomentosiformis]
Length=384

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL+GAS +LINRLIPEH++RQMG+ F
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASSDLINRLIPEHIKRQMGMQF  374



>ref|XP_007132829.1| hypothetical protein PHAVU_011G128000g [Phaseolus vulgaris]
 gb|ESW04823.1| hypothetical protein PHAVU_011G128000g [Phaseolus vulgaris]
Length=419

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP YTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  301  REEIRCMNPEYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  360

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRP PPLFNFKQELAG SPEL+NRLIPEH+RRQ GL+ PH  G
Sbjct  361  SFFDELREPNARLPNGRPLPPLFNFKQELAGVSPELVNRLIPEHIRRQTGLSSPHSAG  418



>ref|XP_008343093.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Malus 
domestica]
Length=416

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  298  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  357

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFD+LREPNARLPNGRP PPLFNFKQEL G SPELI RLIPEHVR+Q GL FPHP G
Sbjct  358  PFFDDLREPNARLPNGRPLPPLFNFKQELNGVSPELIKRLIPEHVRQQAGLGFPHPVG  415



>ref|XP_009801781.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
sylvestris]
Length=424

 Score =   232 bits (592),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  306  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  365

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFKQEL GASP+L+ +LIPEHV RQ GLNFP+PG 
Sbjct  366  SFFDELREPNARLPNGRPFPPLFNFKQELTGASPDLVCKLIPEHVWRQTGLNFPYPGA  423



>ref|XP_009378929.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Pyrus 
x bretschneideri]
Length=416

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  298  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  357

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFD+LREPNARLPNGRP PPLFNFKQEL G SPELI RLIPEHVR+Q GL FPHP G
Sbjct  358  PFFDDLREPNARLPNGRPLPPLFNFKQELNGVSPELIKRLIPEHVRQQAGLGFPHPVG  415



>ref|XP_010414192.1| PREDICTED: shaggy-related protein kinase zeta-like [Camelina 
sativa]
Length=411

 Score =   231 bits (590),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  293  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  352

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNGRP PPLFNFKQELAG SPELINRLIPEHVRRQM   FP   GP
Sbjct  353  PFFNELREPNARLPNGRPLPPLFNFKQELAGVSPELINRLIPEHVRRQMNGGFPFQAGP  411



>ref|NP_180655.1| Shaggy-related protein kinase zeta [Arabidopsis thaliana]
 sp|Q39010.2|KSG6_ARATH RecName: Full=Shaggy-related protein kinase zeta; AltName: Full=ASK-zeta 
[Arabidopsis thaliana]
 gb|AAC20732.1| putative shaggy-like protein kinase dzeta [Arabidopsis thaliana]
 gb|AAL36376.1| putative shaggy protein kinase dzeta [Arabidopsis thaliana]
 gb|AAM19796.1| At2g30980/F7F1.19 [Arabidopsis thaliana]
 gb|AAM20332.1| putative shaggy protein kinase dzeta [Arabidopsis thaliana]
 gb|AEC08470.1| Shaggy-related protein kinase zeta [Arabidopsis thaliana]
Length=412

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  294  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNGRP PPLFNFKQEL+GASPELINRLIPEHVRRQM   FP   GP
Sbjct  354  PFFNELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRQMNGGFPFQAGP  412



>ref|XP_011039408.1| PREDICTED: shaggy-related protein kinase eta-like [Populus euphratica]
 ref|XP_011039409.1| PREDICTED: shaggy-related protein kinase eta-like [Populus euphratica]
Length=380

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPH-PG  368
            PFFDELREPNARLPNGRP P LFNFKQEL GASPEL+N+LIP+HV+RQMGLN  H PG
Sbjct  322  PFFDELREPNARLPNGRPLPALFNFKQELNGASPELVNKLIPDHVKRQMGLNLMHLPG  379



>gb|KJB68374.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=381

 Score =   231 bits (588),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIP+HV+RQ+GL +F HP G
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPDHVKRQIGLQHFMHPPG  380



>gb|AAM65084.1| putative shaggy-like protein kinase dzeta [Arabidopsis thaliana]
Length=412

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  294  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNGRP PPLFNFKQEL+GASPELINRLIPEHVRRQM   FP   GP
Sbjct  354  PFFNELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRQMNGGFPFQAGP  412



>gb|KJB68372.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=375

 Score =   230 bits (587),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIP+HV+RQ+GL +F HP G
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPDHVKRQIGLQHFMHPPG  374



>ref|XP_004233047.1| PREDICTED: shaggy-related protein kinase eta [Solanum lycopersicum]
 ref|XP_006358115.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum tuberosum]
Length=382

 Score =   230 bits (587),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASP+L+NRLIP+H++RQMGL+ 
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPDLVNRLIPDHIKRQMGLHL  374



>gb|KJB34901.1| hypothetical protein B456_006G089300 [Gossypium raimondii]
Length=341

 Score =   229 bits (584),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQ+KAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  222  REEIRCMNPNYTDFRFPQMKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  281

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIP+HV+RQ+GL +F HP G
Sbjct  282  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPDHVKRQIGLQHFMHPAG  340



>emb|CAA64408.1| shaggy-like kinase dzeta [Arabidopsis thaliana]
 emb|CAA70483.1| serine/threonine kinase [Arabidopsis thaliana]
Length=412

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  294  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNGRP PPLFNFKQEL+GASPELINRLIPEHVRRQM   FP   GP
Sbjct  354  PFFNELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRQMNGGFPFQAGP  412



>ref|XP_010274430.1| PREDICTED: shaggy-related protein kinase eta-like [Nelumbo nucifera]
Length=412

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  294  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELRE NARLPNGRP PPLFNFKQEL+GASPELIN+LIPEHVRRQ G+NF H  G
Sbjct  354  SFFDELREANARLPNGRPLPPLFNFKQELSGASPELINKLIPEHVRRQFGMNFMHLAG  411



>ref|XP_002526643.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF35731.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=266

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/117 (92%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  148  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  207

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+ ASPELI+RLIPEHVRRQ  L+F HP 
Sbjct  208  PFFDELREPNARLPNGRPLPPLFNFKQELSEASPELISRLIPEHVRRQSTLSFRHPA  264



>gb|KJB34899.1| hypothetical protein B456_006G089300 [Gossypium raimondii]
Length=381

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQ+KAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQMKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIP+HV+RQ+GL +F HP G
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPDHVKRQIGLQHFMHPAG  380



>gb|KJB34900.1| hypothetical protein B456_006G089300 [Gossypium raimondii]
Length=382

 Score =   230 bits (586),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 114/119 (96%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQ+KAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  263  REEIRCMNPNYTDFRFPQMKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIP+HV+RQ+GL +F HP G
Sbjct  323  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPDHVKRQIGLQHFMHPAG  381



>ref|XP_008789340.1| PREDICTED: shaggy-related protein kinase eta [Phoenix dactylifera]
Length=406

 Score =   231 bits (588),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  288  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  347

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRP PPLFNFK ELAGASPELIN+LIPEHVRRQ GL+F HP G
Sbjct  348  SFFDELREPNARLPNGRPLPPLFNFKHELAGASPELINKLIPEHVRRQSGLSFLHPAG  405



>ref|XP_010104417.1| Shaggy-related protein kinase zeta [Morus notabilis]
 gb|EXC00262.1| Shaggy-related protein kinase zeta [Morus notabilis]
Length=436

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 111/116 (96%), Gaps = 0/116 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC+H
Sbjct  297  REEIRCMNPSYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACSH  356

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHP  371
            PFFDELREPN RLPNGRP PPLFNFKQEL+GASPELINRLIPEHVRR   L+FPHP
Sbjct  357  PFFDELREPNVRLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRLASLSFPHP  412



>ref|XP_010915474.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=403

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQELA ASPELIN+LIPEHVRRQ G  FP P G
Sbjct  345  PFFDELREPNARLPNGRPFPPLFNFKQELAVASPELINKLIPEHVRRQYGPTFPLPTG  402



>gb|KCW47358.1| hypothetical protein EUGRSUZ_K01144 [Eucalyptus grandis]
Length=390

 Score =   229 bits (585),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  272  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  331

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLP GRP PP+FNF+QELAGASP+LINRLIPEHVRR  GLN PHP G
Sbjct  332  PFFDELREPNARLPTGRPLPPIFNFRQELAGASPQLINRLIPEHVRRLNGLNIPHPVG  389



>ref|XP_009781118.1| PREDICTED: shaggy-related protein kinase eta [Nicotiana sylvestris]
Length=382

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 111/113 (98%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASP+L+NRLIP+H++RQMG++ 
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPDLVNRLIPDHIKRQMGMHL  374



>gb|AFK40474.1| unknown [Medicago truncatula]
 gb|KEH36622.1| shaggy-like kinase dzeta [Medicago truncatula]
Length=380

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GASPEL+N+LIP+H++RQ+GL F    G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDHIKRQIGLQFVQSVG  379



>ref|XP_010035873.1| PREDICTED: shaggy-related protein kinase eta-like [Eucalyptus 
grandis]
 gb|KCW47357.1| hypothetical protein EUGRSUZ_K01144 [Eucalyptus grandis]
Length=410

 Score =   230 bits (586),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  292  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLP GRP PP+FNF+QELAGASP+LINRLIPEHVRR  GLN PHP G
Sbjct  352  PFFDELREPNARLPTGRPLPPIFNFRQELAGASPQLINRLIPEHVRRLNGLNIPHPVG  409



>ref|XP_009136953.1| PREDICTED: shaggy-related protein kinase eta-like [Brassica rapa]
Length=380

