BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038I16

Length=657
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009799848.1|  PREDICTED: 60S ribosomal protein L18a              260   1e-84   Nicotiana sylvestris
ref|XP_009609142.1|  PREDICTED: 60S ribosomal protein L18a              260   1e-84   Nicotiana tomentosiformis
ref|XP_004241806.1|  PREDICTED: 60S ribosomal protein L18a              260   2e-84   Solanum lycopersicum
gb|ADE42972.1|  putative 60S ribosomal protein L18a                     260   2e-84   Gardenia jasminoides
ref|XP_006363066.1|  PREDICTED: 60S ribosomal protein L18a-like         260   2e-84   Solanum tuberosum [potatoes]
ref|XP_009598886.1|  PREDICTED: 60S ribosomal protein L18a-like         260   2e-84   Nicotiana tomentosiformis
ref|XP_008798296.1|  PREDICTED: 60S ribosomal protein L18a              260   2e-84   Phoenix dactylifera
ref|XP_006387416.1|  hypothetical protein POPTR_1064s00200g             259   3e-84   
ref|XP_002528496.1|  60S ribosomal protein L18a, putative               259   3e-84   Ricinus communis
ref|XP_011074018.1|  PREDICTED: 60S ribosomal protein L18a-2-like       259   4e-84   Sesamum indicum [beniseed]
ref|NP_001275107.1|  60S ribosomal protein L18a-like                    259   4e-84   Solanum tuberosum [potatoes]
ref|XP_011071121.1|  PREDICTED: 60S ribosomal protein L18a              259   5e-84   Sesamum indicum [beniseed]
emb|CDP06299.1|  unnamed protein product                                259   5e-84   Coffea canephora [robusta coffee]
ref|XP_009406265.1|  PREDICTED: 60S ribosomal protein L18a              259   6e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011085620.1|  PREDICTED: 60S ribosomal protein L18a-like         259   6e-84   
ref|XP_006387417.1|  60S ribosomal protein L18a-1                       259   6e-84   
ref|XP_010324737.1|  PREDICTED: 60S ribosomal protein L18a-like         259   6e-84   Solanum lycopersicum
ref|XP_009782492.1|  PREDICTED: 60S ribosomal protein L18a-like         259   7e-84   Nicotiana sylvestris
gb|ABK92715.1|  unknown                                                 258   8e-84   Populus trichocarpa [western balsam poplar]
ref|XP_011009655.1|  PREDICTED: 60S ribosomal protein L18a-2            258   9e-84   Populus euphratica
ref|XP_008789456.1|  PREDICTED: 60S ribosomal protein L18a-2            258   1e-83   Phoenix dactylifera
ref|XP_008811096.1|  PREDICTED: 60S ribosomal protein L18a              258   1e-83   Phoenix dactylifera
ref|XP_009389413.1|  PREDICTED: 60S ribosomal protein L18a-like         258   1e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399317.1|  PREDICTED: 60S ribosomal protein L18a-like         258   1e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275234.1|  60S ribosomal protein L18a-like                    258   2e-83   Solanum tuberosum [potatoes]
ref|XP_010924380.1|  PREDICTED: 60S ribosomal protein L18a              258   2e-83   Elaeis guineensis
ref|XP_011096544.1|  PREDICTED: 60S ribosomal protein L18a-like         257   2e-83   Sesamum indicum [beniseed]
ref|XP_010918885.1|  PREDICTED: 60S ribosomal protein L18a-like         257   3e-83   
ref|XP_004147412.1|  PREDICTED: 60S ribosomal protein L18a-like         257   3e-83   
ref|XP_002317384.1|  60S ribosomal protein L18a-1                       257   3e-83   Populus trichocarpa [western balsam poplar]
ref|XP_009394206.1|  PREDICTED: 60S ribosomal protein L18a-like         257   3e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001275252.1|  uncharacterized protein LOC102577837               257   3e-83   Solanum tuberosum [potatoes]
ref|XP_008796386.1|  PREDICTED: 60S ribosomal protein L18a-like         257   4e-83   Phoenix dactylifera
gb|ABB29925.1|  unknown                                                 256   5e-83   Solanum tuberosum [potatoes]
ref|XP_007215058.1|  hypothetical protein PRUPE_ppa012231mg             256   5e-83   
ref|XP_008444078.1|  PREDICTED: 60S ribosomal protein L18a              256   5e-83   Cucumis melo [Oriental melon]