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  379



>gb|ACJ84750.1| unknown [Medicago truncatula]
Length=380

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GASPEL+N+LIP+H++RQ+GL F    G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDHIKRQIGLQFVQSVG  379



>emb|CDX78886.1| BnaA01g09530D [Brassica napus]
Length=374

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  373



>emb|CDY70859.1| BnaAnng35300D [Brassica napus]
Length=374

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  373



>ref|XP_009132133.1| PREDICTED: shaggy-related protein kinase eta [Brassica rapa]
Length=380

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  379



>ref|XP_002870026.1| hypothetical protein ARALYDRAFT_914806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46285.1| hypothetical protein ARALYDRAFT_914806 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  379



>ref|XP_010925615.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=403

 Score =   229 bits (585),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLP+GRPFPPLFNFKQEL  ASPELIN+LIPEHV+RQ GLNF  P G
Sbjct  345  PFFDELREPNARLPSGRPFPPLFNFKQELVDASPELINKLIPEHVKRQYGLNFTRPAG  402



>emb|CDY69647.1| BnaAnng31110D [Brassica napus]
Length=340

 Score =   227 bits (579),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  222  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  281

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPP+FNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  282  PFFDELREPNARLPNGRPFPPIFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  339



>ref|XP_010449479.1| PREDICTED: shaggy-related protein kinase eta [Camelina sativa]
Length=381

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  263  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  323  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  380



>ref|XP_002881146.1| hypothetical protein ARALYDRAFT_902112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57405.1| hypothetical protein ARALYDRAFT_902112 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   229 bits (585),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  294  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELRE NARLPNGRP PPLFNFKQEL+GASPELINRLIPEHVRRQM   FP   GP
Sbjct  354  PFFNELREANARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRQMNGGFPFQAGP  412



>ref|XP_007148029.1| hypothetical protein PHAVU_006G1745001g, partial [Phaseolus vulgaris]
 gb|ESW20023.1| hypothetical protein PHAVU_006G1745001g, partial [Phaseolus vulgaris]
Length=123

 Score =   220 bits (560),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  5    REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACVH  64

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK EL GAS EL+N+LIP+HV+RQ+G+ F HP G
Sbjct  65   PFFDELREPNARLPNGRPFPPLFNFKHELTGASAELVNKLIPDHVKRQIGIQFVHPTG  122



>ref|XP_010439822.1| PREDICTED: shaggy-related protein kinase eta-like [Camelina sativa]
Length=381

 Score =   228 bits (582),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  263  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F    G
Sbjct  323  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLSQSG  380



>ref|XP_008794094.1| PREDICTED: shaggy-related protein kinase eta [Phoenix dactylifera]
Length=403

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHK MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKGMPPEAIDLASRLLQYSPSLRCTALEACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNG PFPPLFNFKQEL GASPELIN+LIPEHVRR  GLNF  P G
Sbjct  345  PFFDELREPNARLPNGHPFPPLFNFKQELVGASPELINKLIPEHVRRLYGLNFTRPAG  402



>emb|CDY34051.1| BnaC03g62810D [Brassica napus]
Length=380

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPP+FNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPIFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  379



>ref|XP_009770234.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
sylvestris]
Length=384

 Score =   228 bits (582),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELRE NARLPNGRP PPLFNFKQEL+GAS +LINRLIPEH++RQMG+ F
Sbjct  322  PFFDELREHNARLPNGRPLPPLFNFKQELSGASSDLINRLIPEHIKRQMGMQF  374



>gb|KHG08917.1| Shaggy-related protein kinase eta [Gossypium arboreum]
Length=382

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQ+KAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  263  REEIRCMNPNYTDFRFPQMKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPGG  365
            PFFDELREPNARLPNGRP P LFNFKQEL+GASPELIN+LIP+HV+RQ+GL  F HP G
Sbjct  323  PFFDELREPNARLPNGRPLPSLFNFKQELSGASPELINKLIPDHVKRQIGLQQFMHPAG  381



>dbj|BAH20356.1| AT4G18710 [Arabidopsis thaliana]
Length=311

 Score =   226 bits (576),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  193  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  252

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AG+SPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  253  PFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSG  310



>ref|XP_009108386.1| PREDICTED: shaggy-related protein kinase eta-like [Brassica rapa]
Length=380

 Score =   228 bits (581),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPP+FNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPIFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  379



>ref|XP_009619543.1| PREDICTED: shaggy-related protein kinase eta [Nicotiana tomentosiformis]
Length=382

 Score =   228 bits (581),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL+GAS +L+NRLIP+H++RQMGL+ 
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASADLVNRLIPDHIKRQMGLHL  374



>ref|XP_008790026.1| PREDICTED: shaggy-related protein kinase eta-like [Phoenix dactylifera]
Length=403

 Score =   228 bits (582),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFP LFNFKQE A ASPELIN+L+PEH RRQ GL FP PGG
Sbjct  345  PFFDELREPNARLPNGRPFPHLFNFKQEAACASPELINKLVPEHARRQYGLTFPLPGG  402



>emb|CAA64409.1| shaggy-like kinase etha [Arabidopsis thaliana]
 emb|CAA70144.1| shaggy-like kinase etha [Arabidopsis thaliana]
Length=380

 Score =   228 bits (580),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDF+FPQIKAHPWHK+FHKRMPPEA+DLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFKFPQIKAHPWHKIFHKRMPPEAVDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQE+AG+SPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSG  379



>ref|NP_193606.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 sp|Q39011.2|KSG7_ARATH RecName: Full=Shaggy-related protein kinase eta; AltName: Full=ASK-eta; 
AltName: Full=Protein BRASSINOSTEROID INSENSITIVE 
2; AltName: Full=Protein ULTRACURVATA 1 [Arabidopsis thaliana]
 emb|CAB37456.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 emb|CAB78873.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 gb|AAM63594.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 gb|AAN71719.1| glycogen synthase kinase 3 beta protein kinase DWARF12 [Arabidopsis 
thaliana]
 gb|ABG48387.1| At4g18710 [Arabidopsis thaliana]
 gb|AEE84079.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 gb|KFK28543.1| hypothetical protein AALP_AA7G010300 [Arabis alpina]
Length=380

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AG+SPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSG  379



>ref|XP_006285118.1| hypothetical protein CARUB_v10006451mg [Capsella rubella]
 gb|EOA18016.1| hypothetical protein CARUB_v10006451mg [Capsella rubella]
Length=380

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGA+PEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQEVAGATPELVNKLIPDHIKRQLGLSFLNQSG  379



>dbj|BAH57105.1| AT4G18710 [Arabidopsis thaliana]
Length=374

 Score =   228 bits (580),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AG+SPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSG  373



>ref|XP_008439730.1| PREDICTED: shaggy-related protein kinase eta [Cucumis melo]
Length=379

 Score =   228 bits (580),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTD+RFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  262  REEIRCMNPSYTDYRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GASPEL+N+LIP+ V+RQMGLN 
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDQVKRQMGLNL  374



>ref|XP_004134656.1| PREDICTED: shaggy-related protein kinase eta-like [Cucumis sativus]
 ref|XP_004163355.1| PREDICTED: shaggy-related protein kinase eta-like [Cucumis sativus]
 gb|KGN49313.1| hypothetical protein Csa_6G519650 [Cucumis sativus]
Length=379

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTD+RFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  262  REEIRCMNPSYTDYRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRPFPPLFNFKQEL+GASPEL+N+LIP+ V+RQMGLN 
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSGASPELVNKLIPDQVKRQMGLNL  374



>gb|AFK46922.1| unknown [Lotus japonicus]
Length=380

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPH  374
            PFFDELREPNARLPNGRP PPLFNFKQE++GASPEL+N+LIP+HV+RQ+GL F H
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQEISGASPELVNKLIPDHVKRQIGLQFVH  376



>ref|XP_009144602.1| PREDICTED: shaggy-related protein kinase zeta-like [Brassica 
rapa]
Length=358

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/109 (97%), Positives = 108/109 (99%), Gaps = 0/109 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  249  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  308

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQM  392
            PFF+ELREPNARLPNGRP PPLFNFKQEL+GASPELINRLIPEHVRRQM
Sbjct  309  PFFNELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVRRQM  357



>gb|KFK31745.1| hypothetical protein AALP_AA6G153600 [Arabis alpina]
Length=405

 Score =   228 bits (581),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  285  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNGRP PPLFNFKQEL+GASPELINRLIPEHV+RQM   FP    P
Sbjct  345  PFFNELREPNARLPNGRPLPPLFNFKQELSGASPELINRLIPEHVKRQMNGGFPFQADP  403



>ref|XP_008365741.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Malus 
domestica]
Length=416

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 108/116 (93%), Gaps = 0/116 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  298  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  357

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHP  371
            PFFD+LREPNARLPNGRP PPLFNFKQEL G SPELI RLIPEHVR+Q GL FP P
Sbjct  358  PFFDDLREPNARLPNGRPLPPLFNFKQELNGVSPELIKRLIPEHVRQQAGLGFPQP  413



>ref|NP_001042341.1| Os01g0205700 [Oryza sativa Japonica Group]
 dbj|BAF04255.1| Os01g0205700, partial [Oryza sativa Japonica Group]
Length=233

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  116  REEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  175

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELI+RLIP+H+RRQ GLNF H G 
Sbjct  176  SFFDELREPNARLPNGRPFPPLFNFKHELASASPELIHRLIPDHIRRQHGLNFAHAGS  233



>ref|XP_010496879.1| PREDICTED: shaggy-related protein kinase eta-like [Camelina sativa]
Length=381

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  263  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGR FPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  323  PFFDELREPNARLPNGRSFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  380



>emb|CDX99437.1| BnaC01g11150D [Brassica napus]
Length=381

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  263  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++ Q+GL+F +  G
Sbjct  323  PFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKTQLGLSFLNQSG  380



>dbj|BAJ33611.1| unnamed protein product [Thellungiella halophila]
Length=380

 Score =   226 bits (577),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQE+A ASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQEVAAASPELVNKLIPDHIKRQLGLSFLNQSG  379



>gb|EMS65432.1| Shaggy-related protein kinase iota [Triticum urartu]
Length=406

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHK+MPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  289  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKKMPPEAIDLASRLLQYSPSLRCTALDACAH  348

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRPFPPLFNFK ELA AS +LINRL+PEHVRRQ GL F H G
Sbjct  349  PFFDELREPNARLPNGRPFPPLFNFKHELANASQDLINRLVPEHVRRQAGLAFVHAG  405



>emb|CDY64921.1| BnaC07g50210D [Brassica napus]
Length=374

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            RE+IRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  256  REDIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLP+GRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  316  PFFDELREPNARLPDGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSFLNQSG  373



>ref|XP_009365289.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Pyrus x bretschneideri]
Length=374

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHP  371
            PFFD+LREPNARLPNGRP PPLFNFK EL G SPELI RLIPEHVR+Q GL FP P
Sbjct  316  PFFDDLREPNARLPNGRPLPPLFNFKHELNGVSPELIKRLIPEHVRQQAGLGFPQP  371



>ref|XP_002889601.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65860.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  295  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGRP PPLFNFKQEL GAS EL+NRLIPEHVRRQMG   
Sbjct  355  PFFNELREPNARLPNGRPLPPLFNFKQELGGASVELVNRLIPEHVRRQMGTGL  407



>ref|XP_006594547.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Glycine max]
 ref|XP_006594548.1| PREDICTED: shaggy-related protein kinase eta-like isoform X3 
[Glycine max]
Length=374

 Score =   226 bits (576),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+ ASPEL+N++IP+H++RQ+GL F  P G
Sbjct  316  PFFDELREPNARLPNGRPFPPLFNFKQELSEASPELVNKVIPDHMKRQIGLQFVRPAG  373



>ref|XP_003542973.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Glycine max]
 gb|KHN08421.1| Shaggy-related protein kinase eta [Glycine soja]
Length=380

 Score =   226 bits (576),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFKQEL+ ASPEL+N++IP+H++RQ+GL F  P G
Sbjct  322  PFFDELREPNARLPNGRPFPPLFNFKQELSEASPELVNKVIPDHMKRQIGLQFVRPAG  379



>ref|XP_008448254.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Cucumis 
melo]
Length=375

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPH  374
            PFFDELRE N RLPN RP PPLFNFKQELAGASPELI+RL+PE+VRRQ+GL   H
Sbjct  316  PFFDELREANVRLPNNRPLPPLFNFKQELAGASPELISRLLPEYVRRQIGLGLQH  370



>gb|KHG20434.1| Shaggy-related protein kinase eta [Gossypium arboreum]
Length=381

 Score =   225 bits (574),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNY DFRFPQ+KAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYMDFRFPQMKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIP+HV+RQ+GL +F HP 
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPDHVKRQIGLQHFMHPA  379



>gb|AGK41246.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41248.1| SHAGGY-like kinase [Triticum aestivum]
Length=402

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHK+MPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKKMPPEAIDLASRLLQYSPSLRCTALDACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK ELA AS +LINRL+PEHVRRQ GL F H G 
Sbjct  345  PFFDELREPNARLPNGRPFPPLFNFKHELANASQDLINRLVPEHVRRQAGLAFVHAGS  402



>ref|XP_010557132.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Tarenaya hassleriana]
Length=410

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  292  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNG P PPLFNFKQELAGASPELI+RLIPEHVRRQM   FP   GP
Sbjct  352  PFFNELREPNARLPNGCPLPPLFNFKQELAGASPELISRLIPEHVRRQMTGAFPFQTGP  410



>ref|XP_004234083.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Solanum 
lycopersicum]
Length=382

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC ALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCNALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLP+GR  PPLFNFKQELAGASP+LINRLIP+H++RQMGL+ 
Sbjct  322  PFFDELREPNARLPHGRQLPPLFNFKQELAGASPDLINRLIPDHIKRQMGLHL  374



>ref|XP_010920339.1| PREDICTED: shaggy-related protein kinase eta [Elaeis guineensis]
Length=406

 Score =   226 bits (576),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  288  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  347

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRP PPLFNFK ELA  SPELIN+LIPEHV+RQ GL+F HP G
Sbjct  348  SFFDELREPNARLPNGRPLPPLFNFKHELASVSPELINKLIPEHVKRQSGLSFLHPAG  405



>gb|EMS48919.1| Shaggy-related protein kinase eta [Triticum urartu]
Length=353

 Score =   224 bits (571),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSP+LRCTAL+ACAH
Sbjct  236  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAH  295

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELINRL+PEHVRRQ GLNF H G 
Sbjct  296  SFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGLNFAHAGS  353



>gb|AGJ93558.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGJ93559.1| SHAGGY-like kinase [Triticum aestivum]
Length=402

 Score =   226 bits (575),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHK+MPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKKMPPEAIDLASRLLQYSPSLRCTALDACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK ELA AS +LINRL+PEHVRRQ GL F H G 
Sbjct  345  PFFDELREPNARLPNGRPFPPLFNFKHELANASQDLINRLVPEHVRRQAGLAFVHAGS  402



>ref|XP_010317426.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Solanum 
lycopersicum]
Length=381

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC ALEACAH
Sbjct  261  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCNALEACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLP+GR  PPLFNFKQELAGASP+LINRLIP+H++RQMGL+ 
Sbjct  321  PFFDELREPNARLPHGRQLPPLFNFKQELAGASPDLINRLIPDHIKRQMGLHL  373



>ref|XP_009392422.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=400

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSP  RC+ALEACAH
Sbjct  282  REEIRCMNPSYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPCFRCSALEACAH  341

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNF QELAGASPELIN+LIPEHVRRQ GL F HP G
Sbjct  342  PFFDELREPNARLPNGRPLPPLFNFNQELAGASPELINKLIPEHVRRQSGLGFLHPAG  399



>gb|EMT26120.1| Shaggy-related protein kinase iota [Aegilops tauschii]
Length=421

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHK+MPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  304  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKKMPPEAIDLASRLLQYSPSLRCTALDACAH  363

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK ELA AS +LINRL+PEHVRRQ GL F H G 
Sbjct  364  PFFDELREPNARLPNGRPFPPLFNFKHELANASQDLINRLVPEHVRRQAGLAFVHAGS  421



>emb|CDM82043.1| unnamed protein product [Triticum aestivum]
Length=391

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSP+LRCTAL+ACAH
Sbjct  274  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAH  333

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELINRL+PEHVRRQ GLNF H G
Sbjct  334  SFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGLNFAHAG  390



>gb|EYU43326.1| hypothetical protein MIMGU_mgv1a008172mg [Erythranthe guttata]
Length=382

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVF KRMP EAIDLASRLLQYSP+LRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFQKRMPAEAIDLASRLLQYSPNLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
             FFDELREPNARLPNGRP PPLFNFKQEL+GASPELIN+LIP+HV+RQMGL F
Sbjct  322  SFFDELREPNARLPNGRPLPPLFNFKQELSGASPELINKLIPDHVKRQMGLQF  374



>ref|XP_009365288.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Pyrus x bretschneideri]
Length=416

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 107/116 (92%), Gaps = 0/116 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  298  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACTH  357

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHP  371
            PFFD+LREPNARLPNGRP PPLFNFK EL G SPELI RLIPEHVR+Q GL FP P
Sbjct  358  PFFDDLREPNARLPNGRPLPPLFNFKHELNGVSPELIKRLIPEHVRQQAGLGFPQP  413



>ref|XP_006367136.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum tuberosum]
Length=382

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/112 (92%), Positives = 109/112 (97%), Gaps = 0/112 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRC ALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCNALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLN  383
            PFFDELREPNARLP+GR  PPLFNFKQELAGASP+LINRLIP+H++RQMGL+
Sbjct  322  PFFDELREPNARLPHGRQLPPLFNFKQELAGASPDLINRLIPDHIKRQMGLH  373



>dbj|BAA92966.1| putative shaggy-like kinase dzeta [Oryza sativa Japonica Group]
Length=407

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  290  REEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  349

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELI+RLIP+H+RRQ GLNF H G
Sbjct  350  SFFDELREPNARLPNGRPFPPLFNFKHELASASPELIHRLIPDHIRRQHGLNFAHAG  406



>gb|AAL77705.1| AT4g18710/F28A21_120 [Arabidopsis thaliana]
Length=380

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP+YTDFRFPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDE REPNARLPNGRPFPPLFNFKQE+AG+SPEL+N+LIP+H++RQ+GL+F +  G
Sbjct  322  PFFDEHREPNARLPNGRPFPPLFNFKQEVAGSSPELVNKLIPDHIKRQLGLSFLNQSG  379



>gb|ACN27271.1| unknown [Zea mays]
Length=191

 Score =   218 bits (556),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  73   REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  132

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFDELREP+ARLPNGRPFPPLFNFKQELA ASPELINRLIP+H RR +GL      GP
Sbjct  133  PFFDELREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPTAGP  191



>gb|EEC70138.1| hypothetical protein OsI_00828 [Oryza sativa Indica Group]
Length=404

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  287  REEIRCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  346