gb|KJB34967.1|  hypothetical protein B456_006G092900                    255   6e-83   Gossypium raimondii
gb|KHG16522.1|  60S ribosomal L18a                                      256   7e-83   Gossypium arboreum [tree cotton]
gb|KJB10615.1|  hypothetical protein B456_001G211400                    255   8e-83   Gossypium raimondii
gb|ADU56180.1|  hypothetical protein                                    255   1e-82   Jatropha curcas
emb|CDX98480.1|  BnaC05g38950D                                          254   1e-82   
gb|KHN38335.1|  60S ribosomal protein L18a                              256   1e-82   Glycine soja [wild soybean]
ref|XP_010052071.1|  PREDICTED: 60S ribosomal protein L18a-like i...    255   1e-82   Eucalyptus grandis [rose gum]
emb|CDX82474.1|  BnaA03g33470D                                          254   1e-82   
ref|XP_011002051.1|  PREDICTED: 60S ribosomal protein L18a-like         255   1e-82   Populus euphratica
ref|XP_006449674.1|  hypothetical protein CICLE_v10016900mg             255   1e-82   Citrus clementina [clementine]
ref|XP_010053843.1|  PREDICTED: 60S ribosomal protein L18a              255   1e-82   
gb|KCW89756.1|  hypothetical protein EUGRSUZ_A02018                     256   2e-82   Eucalyptus grandis [rose gum]
gb|KHG16962.1|  60S ribosomal L18a                                      255   2e-82   Gossypium arboreum [tree cotton]
gb|KHG02356.1|  60S ribosomal L18a                                      255   2e-82   Gossypium arboreum [tree cotton]
gb|ACS96446.1|  60S ribosomal protein L18a                              255   2e-82   Jatropha curcas
gb|KJB42782.1|  hypothetical protein B456_007G174800                    255   2e-82   Gossypium raimondii
gb|EYU33347.1|  hypothetical protein MIMGU_mgv1a014797mg                254   2e-82   Erythranthe guttata [common monkey flower]
ref|XP_007212144.1|  hypothetical protein PRUPE_ppa012251mg             255   2e-82   Prunus persica
gb|KJB10614.1|  hypothetical protein B456_001G211400                    254   3e-82   Gossypium raimondii
ref|XP_007025105.1|  Ribosomal protein L18ae/LX family protein          254   3e-82   
ref|XP_006477944.1|  PREDICTED: 60S ribosomal protein L18a-like i...    256   3e-82   Citrus sinensis [apfelsine]
emb|CDX97587.1|  BnaA05g24920D                                          254   3e-82   
ref|XP_009407842.1|  PREDICTED: 60S ribosomal protein L18a-like         254   3e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300869.1|  60S ribosomal protein L18a-1                       254   3e-82   Populus trichocarpa [western balsam poplar]
ref|XP_007048983.1|  Ribosomal protein L18ae/LX family protein          254   3e-82   Theobroma cacao [chocolate]
gb|EYU33348.1|  hypothetical protein MIMGU_mgv1a014797mg                254   4e-82   Erythranthe guttata [common monkey flower]
ref|XP_009135390.1|  PREDICTED: 60S ribosomal protein L18a-2-like       254   4e-82   Brassica rapa
emb|CDX84313.1|  BnaC04g10750D                                          253   5e-82   
ref|XP_004134633.1|  PREDICTED: 60S ribosomal protein L18a-like         254   5e-82   Cucumis sativus [cucumbers]
emb|CDX84643.1|  BnaA03g15870D                                          253   6e-82   
ref|XP_008371596.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    254   7e-82   Malus domestica [apple tree]
ref|XP_010542333.1|  PREDICTED: 60S ribosomal protein L18a isofor...    253   7e-82   Tarenaya hassleriana [spider flower]
ref|XP_009146339.1|  PREDICTED: 60S ribosomal protein L18a-2            253   8e-82   Brassica rapa
gb|KDO51884.1|  hypothetical protein CISIN_1g030276mg                   253   9e-82   Citrus sinensis [apfelsine]
gb|KHG26670.1|  60S ribosomal L18a                                      253   9e-82   Gossypium arboreum [tree cotton]
ref|NP_001237207.1|  uncharacterized protein LOC100527007               253   1e-81   
ref|XP_010263115.1|  PREDICTED: 60S ribosomal protein L18a-2            253   1e-81   Nelumbo nucifera [Indian lotus]