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELI+RLIP+H+RRQ GLNF H G
Sbjct  347  SFFDELREPNARLPNGRPFPPLFNFKHELASASPELIHRLIPDHIRRQHGLNFAHAG  403



>ref|XP_011085977.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Sesamum 
indicum]
Length=382

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVF KRMPPEAIDL SRLLQYSP+LRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFQKRMPPEAIDLTSRLLQYSPNLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP P LFNFKQELAGASP+LIN+LIP+HV+RQMGL F
Sbjct  322  PFFDELREPNARLPNGRPLPHLFNFKQELAGASPDLINKLIPDHVKRQMGLQF  374



>ref|XP_011085978.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Sesamum 
indicum]
Length=376

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/113 (91%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVF KRMPPEAIDL SRLLQYSP+LRCTALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFQKRMPPEAIDLTSRLLQYSPNLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP P LFNFKQELAGASP+LIN+LIP+HV+RQMGL F
Sbjct  316  PFFDELREPNARLPNGRPLPHLFNFKQELAGASPDLINKLIPDHVKRQMGLQF  368



>ref|XP_004968576.1| PREDICTED: shaggy-related protein kinase iota-like [Setaria italica]
Length=406

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC+AL+ACAH
Sbjct  289  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSALDACAH  348

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELR PNARLPNGRPFPPLFNFK ELA ASPEL+NRLIPEH+RRQ G+NF H G
Sbjct  349  PFFDELRAPNARLPNGRPFPPLFNFKHELANASPELVNRLIPEHIRRQHGVNFGHAG  405



>emb|CDY66894.1| BnaCnng52760D [Brassica napus]
Length=374

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR TALEACAH
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRYTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFP-HPG  368
            PFF+ELREPNARLPNGRP P LFNFKQELAGASPELINRLIPEH+RRQM   FP  PG
Sbjct  316  PFFNELREPNARLPNGRPLPALFNFKQELAGASPELINRLIPEHIRRQMSGGFPSQPG  373



>gb|AGJ93554.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41243.1| SHAGGY-like kinase [Triticum aestivum]
Length=400

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSP+LRCTAL+ACAH
Sbjct  283  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAH  342

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELINRL+PEHVRRQ GLNF H G
Sbjct  343  SFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGLNFAHAG  399



>ref|XP_010475366.1| PREDICTED: shaggy-related protein kinase iota-like [Camelina 
sativa]
Length=417

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  299  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  358

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGRP PPLFNFKQEL GAS ELINRLIPEHVRRQM    
Sbjct  359  PFFNELREPNARLPNGRPLPPLFNFKQELGGASVELINRLIPEHVRRQMSTGL  411



>ref|XP_010924595.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=406

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPSLRCTAL+ACAH
Sbjct  288  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSLRCTALDACAH  347

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFK ELAGASPELIN+LIPE+VRRQ GL+  H  G
Sbjct  348  PFFDELREPNARLPNGRPLPPLFNFKHELAGASPELINKLIPEYVRRQSGLSVLHSAG  405



>ref|XP_009141120.1| PREDICTED: shaggy-related protein kinase zeta [Brassica rapa]
 emb|CDX97773.1| BnaC04g41660D [Brassica napus]
Length=410

 Score =   225 bits (573),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLR TALEACAH
Sbjct  292  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRYTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFP-HPG  368
            PFF+ELREPNARLPNGRP P LFNFKQELAGASPELINRLIPEH+RRQM   FP  PG
Sbjct  352  PFFNELREPNARLPNGRPLPALFNFKQELAGASPELINRLIPEHIRRQMSGGFPSQPG  409



>dbj|BAJ91341.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96026.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSP+LRCTAL+ACAH
Sbjct  283  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAH  342

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELINRL+PEHVRRQ GLNF H G
Sbjct  343  SFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGLNFAHAG  399



>ref|XP_008448253.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Cucumis 
melo]
Length=425

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  306  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  365

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPH  374
            PFFDELRE N RLPN RP PPLFNFKQELAGASPELI+RL+PE+VRRQ+GL   H
Sbjct  366  PFFDELREANVRLPNNRPLPPLFNFKQELAGASPELISRLLPEYVRRQIGLGLQH  420



>gb|AGK41245.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41247.1| SHAGGY-like kinase [Triticum aestivum]
Length=400

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/117 (90%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSP+LRCTAL+ACAH
Sbjct  283  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAH  342

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELINRL+PEHVRRQ GLNF H G
Sbjct  343  SFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGLNFAHAG  399



>gb|ACG34459.1| shaggy-related protein kinase eta [Zea mays]
Length=406

 Score =   224 bits (571),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/117 (88%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC+AL+ACAH
Sbjct  289  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSALDACAH  348

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELR PNARLPNGRPFPPLFNFK ELA ASP+LINRL+PEH+RRQ G+NF H G
Sbjct  349  PFFDELRAPNARLPNGRPFPPLFNFKHELANASPDLINRLVPEHIRRQNGVNFGHIG  405



>ref|XP_010457765.1| PREDICTED: shaggy-related protein kinase iota [Camelina sativa]
Length=413

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  295  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGRP PPLFNFKQEL GAS ELINRLIPEHVRRQM    
Sbjct  355  PFFNELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQMSTGL  407



>gb|KFK42959.1| hypothetical protein AALP_AA1G061200 [Arabis alpina]
Length=409

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 105/109 (96%), Positives = 107/109 (98%), Gaps = 0/109 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  294  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQM  392
            PFF+ELREPNARLPNGRP PPLFNFKQEL+GAS ELINRLIPEHVRRQM
Sbjct  354  PFFNELREPNARLPNGRPLPPLFNFKQELSGASLELINRLIPEHVRRQM  402



>gb|EYU30768.1| hypothetical protein MIMGU_mgv1a006689mg [Erythranthe guttata]
Length=435

 Score =   225 bits (573),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/116 (90%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNY+DFRFPQIKAHPWHKVFHKRMPPEAIDLASRLL YSP+LRCTALEACAH
Sbjct  314  REEIRCMNPNYSDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLHYSPNLRCTALEACAH  373

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHP  371
            PFFDELREPNARLPNGRPFPPLFNFKQEL G+ PEL+N+LIPEH+RRQ GL FP P
Sbjct  374  PFFDELREPNARLPNGRPFPPLFNFKQELNGSYPELMNKLIPEHIRRQAGLTFPFP  429



>dbj|BAH19519.1| AT1G06390 [Arabidopsis thaliana]
Length=407

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  292  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGRP PPLFNFKQEL GAS ELINRLIPEHVRRQM    
Sbjct  352  PFFNELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQMSTGL  404



>ref|NP_172127.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 ref|NP_973771.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 sp|Q39012.1|KSG9_ARATH RecName: Full=Shaggy-related protein kinase iota; AltName: Full=ASK-iota 
[Arabidopsis thaliana]
 gb|AAF82167.1|AC068143_9 Contains a very strong similarity to a shaggy-like kinase iota 
from Arabidopsis thaliana gb|X99696 and contains an eukaryotic 
protein kinase PF|00069 domain. EST gb|N37432 comes from 
this gene [Arabidopsis thaliana]
 emb|CAA68027.1| shaggy-like protein kinase iota [Arabidopsis thaliana]
 gb|AAB71545.1| GSK3/shaggy-like protein kinase [Arabidopsis thaliana]
 gb|AAK59553.1| putative shaggy kinase [Arabidopsis thaliana]
 gb|AAK93730.1| putative shaggy kinase [Arabidopsis thaliana]
 gb|AEE27980.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 gb|AEE27981.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
Length=407

 Score =   224 bits (570),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/113 (93%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  292  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGRP PPLFNFKQEL GAS ELINRLIPEHVRRQM    
Sbjct  352  PFFNELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHVRRQMSTGL  404



>gb|KJB34905.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=357

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNY DFRFPQ+KAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  238  REEIRCMNPNYMDFRFPQMKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  297

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+ ASPELIN+LIP+HV+RQ+GL +F HP 
Sbjct  298  PFFDELREPNARLPNGRPLPPLFNFKQELSEASPELINKLIPDHVKRQIGLQHFMHPA  355



>ref|XP_010231609.1| PREDICTED: shaggy-related protein kinase eta [Brachypodium distachyon]
Length=403

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  286  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  345

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELRE NARLPNGRPFPPLFNFK ELA AS +LINRL+PEHVRRQ G NF H G 
Sbjct  346  PFFDELRELNARLPNGRPFPPLFNFKHELANASADLINRLVPEHVRRQPGFNFFHAGS  403



>ref|XP_006647108.1| PREDICTED: shaggy-related protein kinase zeta-like [Oryza brachyantha]
Length=383

 Score =   223 bits (568),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  265  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  324

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFDELREP+ARLPNGRPFPPLFNFKQEL  ASPELINRLIPEH RR  G NF    GP
Sbjct  325  PFFDELREPHARLPNGRPFPPLFNFKQELVNASPELINRLIPEHARRHCGFNFLPAAGP  383



>ref|XP_010486052.1| PREDICTED: shaggy-related protein kinase iota-like [Camelina 
sativa]
Length=413

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  295  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGRP PPLFN KQEL GAS ELINRLIPEHVRRQM    
Sbjct  355  PFFNELREPNARLPNGRPLPPLFNLKQELGGASMELINRLIPEHVRRQMSTGL  407



>ref|XP_010686226.1| PREDICTED: shaggy-related protein kinase eta [Beta vulgaris subsp. 
vulgaris]
Length=380

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNY+DFRFPQIKA PWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYSDFRFPQIKATPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGR  PPLFN+KQEL+GAS +LIN+LIPEHVRRQ G N  HP G
Sbjct  322  PFFDELREPNARLPNGRSLPPLFNYKQELSGASSDLINKLIPEHVRRQHGHNMMHPTG  379



>emb|CDO96835.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   223 bits (567),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/118 (85%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELR+PN RLPNGR  P LFNFKQEL+GA P+LINRL+P+H++RQMG+   HP G
Sbjct  322  SFFDELRDPNTRLPNGRHLPQLFNFKQELSGAHPDLINRLVPDHIKRQMGIQLMHPTG  379



>ref|XP_004149276.1| PREDICTED: shaggy-related protein kinase zeta-like [Cucumis sativus]
 ref|XP_004162470.1| PREDICTED: shaggy-related protein kinase zeta-like [Cucumis sativus]
Length=425

 Score =   224 bits (570),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPW+KVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  306  REEIRCMNPNYTDFRFPQIKAHPWYKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  365

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPH  374
            PFFDELRE N RLPN RP PPLFNFKQELAGASPELI+RL+PE+VRRQ+GL   H
Sbjct  366  PFFDELREANVRLPNNRPLPPLFNFKQELAGASPELISRLLPEYVRRQIGLGLQH  420



>ref|XP_006307671.1| hypothetical protein CARUB_v10009298mg [Capsella rubella]
 gb|EOA40569.1| hypothetical protein CARUB_v10009298mg [Capsella rubella]
Length=412

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  294  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL GAS ELINRLIPEH+RR M    
Sbjct  354  PFFDELREPNARLPNGRPLPPLFNFKQELGGASMELINRLIPEHMRRHMSTGL  406



>gb|KJB34902.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=381

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNY DFRFPQ+KAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYMDFRFPQMKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPG  368
            PFFDELREPNARLPNGRP PPLFNFKQEL+ ASPELIN+LIP+HV+RQ+GL +F HP 
Sbjct  322  PFFDELREPNARLPNGRPLPPLFNFKQELSEASPELINKLIPDHVKRQIGLQHFMHPA  379



>gb|KHN28622.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  256  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREP+ARLPNGRPFPPLFNFKQEL+ ASP L+N+LIP+HV+RQ+GL F  P G
Sbjct  316  PFFDELREPHARLPNGRPFPPLFNFKQELSEASPVLVNKLIPDHVKRQIGLQFVPPAG  373



>gb|AGJ93556.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGJ93557.1| SHAGGY-like kinase [Triticum aestivum]
Length=402

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHK+MPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKKMPPEAIDLASRLLQYSPSLRCTALDACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDEL EPNARLPNGRPFPPLFNFK ELA AS +LINRL+PEHVRRQ GL F H G 
Sbjct  345  PFFDELWEPNARLPNGRPFPPLFNFKHELANASQDLINRLVPEHVRRQAGLAFVHAGS  402



>gb|KDP21116.1| hypothetical protein JCGZ_21587 [Jatropha curcas]
Length=379

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELRE NARLPNGRP PPLFN KQEL GASPELIN+LIP+HV+RQM  NF H  G
Sbjct  322  PFFDELRELNARLPNGRPLPPLFNCKQELNGASPELINKLIPDHVKRQMA-NFLHLAG  378



>ref|XP_003546036.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REE+RCMNPNY DFRFPQIKAHPWHK+FHK+MPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  262  REEVRCMNPNYNDFRFPQIKAHPWHKIFHKKMPPEAIDLASRLLQYSPSLRCTALEACAH  321

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREP+ARLPNGRPFPPLFNFKQEL+ ASP L+N+LIP+HV+RQ+GL F  P G
Sbjct  322  PFFDELREPHARLPNGRPFPPLFNFKQELSEASPVLVNKLIPDHVKRQIGLQFVPPAG  379



>ref|XP_004951349.1| PREDICTED: shaggy-related protein kinase eta-like [Setaria italica]
Length=414

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/119 (88%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  296  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  355

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFDELREP+ARLPNGRPFPPLFNFKQELA ASPELINRLIP+H RR +GL F    GP
Sbjct  356  PFFDELREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTFLPATGP  414



>ref|XP_006417928.1| hypothetical protein EUTSA_v10007772mg [Eutrema salsugineum]
 gb|ESQ36281.1| hypothetical protein EUTSA_v10007772mg [Eutrema salsugineum]
Length=410

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/113 (92%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  295  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGRP PPLFNFKQEL G S ELINRLIPEHVRRQM    
Sbjct  355  PFFNELREPNARLPNGRPLPPLFNFKQELTGVSLELINRLIPEHVRRQMSTGL  407



>ref|XP_010522087.1| PREDICTED: shaggy-related protein kinase iota [Tarenaya hassleriana]
Length=411

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  292  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFP  377
            PFFDELREPNARLPNGRP P LFNF+QEL GAS ELI+RLIPEHVRRQM   FP
Sbjct  352  PFFDELREPNARLPNGRPLPSLFNFRQELGGASTELISRLIPEHVRRQMNGAFP  405



>ref|NP_001131812.1| putative glycogen synthase kinase family protein [Zea mays]
 gb|ACF80388.1| unknown [Zea mays]
 gb|ACF85585.1| unknown [Zea mays]
 gb|AFW80359.1| putative glycogen synthase kinase family protein [Zea mays]
Length=406

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC+AL+ACAH
Sbjct  289  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSALDACAH  348

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELR PNARLPNGRPFPPLFNFK ELA ASP+LINRL+PE +RRQ G+NF H G
Sbjct  349  PFFDELRAPNARLPNGRPFPPLFNFKHELANASPDLINRLVPEQIRRQNGVNFGHTG  405



>gb|KGN46984.1| hypothetical protein Csa_6G157100 [Cucumis sativus]
Length=441

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPW+KVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH
Sbjct  322  REEIRCMNPNYTDFRFPQIKAHPWYKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  381

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPH  374
            PFFDELRE N RLPN RP PPLFNFKQELAGASPELI+RL+PE+VRRQ+GL   H
Sbjct  382  PFFDELREANVRLPNNRPLPPLFNFKQELAGASPELISRLLPEYVRRQIGLGLQH  436



>ref|XP_009394828.1| PREDICTED: shaggy-related protein kinase eta [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 108/113 (96%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDL SRLLQYSPS RCTALEACAH
Sbjct  288  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPLEAIDLTSRLLQYSPSFRCTALEACAH  347

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL+GASPELI++LIPEHVRRQ GL+F
Sbjct  348  PFFDELREPNARLPNGRPLPPLFNFKQELSGASPELIDKLIPEHVRRQSGLSF  400



>gb|AFW71144.1| putative glycogen synthase kinase family protein [Zea mays]
Length=409

 Score =   223 bits (567),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  291  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  350

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFDELREP+ARLPNGRPFPPLFNFKQELA ASPELINRLIP+H RR +GL      GP
Sbjct  351  PFFDELREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPTAGP  409



>gb|ABG74917.1| BIN2-like protein [Brassica napus]
Length=387

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/125 (82%), Positives = 114/125 (91%), Gaps = 7/125 (6%)
 Frame = -2

Query  718  REEIRCMNPNYTDFR-------FPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCT  560
            REEIRCMNP+YTDFR       FPQIKAHPWHK+FHKRMPPEAID ASRLLQYSPSLRCT
Sbjct  262  REEIRCMNPHYTDFRYHYTDFRFPQIKAHPWHKIFHKRMPPEAIDFASRLLQYSPSLRCT  321

Query  559  ALEACAHPFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            ALEACAHPFFDELREPNARLPNGRPFPPLFNFKQE+AGASPEL+N+LIP+H++RQ+GL+F
Sbjct  322  ALEACAHPFFDELREPNARLPNGRPFPPLFNFKQEVAGASPELVNKLIPDHIKRQLGLSF  381

Query  379  PHPGG  365
             +  G
Sbjct  382  LNQSG  386



>ref|XP_006654148.1| PREDICTED: shaggy-related protein kinase zeta-like [Oryza brachyantha]
Length=339

 Score =   220 bits (561),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  222  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  281

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK ELA +SPELI+RL+PEHVRRQ   NF + G 
Sbjct  282  PFFDELREPNARLPNGRPFPPLFNFKHELANSSPELISRLVPEHVRRQADHNFFNAGS  339



>ref|NP_001149983.1| shaggy-related protein kinase eta [Zea mays]
 gb|ACG37405.1| shaggy-related protein kinase eta [Zea mays]
Length=409

 Score =   222 bits (566),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  291  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  350

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFDELREP+ARLPNGRPFPPLFNFKQELA ASPELINRLIP+H RR +GL      GP
Sbjct  351  PFFDELREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPTTGP  409



>gb|EMT19129.1| Shaggy-related protein kinase iota [Aegilops tauschii]
Length=378

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSP+LRCTAL+ACAH
Sbjct  261  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAH  320

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELINRL+PEHVRRQ G NF H G
Sbjct  321  SFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGPNFAHAG  377



>ref|XP_010557131.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X1 
[Tarenaya hassleriana]
Length=411

 Score =   222 bits (565),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/120 (90%), Positives = 110/120 (92%), Gaps = 1/120 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  292  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQE-LAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFF+ELREPNARLPNG P PPLFNFKQE LAGASPELI+RLIPEHVRRQM   FP   GP
Sbjct  352  PFFNELREPNARLPNGCPLPPLFNFKQEQLAGASPELISRLIPEHVRRQMTGAFPFQTGP  411



>ref|XP_002454973.1| hypothetical protein SORBIDRAFT_03g002380 [Sorghum bicolor]
 gb|EES00093.1| hypothetical protein SORBIDRAFT_03g002380 [Sorghum bicolor]
Length=404