gb|KCW75929.1|  hypothetical protein EUGRSUZ_D00304                     256   1e-81   Eucalyptus grandis [rose gum]
ref|NP_001237792.1|  uncharacterized protein LOC100305604               252   1e-81   
gb|EYU36633.1|  hypothetical protein MIMGU_mgv1a014793mg                253   1e-81   Erythranthe guttata [common monkey flower]
emb|CDX79564.1|  BnaC03g19000D                                          253   2e-81   
ref|XP_002276260.1|  PREDICTED: 60S ribosomal protein L18a              253   2e-81   Vitis vinifera
emb|CDY43672.1|  BnaA04g20190D                                          252   2e-81   Brassica napus [oilseed rape]
ref|XP_010655647.1|  PREDICTED: 60S ribosomal protein L18a isofor...    253   2e-81   Vitis vinifera
ref|XP_008380196.1|  PREDICTED: 60S ribosomal protein L18a-2-like       252   2e-81   Malus domestica [apple tree]
ref|XP_008439644.1|  PREDICTED: 60S ribosomal protein L18a              252   2e-81   Cucumis melo [Oriental melon]
emb|CDX75778.1|  BnaC03g38610D                                          255   3e-81   
ref|XP_010538246.1|  PREDICTED: 60S ribosomal protein L18a-like         252   3e-81   Tarenaya hassleriana [spider flower]
gb|ABK94361.1|  unknown                                                 252   3e-81   Populus trichocarpa [western balsam poplar]
gb|KJB69800.1|  hypothetical protein B456_011G042900                    251   4e-81   Gossypium raimondii
ref|XP_006437137.1|  hypothetical protein CICLE_v10032878mg             251   5e-81   
ref|XP_006407062.1|  hypothetical protein EUTSA_v10021546mg             251   5e-81   Eutrema salsugineum [saltwater cress]
ref|XP_009141387.1|  PREDICTED: 60S ribosomal protein L18a-2            251   5e-81   Brassica rapa
gb|KHG29727.1|  60S ribosomal L18a                                      251   5e-81   Gossypium arboreum [tree cotton]
ref|XP_002268750.1|  PREDICTED: 60S ribosomal protein L18a              251   6e-81   Vitis vinifera
ref|XP_006407063.1|  hypothetical protein EUTSA_v10021546mg             252   6e-81   
ref|XP_006410594.1|  hypothetical protein EUTSA_v10017304mg             251   7e-81   Eutrema salsugineum [saltwater cress]
ref|XP_009132991.1|  PREDICTED: 60S ribosomal protein L18a-2-like       251   8e-81   Brassica rapa
gb|KFK36339.1|  hypothetical protein AALP_AA4G109800                    251   8e-81   Arabis alpina [alpine rockcress]
gb|AFK33651.1|  unknown                                                 251   9e-81   Lotus japonicus
ref|NP_001237679.1|  uncharacterized protein LOC100306365               251   1e-80   Glycine max [soybeans]
ref|XP_010540563.1|  PREDICTED: 60S ribosomal protein L18a              251   1e-80   Tarenaya hassleriana [spider flower]
gb|KHG27228.1|  60S ribosomal L18a                                      251   1e-80   Gossypium arboreum [tree cotton]
ref|XP_006841639.1|  hypothetical protein AMTR_s00003p00234980          251   1e-80   Amborella trichopoda
ref|XP_006442292.1|  hypothetical protein CICLE_v10022114mg             252   1e-80   Citrus clementina [clementine]
ref|XP_004486036.1|  PREDICTED: 60S ribosomal protein L18a-like         250   1e-80   Cicer arietinum [garbanzo]
ref|XP_006601742.1|  PREDICTED: uncharacterized protein LOC100306...    251   1e-80   
ref|XP_007159262.1|  hypothetical protein PHAVU_002G223200g             250   2e-80   Phaseolus vulgaris [French bean]
gb|KFK44821.1|  hypothetical protein AALP_AA1G307200                    250   2e-80   Arabis alpina [alpine rockcress]
ref|XP_006295085.1|  hypothetical protein CARUB_v10024156mg             250   2e-80   Capsella rubella
gb|AFK44558.1|  unknown                                                 250   2e-80   Lotus japonicus
ref|NP_180995.1|  60S ribosomal protein L18a-2                          250   2e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007136179.1|  hypothetical protein PHAVU_009G024800g             250   2e-80   Phaseolus vulgaris [French bean]
ref|XP_010504908.1|  PREDICTED: 60S ribosomal protein L18a-2            250   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010465351.1|  PREDICTED: 60S ribosomal protein L18a-3            249   2e-80   Camelina sativa [gold-of-pleasure]
gb|KJB57268.1|  hypothetical protein B456_009G155900                    249   3e-80   Gossypium raimondii
ref|NP_001238728.1|  uncharacterized protein LOC100306174               249   3e-80   Glycine max [soybeans]
ref|XP_007147889.1|  hypothetical protein PHAVU_006G163400g             249   3e-80   Phaseolus vulgaris [French bean]
ref|XP_010552158.1|  PREDICTED: 60S ribosomal protein L18a              249   4e-80   Tarenaya hassleriana [spider flower]
ref|XP_002519698.1|  60S ribosomal protein L18a, putative               253   4e-80   Ricinus communis
ref|XP_006467486.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    253   4e-80   Citrus sinensis [apfelsine]
gb|EYU43268.1|  hypothetical protein MIMGU_mgv1a013972mg                250   5e-80   Erythranthe guttata [common monkey flower]
gb|AFK46978.1|  unknown                                                 249   5e-80   Lotus japonicus
gb|AFK40398.1|  unknown                                                 249   5e-80   Medicago truncatula
gb|KEH33554.1|  60S ribosomal protein L18a-3                            249   5e-80   Medicago truncatula
ref|XP_006298665.1|  hypothetical protein CARUB_v10014756mg             249   6e-80   Capsella rubella
ref|XP_008225468.1|  PREDICTED: 60S ribosomal protein L18a isofor...    253   8e-80   
ref|NP_001236918.1|  uncharacterized protein LOC100500108               248   8e-80   Glycine max [soybeans]
ref|XP_004303885.2|  PREDICTED: 60S ribosomal protein L18a-2 isof...    248   8e-80   Fragaria vesca subsp. vesca
ref|XP_004303886.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    248   8e-80   Fragaria vesca subsp. vesca
ref|XP_010052072.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    253   1e-79   Eucalyptus grandis [rose gum]
sp|Q9ATF5.1|RL18A_CASSA  RecName: Full=60S ribosomal protein L18a       248   1e-79   Castanea sativa
ref|XP_004488610.1|  PREDICTED: 60S ribosomal protein L18a-like i...    248   1e-79   Cicer arietinum [garbanzo]
ref|XP_004488609.1|  PREDICTED: 60S ribosomal protein L18a-like i...    248   2e-79   
ref|XP_008371597.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    252   2e-79   Malus domestica [apple tree]
ref|XP_009360876.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    252   2e-79   Pyrus x bretschneideri [bai li]
ref|XP_006415527.1|  hypothetical protein EUTSA_v10009933mg             251   3e-79   
ref|XP_010542335.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    251   4e-79   Tarenaya hassleriana [spider flower]
ref|XP_010499515.1|  PREDICTED: 60S ribosomal protein L18a-1            246   5e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010549484.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    250   9e-79   Tarenaya hassleriana [spider flower]
ref|XP_002276545.1|  PREDICTED: 60S ribosomal protein L18a isofor...    250   1e-78   Vitis vinifera
dbj|BAH20340.1|  AT3G14600                                              244   1e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003597433.1|  60S ribosomal protein L18a                         245   1e-78   
ref|XP_010501986.1|  PREDICTED: 60S ribosomal protein L18a-3-like       245   2e-78   Camelina sativa [gold-of-pleasure]
gb|ABK26330.1|  unknown                                                 244   2e-78   Picea sitchensis
ref|NP_188078.1|  60S ribosomal protein L18a-3                          244   4e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882886.1|  60S ribosomal protein L18A                         243   9e-78   
ref|XP_010460775.1|  PREDICTED: 60S ribosomal protein L18a-1-like       243   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010679799.1|  PREDICTED: 60S ribosomal protein L18a-2            243   1e-77   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY35269.1|  BnaC03g59540D                                          243   2e-77   Brassica napus [oilseed rape]