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 102/117 (87%), Positives = 110/117 (94%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC+AL+ACAH
Sbjct  287  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSALDACAH  346

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELR PNARLPNGRPFP LFNFK ELA ASP+LINRL+PEH+RRQ G+NF H G
Sbjct  347  PFFDELRAPNARLPNGRPFPLLFNFKHELANASPDLINRLVPEHIRRQNGVNFGHVG  403



>ref|XP_010689734.1| PREDICTED: shaggy-related protein kinase eta [Beta vulgaris subsp. 
vulgaris]
Length=407

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC H
Sbjct  293  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACVH  352

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFP  377
            PFFDELREPNARL NGRP PPLFNFKQELAGA PE INRLIPEHVRRQ G   P
Sbjct  353  PFFDELREPNARLLNGRPLPPLFNFKQELAGAPPEFINRLIPEHVRRQSGCPLP  406



>gb|EEC72801.1| hypothetical protein OsI_06492 [Oryza sativa Indica Group]
Length=369

 Score =   220 bits (561),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 108/119 (91%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  251  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  310

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
             FFDELREP+ARLPNGRPFPPLFNFKQELA  SPELINRLIPEH RR  G NF    GP
Sbjct  311  SFFDELREPHARLPNGRPFPPLFNFKQELANISPELINRLIPEHARRHCGFNFLPAAGP  369



>gb|EEC78696.1| hypothetical protein OsI_18849 [Oryza sativa Indica Group]
Length=236

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  119  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  178

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
            PFFDELREPNARLPNGRPFPPLFNFK ELA +S ELI+RLIPEHVRRQ   NF + G
Sbjct  179  PFFDELREPNARLPNGRPFPPLFNFKHELANSSQELISRLIPEHVRRQATHNFFNTG  235



>ref|XP_002453590.1| hypothetical protein SORBIDRAFT_04g008580 [Sorghum bicolor]
 gb|EES06566.1| hypothetical protein SORBIDRAFT_04g008580 [Sorghum bicolor]
Length=417

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  299  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  358

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFDELREP+ARLPNGRPFPPLFNFKQELA ASPELINRLIP+H RR +GL      GP
Sbjct  359  PFFDELREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPTTGP  417



>gb|ACG33866.1| shaggy-related protein kinase eta [Zea mays]
Length=400

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC+AL+ACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSALDACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELR PNARLPNGRPFPPLFNFK ELA ASP+L++RL+PEH+RRQ+G+NF
Sbjct  345  PFFDELRTPNARLPNGRPFPPLFNFKHELANASPDLVSRLVPEHIRRQIGVNF  397



>ref|NP_001149135.1| shaggy-related protein kinase eta [Zea mays]
 gb|ACG34332.1| shaggy-related protein kinase eta [Zea mays]
 gb|ACL53875.1| unknown [Zea mays]
 tpg|DAA52908.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=400

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC+AL+ACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSALDACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELR PNARLPNGRPFPPLFNFK ELA ASP+L++RL+PEH+RRQ+G+NF
Sbjct  345  PFFDELRTPNARLPNGRPFPPLFNFKHELANASPDLVSRLVPEHIRRQIGVNF  397



>gb|AGJ93555.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41244.1| SHAGGY-like kinase [Triticum aestivum]
Length=401

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSP+LRCTAL+ACAH
Sbjct  284  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPNLRCTALDACAH  343

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             FFDELREPNARLPNGRPFPPLFNFK ELA ASPELINRL+PEHVRRQ G NF H G 
Sbjct  344  SFFDELREPNARLPNGRPFPPLFNFKPELANASPELINRLVPEHVRRQNGPNFAHAGS  401



>ref|NP_001130511.1| uncharacterized protein LOC100191610 [Zea mays]
 gb|ACF78757.1| unknown [Zea mays]
 gb|ACF84377.1| unknown [Zea mays]
 gb|ACF87812.1| unknown [Zea mays]
 gb|ACG36869.1| shaggy-related protein kinase eta [Zea mays]
 gb|AFW65991.1| putative glycogen synthase kinase family protein [Zea mays]
Length=412

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  294  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFD+LREP+ARLPNGRPFPPLFNFKQELA ASPELINRLIP+H RR +GL      GP
Sbjct  354  PFFDDLREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPATGP  412



>ref|XP_008672878.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Zea 
mays]
 gb|ACN32041.1| unknown [Zea mays]
 tpg|DAA52909.1| TPA: putative glycogen synthase kinase family protein [Zea mays]
Length=429

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/113 (88%), Positives = 110/113 (97%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSPSLRC+AL+ACAH
Sbjct  314  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPSLRCSALDACAH  373

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELR PNARLPNGRPFPPLFNFK ELA ASP+L++RL+PEH+RRQ+G+NF
Sbjct  374  PFFDELRTPNARLPNGRPFPPLFNFKHELANASPDLVSRLVPEHIRRQIGVNF  426



>gb|ACG33869.1| shaggy-related protein kinase eta [Zea mays]
Length=412

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/119 (87%), Positives = 110/119 (92%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQYSP+LRCTALEACAH
Sbjct  294  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYSPNLRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
            PFFD+LREP+ARLPNGRPFPPLFNFKQELA ASPELINRLIP+H RR +GL      GP
Sbjct  354  PFFDDLREPHARLPNGRPFPPLFNFKQELANASPELINRLIPDHARRHLGLTLLPATGP  412



>ref|XP_003565257.1| PREDICTED: shaggy-related protein kinase eta-like [Brachypodium 
distachyon]
Length=399

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/117 (89%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMP EAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  282  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPAEAIDLASRLLQYSPSLRCTALDACAH  341

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPG  368
             FFDELREPNARLPNGRPFPPLFNFK EL  AS ELINRLIPEHVRRQ  LNF H G
Sbjct  342  SFFDELREPNARLPNGRPFPPLFNFKPELVNASLELINRLIPEHVRRQNSLNFAHSG  398



>ref|XP_009416503.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=412

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 106/118 (90%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNP YT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPS RCTALEACAH
Sbjct  294  REEIRCMNPGYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSFRCTALEACAH  353

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRP PPL+NFKQELAGASP+LIN+LIPEH RRQ G    H  G
Sbjct  354  PFFDELREPNARLPNGRPLPPLYNFKQELAGASPDLINKLIPEHARRQSGFGCLHMAG  411



>emb|CDP15948.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDL SRLLQYSPSLRCTALEACAH
Sbjct  316  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLTSRLLQYSPSLRCTALEACAH  375

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFD+LR+P+ RLPN RP P LF+FKQEL+GASPELINRLIPEHVRRQ   + PHP G
Sbjct  376  PFFDDLRDPHVRLPNNRPLPTLFDFKQELSGASPELINRLIPEHVRRQTTGHCPHPSG  433



>ref|XP_009394192.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/113 (90%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPS RCTALEACAH
Sbjct  292  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSFRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP P LFNFK ELAGASPELI +LIPEHVRRQ GL+F
Sbjct  352  PFFDELREPNARLPNGRPLPSLFNFKPELAGASPELIAKLIPEHVRRQSGLSF  404



>gb|EEE62704.1| hypothetical protein OsJ_17507 [Oryza sativa Japonica Group]
Length=383

 Score =   218 bits (555),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  266  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  325

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK ELA +S ELI+RLIPEHVRRQ   NF + G 
Sbjct  326  PFFDELREPNARLPNGRPFPPLFNFKHELANSSQELISRLIPEHVRRQATHNFFNTGS  383



>ref|XP_009396521.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPS RCTALEACAH
Sbjct  292  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSFRCTALEACAH  351

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLF+FKQEL GASPELI++LIPEH+RRQ  L+F
Sbjct  352  PFFDELREPNARLPNGRPLPPLFDFKQELNGASPELIDKLIPEHLRRQSSLSF  404



>ref|NP_001054901.1| Os05g0207500 [Oryza sativa Japonica Group]
 gb|AAU90187.1| putative shaggy-related protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF16815.1| Os05g0207500 [Oryza sativa Japonica Group]
Length=402

 Score =   218 bits (556),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTAL+ACAH
Sbjct  285  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALDACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            PFFDELREPNARLPNGRPFPPLFNFK ELA +S ELI+RLIPEHVRRQ   NF + G 
Sbjct  345  PFFDELREPNARLPNGRPFPPLFNFKHELANSSQELISRLIPEHVRRQATHNFFNTGS  402



>gb|EYU28104.1| hypothetical protein MIMGU_mgv1a008133mg [Erythranthe guttata]
Length=383

 Score =   216 bits (550),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 107/113 (95%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVF K MPPEAIDLASRLLQYSP+LR +AL+AC+H
Sbjct  263  REEIRCMNPNYTDFRFPQIKAHPWHKVFQKLMPPEAIDLASRLLQYSPNLRLSALDACSH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFKQEL+GAS +LIN+LIP+HV+RQMGL F
Sbjct  323  PFFDELREPNARLPNGRPLPPLFNFKQELSGASSDLINKLIPDHVKRQMGLQF  375



>gb|AFM94293.1| glycogen synthase kinase [Oncidium hybrid cultivar]
Length=372

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 100/108 (93%), Positives = 103/108 (95%), Gaps = 0/108 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDL SRLLQYSP LR TALEACAH
Sbjct  263  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLTSRLLQYSPILRYTALEACAH  322

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQ  395
            PFFDELREPNARLPNGRPFPPLFNFKQEL GASPEL+N+LI EH+RRQ
Sbjct  323  PFFDELREPNARLPNGRPFPPLFNFKQELGGASPELMNKLILEHLRRQ  370