gb|EMS54441.1|  60S ribosomal protein L18a                              242   2e-77   Triticum urartu
gb|AAM65890.1|  putative 60S ribosomal protein L18A                     242   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046    259   2e-77   Prunus mume [ume]
ref|NP_001044264.1|  Os01g0752300                                       241   5e-77   
ref|NP_849729.1|  ribosomal protein L18ae/LX family protein             241   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002449311.1|  hypothetical protein SORBIDRAFT_05g007540          241   6e-77   Sorghum bicolor [broomcorn]
ref|XP_003567891.1|  PREDICTED: 60S ribosomal protein L18a-like         241   6e-77   Brachypodium distachyon [annual false brome]
ref|XP_009109630.1|  PREDICTED: 60S ribosomal protein L18a-2            241   7e-77   Brassica rapa
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...    257   8e-77   
ref|XP_006306031.1|  hypothetical protein CARUB_v10011327mg             246   8e-77   
gb|EMT24993.1|  60S ribosomal protein L18a                              241   9e-77   
dbj|BAJ85943.1|  predicted protein                                      241   9e-77   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT07340.1|  60S ribosomal protein L18a                              241   9e-77   
ref|XP_002440257.1|  hypothetical protein SORBIDRAFT_09g028590          241   9e-77   Sorghum bicolor [broomcorn]
ref|NP_001149475.1|  LOC100283101                                       240   1e-76   Zea mays [maize]
ref|NP_001056335.1|  Os05g0565000                                       240   1e-76   
ref|XP_003569521.1|  PREDICTED: 60S ribosomal protein L18a-like         240   1e-76   Brachypodium distachyon [annual false brome]
ref|XP_010940708.1|  PREDICTED: 60S ribosomal protein L18a-2-like       240   1e-76   Elaeis guineensis
ref|XP_004166596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    256   2e-76   
ref|XP_010936051.1|  PREDICTED: 60S ribosomal protein L18a-2            239   2e-76   Elaeis guineensis
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...    256   3e-76   
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    255   4e-76   Cucumis melo [Oriental melon]
ref|XP_006644488.1|  PREDICTED: 60S ribosomal protein L18a-like         239   4e-76   Oryza brachyantha
ref|XP_004969468.1|  PREDICTED: 60S ribosomal protein L18a-like         239   5e-76   Setaria italica
ref|XP_006654794.1|  PREDICTED: 60S ribosomal protein L18a-like         239   5e-76   Oryza brachyantha
gb|ACF78859.1|  unknown                                                 238   6e-76   Zea mays [maize]
ref|NP_001043805.2|  Os01g0666900                                       238   6e-76   
gb|ACG30921.1|  60S ribosomal protein L18a                              238   7e-76   Zea mays [maize]
ref|XP_002893593.1|  60S ribosomal protein L18A-1                       243   7e-76   
ref|NP_001148024.1|  60S ribosomal protein L18a                         238   9e-76   Zea mays [maize]
ref|XP_004979031.1|  PREDICTED: 60S ribosomal protein L18a-like         238   1e-75   Setaria italica
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748    254   2e-75   
ref|NP_001152227.1|  60S ribosomal protein L18a                         237   2e-75   Zea mays [maize]
gb|ACN28455.1|  unknown                                                 237   3e-75   Zea mays [maize]
ref|XP_010666370.1|  PREDICTED: 60S ribosomal protein L18a-like         236   4e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003569823.1|  PREDICTED: 60S ribosomal protein L18a              236   4e-75   Brachypodium distachyon [annual false brome]
gb|KJB69797.1|  hypothetical protein B456_011G042800                    234   7e-75   Gossypium raimondii
ref|NP_001077626.1|  60S ribosomal protein L18a-1                       240   7e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    250   3e-74   
ref|XP_006828776.1|  hypothetical protein AMTR_s00001p00102800          232   5e-74   
ref|XP_004961208.1|  PREDICTED: 60S ribosomal protein L18a-like         239   6e-74   
ref|NP_001152434.1|  LOC100286074                                       233   1e-73   
ref|XP_001762693.1|  predicted protein                                  231   3e-73   
ref|XP_003617399.1|  60S ribosomal protein L18a                         247   4e-73   
ref|XP_001765218.1|  predicted protein                                  230   8e-73   
ref|XP_009419339.1|  PREDICTED: 60S ribosomal protein L18a-like         230   8e-73   
ref|XP_001760636.1|  predicted protein                                  230   1e-72   
gb|ACG47612.1|  60S ribosomal protein L18a                              229   2e-72   Zea mays [maize]
ref|XP_001752605.1|  predicted protein                                  229   3e-72   
ref|XP_011460183.1|  PREDICTED: 60S ribosomal protein L18a              229   4e-72   Fragaria vesca subsp. vesca
ref|XP_006387717.1|  hypothetical protein POPTR_0647s00210g             226   1e-71   
gb|AAG52055.1|AC022455_9  60S ribosomal protein L18A, putative; 2...    232   2e-71   Arabidopsis thaliana [mouse-ear cress]
pdb|3IZS|S  Chain S, Localization Of The Large Subunit Ribosomal ...    224   1e-70   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_003617398.1|  60S ribosomal protein L18a                         223   2e-70   
ref|XP_002961150.1|  hypothetical protein SELMODRAFT_227198             224   3e-70   Selaginella moellendorffii
gb|EEE55145.1|  hypothetical protein OsJ_02939                          224   4e-70   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90499.1|  ribosomal protein L18a-like                            222   2e-69   Oryza sativa Japonica Group [Japonica rice]
gb|AAT08714.1|  ribosomal protein L18A                                  215   1e-66   Hyacinthus orientalis [common hyacinth]
ref|XP_005652280.1|  60S ribosomal protein L18a-2                       211   3e-65   Coccomyxa subellipsoidea C-169
ref|XP_006384076.1|  60S ribosomal protein L18a-1                       203   7e-63   
gb|KDO49364.1|  hypothetical protein CISIN_1g028910mg                   203   9e-63   Citrus sinensis [apfelsine]
ref|XP_007146225.1|  hypothetical protein PHAVU_006G022700g             204   1e-62   Phaseolus vulgaris [French bean]
ref|XP_005848088.1|  hypothetical protein CHLNCDRAFT_30965              204   2e-62   Chlorella variabilis
gb|KIZ01204.1|  60S ribosomal protein L18a-2                            200   6e-61   Monoraphidium neglectum
ref|XP_004144680.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    209   4e-59   
gb|AFW81143.1|  hypothetical protein ZEAMMB73_376835                    192   1e-58   
ref|XP_009144150.1|  PREDICTED: 60S ribosomal protein L18a-2-like       191   2e-58   
gb|KDD75676.1|  ribosomal protein L18ae/LX                              191   2e-57   Helicosporidium sp. ATCC 50920
ref|XP_011401286.1|  60S ribosomal protein L18a-2                       188   4e-56   Auxenochlorella protothecoides
gb|ACN30573.1|  unknown                                                 185   8e-56   Zea mays [maize]
ref|XP_001689743.1|  ribosomal protein L18a, component of cytosol...    185   6e-55   Chlamydomonas reinhardtii
ref|XP_002948508.1|  ribosomal protein L18A component of cytosoli...    184   1e-54   Volvox carteri f. nagariensis
gb|KCW89757.1|  hypothetical protein EUGRSUZ_A02018                     183   3e-54   Eucalyptus grandis [rose gum]
gb|KHN49096.1|  60S ribosomal protein L18a-2                            178   3e-53   Glycine soja [wild soybean]
ref|XP_001418811.1|  Ribosomal protein L18a, component of cytosol...    174   7e-51   Ostreococcus lucimarinus CCE9901
emb|CDY71447.1|  BnaAnng37490D                                          171   9e-51   Brassica napus [oilseed rape]
ref|XP_007508296.1|  unknown                                            173   5e-50   Bathycoccus prasinos
gb|ABQ42114.1|  60S ribosomal protein L18a                              169   9e-50   Sonneratia caseolaris
gb|ABQ42113.1|  60S ribosomal protein L18a                              168   2e-49   Sonneratia alba