>ref|XP_006833052.1| hypothetical protein AMTR_s00170p00028260 [Amborella trichopoda]
 gb|ERM98330.1| hypothetical protein AMTR_s00170p00028260 [Amborella trichopoda]
Length=355

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/113 (88%), Positives = 104/113 (92%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSP+LRCTALEAC H
Sbjct  243  REEIRCMNPNYTEFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPNLRCTALEACVH  302

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELREPNARLPNGRP PPLFNFK EL GA PELIN+LIPEH R Q  L+F
Sbjct  303  PFFDELREPNARLPNGRPLPPLFNFKLELHGAPPELINKLIPEHARNQSLLSF  355



>emb|CDY52692.1| BnaC04g54320D [Brassica napus]
Length=113

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/112 (89%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = -2

Query  700  MNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAHPFFDEL  521
            MNPNYTDFRFPQIKAHPWHKVFHKRMPPE IDLASRLLQYSPSLRCTALEACAHPFF EL
Sbjct  1    MNPNYTDFRFPQIKAHPWHKVFHKRMPPETIDLASRLLQYSPSLRCTALEACAHPFFSEL  60

Query  520  REPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            REPNARLPNGRP PPLFNFKQEL+GAS ELI+RLIPEHVRRQM   FP   G
Sbjct  61   REPNARLPNGRPLPPLFNFKQELSGASLELIDRLIPEHVRRQMSGGFPLQAG  112



>ref|XP_009410924.1| PREDICTED: shaggy-related protein kinase iota isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=377

 Score =   213 bits (541),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPS RCTALEACAH
Sbjct  259  REEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSFRCTALEACAH  318

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELR  NARLP+GRP P LFNFKQELAGASPELI +LIPEH RR   L F
Sbjct  319  PFFDELRGSNARLPDGRPLPALFNFKQELAGASPELIGKLIPEHARRHSDLGF  371



>ref|XP_009410923.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=390

 Score =   213 bits (541),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSPS RCTALEACAH
Sbjct  272  REEIRCMNPNYTDFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPSFRCTALEACAH  331

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFFDELR  NARLP+GRP P LFNFKQELAGASPELI +LIPEH RR   L F
Sbjct  332  PFFDELRGSNARLPDGRPLPALFNFKQELAGASPELIGKLIPEHARRHSDLGF  384



>ref|NP_001046390.1| Os02g0236200 [Oryza sativa Japonica Group]
 dbj|BAD27595.1| putative Shaggy-related protein kinase dzeta (ASK-dzeta) [Oryza 
sativa Japonica Group]
 dbj|BAF08304.1| Os02g0236200 [Oryza sativa Japonica Group]
Length=401

 Score =   209 bits (533),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQY+P+LRCTALEACAH
Sbjct  296  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYAPNLRCTALEACAH  355

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVR  401
             FFDELREP+ARLPNGRPFPPLFNFKQELA  SPELINRLIPEH R
Sbjct  356  SFFDELREPHARLPNGRPFPPLFNFKQELANLSPELINRLIPEHAR  401



>ref|XP_009415683.1| PREDICTED: uncharacterized protein LOC103996486 [Musa acuminata 
subsp. malaccensis]
Length=1092

 Score =   219 bits (557),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/118 (84%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = -2

Query  718   REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
             REEIRCMNP+YT+FRFPQIKAHPWHK+FHKRMPPEAIDL SRLLQYSP  RC+ALEACAH
Sbjct  974   REEIRCMNPSYTEFRFPQIKAHPWHKIFHKRMPPEAIDLTSRLLQYSPCFRCSALEACAH  1033

Query  538   PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
             PFFDELREPN RLPNGRP PPLFNFKQELAGASPEL+ +LIPEHVR++  L+F HP G
Sbjct  1034  PFFDELREPNVRLPNGRPLPPLFNFKQELAGASPELVTKLIPEHVRQRSVLSFLHPVG  1091



>gb|EAZ22360.1| hypothetical protein OsJ_06019 [Oryza sativa Japonica Group]
Length=401

 Score =   208 bits (530),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 102/106 (96%), Gaps = 0/106 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHK+FHKRMPPEAIDLASRLLQY+P+LRCTALEACAH
Sbjct  296  REEIRCMNPNYTEFRFPQIKAHPWHKIFHKRMPPEAIDLASRLLQYAPNLRCTALEACAH  355

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVR  401
             FFDELREP+ARLPNGRPFPPLFNFKQELA  SPELINRLIPEH R
Sbjct  356  SFFDELREPHARLPNGRPFPPLFNFKQELANLSPELINRLIPEHAR  401



>gb|KHN36706.1| Shaggy-related protein kinase zeta [Glycine soja]
Length=349

 Score =   205 bits (521),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFP IKAHPWHKVFHKRMPPEAIDLASRLLQYSP LR +A+EA AH
Sbjct  227  REEIRCMNPNYTDFRFPHIKAHPWHKVFHKRMPPEAIDLASRLLQYSPKLRYSAVEAMAH  286

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGR  PPLFNFK+EL GA PEL+ +LIPEHVRRQ GL F
Sbjct  287  PFFEELREPNARLPNGRSLPPLFNFKKELDGAPPELLPKLIPEHVRRQTGLGF  339



>ref|XP_007149727.1| hypothetical protein PHAVU_005G094100g [Phaseolus vulgaris]
 gb|ESW21721.1| hypothetical protein PHAVU_005G094100g [Phaseolus vulgaris]
Length=425

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFP IKAHPWHKVFHKRMPPEAIDLASRLLQYSP LR +A+EA AH
Sbjct  305  REEIRCMNPNYTDFRFPHIKAHPWHKVFHKRMPPEAIDLASRLLQYSPKLRYSAVEALAH  364

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFP  377
            PFFDELREPNARLPNGR  PPLFNFKQEL GA PEL+ +LIPEHVRRQ+G   P
Sbjct  365  PFFDELREPNARLPNGRLLPPLFNFKQELDGAPPELLPKLIPEHVRRQIGFGLP  418



>ref|XP_006594816.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Glycine max]
Length=378

 Score =   204 bits (520),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFP IKAHPWHKVFHKRMPPEAIDLASRLLQYSP LR +A+EA AH
Sbjct  256  REEIRCMNPNYTDFRFPHIKAHPWHKVFHKRMPPEAIDLASRLLQYSPKLRYSAVEAMAH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGR  PPLFNFK+EL GA PEL+ +LIPEHVRRQ GL F
Sbjct  316  PFFEELREPNARLPNGRSLPPLFNFKKELDGAPPELLPKLIPEHVRRQTGLGF  368



>ref|XP_006594815.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X1 
[Glycine max]
Length=417

 Score =   205 bits (522),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFP IKAHPWHKVFHKRMPPEAIDLASRLLQYSP LR +A+EA AH
Sbjct  295  REEIRCMNPNYTDFRFPHIKAHPWHKVFHKRMPPEAIDLASRLLQYSPKLRYSAVEAMAH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNF  380
            PFF+ELREPNARLPNGR  PPLFNFK+EL GA PEL+ +LIPEHVRRQ GL F
Sbjct  355  PFFEELREPNARLPNGRSLPPLFNFKKELDGAPPELLPKLIPEHVRRQTGLGF  407



>gb|KDO66104.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
 gb|KDO66105.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
 gb|KDO66106.1| hypothetical protein CISIN_1g0141742mg, partial [Citrus sinensis]
Length=185

 Score =   198 bits (504),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 103/109 (94%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  71   REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  130

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFDELR+PNARLPNGRPFPPLFNFK QEL GAS EL+++LIPEH R+Q
Sbjct  131  PFFDELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQ  179



>ref|XP_003540409.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=409

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/108 (89%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFP IKAHPWHKVFHKRMPPEAIDLASRLLQYSP LR +A+EA AH
Sbjct  299  REEIRCMNPNYTDFRFPHIKAHPWHKVFHKRMPPEAIDLASRLLQYSPKLRYSAVEAMAH  358

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQ  395
            PFFDELREPNARLPNGRP PPLFNFKQEL GA PEL+ +LIPEHVRRQ
Sbjct  359  PFFDELREPNARLPNGRPLPPLFNFKQELDGAPPELLPKLIPEHVRRQ  406



>ref|XP_004965568.1| PREDICTED: shaggy-related protein kinase zeta-like [Setaria italica]
Length=402

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKA PWHK+FHKRMPPEAIDL SRLLQYSP+LRC+ALEACAH
Sbjct  284  REEIRCMNPNYTEFKFPQIKACPWHKIFHKRMPPEAIDLVSRLLQYSPNLRCSALEACAH  343

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
              FDELREP+ARLPNGRPFPPLFNFKQELA A PELI++L+PEH RR  G N     GP
Sbjct  344  SLFDELREPHARLPNGRPFPPLFNFKQELANAPPELISKLLPEHARRHSGFNSLFGSGP  402



>ref|XP_009380485.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+FRFPQIKAHPWHKVF+KRMP EA+DLASRLLQYSP+LRC+ALEACAH
Sbjct  287  REEIRCMNPNYTEFRFPQIKAHPWHKVFNKRMPLEAVDLASRLLQYSPNLRCSALEACAH  346

Query  538  PFFDELREPNARLPNGRPFPPLFNF-KQELAGASPELINRLIPEHVRRQMGLNFPHPGG  365
            P FDELRE NARLPNGRPFP LF+F KQEL GASP LI++L+PEH RRQ GL+F    G
Sbjct  347  PLFDELREHNARLPNGRPFPLLFDFNKQELLGASPALIDKLVPEHARRQCGLDFVQVAG  405



>ref|XP_006470301.1| PREDICTED: shaggy-related protein kinase epsilon-like [Citrus 
sinensis]
Length=429

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 103/109 (94%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  315  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  374

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFDELR+PNARLPNGRPFPPLFNFK QEL GAS EL+++LIPEH R+Q
Sbjct  375  PFFDELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQ  423



>ref|NP_001131188.1| putative glycogen synthase kinase family protein [Zea mays]
 gb|ACF79495.1| unknown [Zea mays]
 gb|ACN27945.1| unknown [Zea mays]
 gb|AFW76551.1| putative glycogen synthase kinase family protein [Zea mays]
Length=403

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/119 (79%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKA PWHK+FHKRMPPEAIDL SRLLQYSP+LRC+ALEACAH
Sbjct  285  REEIRCMNPNYTEFKFPQIKACPWHKIFHKRMPPEAIDLVSRLLQYSPNLRCSALEACAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
             FFDELRE +ARLPNGRPFPPLFNFKQELA A PEL++RL+PEH RR  G       GP
Sbjct  345  SFFDELRESHARLPNGRPFPPLFNFKQELANAPPELVSRLLPEHARRHSGFGSLFGSGP  403



>ref|XP_010278583.1| PREDICTED: shaggy-related protein kinase epsilon-like [Nelumbo 
nucifera]
Length=469

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 1/108 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHKVFHKRMPPEA+DL SRLLQYSP+LRCTALEACAH
Sbjct  362  REEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCTALEACAH  421

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRR  398
            PFFDELR+PN RLPNGRP PPLF+F  QELAGASPEL  RLIPEHV++
Sbjct  422  PFFDELRDPNTRLPNGRPLPPLFDFTPQELAGASPELHQRLIPEHVKK  469



>ref|XP_002987888.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
 ref|XP_002994033.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ04915.1| hypothetical protein SELMODRAFT_163279 [Selaginella moellendorffii]
 gb|EFJ10962.1| GSK3/shaggy-like protein kinase [Selaginella moellendorffii]
Length=423

 Score =   202 bits (513),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/110 (82%), Positives = 103/110 (94%), Gaps = 1/110 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHKVFHKRMPPEA+DL SRLLQYSP+LRC++LEA AH
Sbjct  309  REEIKCMNPNYTEFKFPQIKAHPWHKVFHKRMPPEAVDLVSRLLQYSPNLRCSSLEALAH  368

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQ-ELAGASPELINRLIPEHVRRQM  392
            PFFDELR+PN RLPNGRP PPL+NFKQ EL GASPEL+NRL+PEH R+Q+
Sbjct  369  PFFDELRDPNTRLPNGRPLPPLYNFKQLELKGASPELLNRLVPEHARKQV  418



>ref|XP_007215466.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
 gb|EMJ16665.1| hypothetical protein PRUPE_ppa006497mg [Prunus persica]
Length=409

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 102/109 (94%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSPSLRCTALEAC H
Sbjct  295  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFD+LR+PNARLPNGRP PPLFNFK QEL GA+ EL++RLIPEH R+Q
Sbjct  355  PFFDQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQ  403



>ref|XP_008230580.1| PREDICTED: shaggy-related protein kinase epsilon [Prunus mume]
Length=409

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 102/109 (94%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSPSLRCTALEAC H
Sbjct  295  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPSLRCTALEACVH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFD+LR+PNARLPNGRP PPLFNFK QEL GA+ EL++RLIPEH R+Q
Sbjct  355  PFFDQLRDPNARLPNGRPLPPLFNFKPQELKGATFELLSRLIPEHARKQ  403



>ref|NP_001167685.1| shaggy-related protein kinase eta [Zea mays]
 gb|ACG36730.1| shaggy-related protein kinase eta [Zea mays]
Length=403

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKA PWHK+FHKRMPPEAIDL SRLLQYSP+LRC+ALE CAH
Sbjct  285  REEIRCMNPNYTEFKFPQIKACPWHKIFHKRMPPEAIDLVSRLLQYSPNLRCSALEVCAH  344

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGLNFPHPGGP  362
             FFDELRE +ARLPNGRPFPPLFNFKQELA A PEL++RL+PEH RR  G       GP
Sbjct  345  SFFDELRESHARLPNGRPFPPLFNFKQELANAPPELVSRLLPEHARRHSGFGSLFGSGP  403



>emb|CAA73848.1| shaggy-like kinase etha (OSKetha) [Oryza sativa Japonica Group]
Length=403

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKA PWHK+FHKRMPPEAIDL SRLLQYSP+LRCTALEACAH
Sbjct  293  REEIRCMNPNYTEFKFPQIKACPWHKIFHKRMPPEAIDLVSRLLQYSPNLRCTALEACAH  352

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL  386
             FFDELREP+A+LPNGRPFPPLFNFKQELA   PEL++RL+PEH +R  G 
Sbjct  353  SFFDELREPHAKLPNGRPFPPLFNFKQELANTHPELVSRLLPEHAQRHSGF  403



>ref|NP_001057824.1| Os06g0547900 [Oryza sativa Japonica Group]
 dbj|BAD54124.1| shaggy-like kinase etha [Oryza sativa Japonica Group]
 dbj|BAF19738.1| Os06g0547900 [Oryza sativa Japonica Group]
 gb|EAZ37291.1| hypothetical protein OsJ_21630 [Oryza sativa Japonica Group]
 dbj|BAG94846.1| unnamed protein product [Oryza sativa Japonica Group]
Length=403

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/111 (82%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYT+F+FPQIKA PWHK+FHKRMPPEAIDL SRLLQYSP+LRCTALEACAH
Sbjct  293  REEIRCMNPNYTEFKFPQIKACPWHKIFHKRMPPEAIDLVSRLLQYSPNLRCTALEACAH  352

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL  386
             FFDELREP+A+LPNGRPFPPLFNFKQELA   PEL++RL+PEH +R  G 
Sbjct  353  SFFDELREPHAKLPNGRPFPPLFNFKQELANTHPELVSRLLPEHAQRHSGF  403



>gb|ABK24355.1| unknown [Picea sitchensis]
Length=370

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  256  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFDELR+PN RLPNGRP PPLFNFK QEL GA+P+L+ +LIPEH R+Q
Sbjct  316  PFFDELRDPNTRLPNGRPLPPLFNFKPQELKGATPDLLIKLIPEHARKQ  364



>ref|XP_007025342.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY27964.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=362

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 101/119 (85%), Gaps = 14/119 (12%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEAC+H
Sbjct  256  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACSH  315

Query  538  PFFDELREPNARLPNGRPFPPLFNFKQELAGASPELINRLIPEHVRRQMGL-NFPHPGG  365
            PFFDELREPNARLPNGRP PPLFNFKQE              +HV+RQ+GL +F HP G
Sbjct  316  PFFDELREPNARLPNGRPLPPLFNFKQE-------------SDHVKRQIGLQHFMHPAG  361



>ref|XP_006446534.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446536.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59774.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59776.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=429

 Score =   200 bits (508),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 102/109 (94%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  315  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  374

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFF ELR+PNARLPNGRPFPPLFNFK QEL GAS EL+++LIPEH R+Q
Sbjct  375  PFFYELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQ  423



>ref|XP_007031506.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
 gb|EOY02432.1| Shaggy-like kinase 13 isoform 3 [Theobroma cacao]
Length=413

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  299  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  358

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFDELR+PNARLPNGRP PPLFNFK QEL G S EL+ +LIPEH R+Q
Sbjct  359  PFFDELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQ  407



>ref|XP_008443540.1| PREDICTED: shaggy-related protein kinase epsilon [Cucumis melo]
Length=410

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 101/109 (93%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  296  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  355

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFDELR+PN RLPNGRP PPLFNFK QEL GA+ EL+++LIPEH R+Q
Sbjct  356  PFFDELRDPNTRLPNGRPLPPLFNFKPQELKGATLELLSKLIPEHARKQ  404



>ref|XP_007031504.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 ref|XP_007031505.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02430.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
 gb|EOY02431.1| Shaggy-like kinase 13 isoform 1 [Theobroma cacao]
Length=412

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 100/109 (92%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  298  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  357

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFFDELR+PNARLPNGRP PPLFNFK QEL G S EL+ +LIPEH R+Q
Sbjct  358  PFFDELRDPNARLPNGRPLPPLFNFKPQELKGVSLELLAKLIPEHARKQ  406



>ref|XP_006446533.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 ref|XP_006446535.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59773.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
 gb|ESR59775.1| hypothetical protein CICLE_v10015323mg [Citrus clementina]
Length=409

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 102/109 (94%), Gaps = 1/109 (1%)
 Frame = -2

Query  718  REEIRCMNPNYTDFRFPQIKAHPWHKVFHKRMPPEAIDLASRLLQYSPSLRCTALEACAH  539
            REEI+CMNPNYT+F+FPQIKAHPWHK+FHKRMPPEA+DL SRLLQYSP+LRCTALEAC H
Sbjct  295  REEIKCMNPNYTEFKFPQIKAHPWHKIFHKRMPPEAVDLVSRLLQYSPNLRCTALEACIH  354

Query  538  PFFDELREPNARLPNGRPFPPLFNFK-QELAGASPELINRLIPEHVRRQ  395
            PFF ELR+PNARLPNGRPFPPLFNFK QEL GAS EL+++LIPEH R+Q
Sbjct  355  PFFYELRDPNARLPNGRPFPPLFNFKPQELKGASKELLSKLIPEHARKQ  403



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410