gb|ACS68696.1|  60S RPL18aB                                             163   1e-47   Sonneratia alba
emb|CEF98555.1|  Ribosomal protein L18ae                                166   1e-47   Ostreococcus tauri
gb|ADV03035.1|  ribosomal protein L18A                                  166   2e-47   Karlodinium veneficum
ref|XP_008880083.1|  hypothetical protein H310_14105                    164   5e-47   Aphanomyces invadans
gb|ACO51977.1|  60S ribosomal protein L18a                              160   2e-45   Rana catesbeiana [bullfrog]
ref|XP_002501229.1|  predicted protein                                  160   3e-45   Micromonas commoda
ref|XP_009831602.1|  hypothetical protein H257_07690                    159   7e-45   Aphanomyces astaci
ref|XP_008604133.1|  50S ribosomal protein L18Ae                        158   1e-44   Saprolegnia diclina VS20
ref|XP_010604767.1|  PREDICTED: 60S ribosomal protein L18a isofor...    157   1e-44   Fukomys damarensis [Damara mole rat]
ref|XP_001362363.1|  PREDICTED: 60S ribosomal protein L18a              158   2e-44   Monodelphis domestica
ref|XP_005702735.1|  60S ribosomal protein L18Ae                        158   2e-44   Galdieria sulphuraria
ref|XP_004616713.1|  PREDICTED: 60S ribosomal protein L18a              157   2e-44   Sorex araneus [Eurasian shrew]
gb|KFM72761.1|  60S ribosomal protein L18a                              157   3e-44   Stegodyphus mimosarum
ref|XP_010706034.1|  PREDICTED: 60S ribosomal protein L18a              156   3e-44   
ref|XP_006633700.1|  PREDICTED: 60S ribosomal protein L18a-like         157   4e-44   Lepisosteus oculatus
gb|AAI67657.1|  Unknown (protein for IMAGE:7718161)                     156   6e-44   Xenopus tropicalis [western clawed frog]
gb|ACO51820.1|  60S ribosomal protein L18a                              156   6e-44   Rana catesbeiana [bullfrog]
gb|AAH42256.1|  RPL18A protein                                          156   7e-44   Xenopus laevis [clawed frog]
gb|AAI61335.1|  LOC549444 protein                                       156   7e-44   Xenopus tropicalis [western clawed frog]
emb|CBN79653.1|  ribosomal protein L18                                  158   7e-44   Ectocarpus siliculosus
ref|NP_001090206.1|  ribosomal protein L18a                             156   8e-44   Xenopus laevis [clawed frog]
ref|NP_001016690.1|  ribosomal protein L18a                             156   8e-44   Xenopus tropicalis [western clawed frog]
ref|XP_003062312.1|  predicted protein                                  156   9e-44   Micromonas pusilla CCMP1545
ref|XP_005988720.1|  PREDICTED: 60S ribosomal protein L18a-like i...    154   1e-43   Latimeria chalumnae
ref|XP_005830017.1|  large subunit ribosomal protein L18Ae, cytop...    155   1e-43   Guillardia theta CCMP2712
ref|XP_006267603.1|  PREDICTED: 60S ribosomal protein L18a-like         154   2e-43   
ref|XP_007433473.1|  PREDICTED: 60S ribosomal protein L18a-like         155   2e-43   Python bivittatus
ref|XP_008822800.1|  PREDICTED: 60S ribosomal protein L18a isofor...    154   2e-43   Nannospalax galili
ref|XP_002108947.1|  expressed hypothetical protein                     155   2e-43   Trichoplax adhaerens
ref|XP_008502645.1|  PREDICTED: 60S ribosomal protein L18a              154   2e-43   Calypte anna
ref|XP_010071114.1|  PREDICTED: 60S ribosomal protein L18a              154   3e-43   Pterocles gutturalis
ref|XP_005988719.1|  PREDICTED: 60S ribosomal protein L18a-like i...    155   3e-43   Latimeria chalumnae
dbj|BAD96367.1|  ribosomal protein L18a variant                         154   3e-43   Homo sapiens [man]
dbj|BAG34717.1|  unnamed protein product                                154   4e-43   Homo sapiens [man]
ref|NP_000971.1|  60S ribosomal protein L18a                            154   4e-43   Homo sapiens [man]
ref|XP_003465225.2|  PREDICTED: 60S ribosomal protein L18a              154   4e-43   Cavia porcellus [guinea pig]
ref|XP_004643232.1|  PREDICTED: 60S ribosomal protein L18a-like         153   4e-43   
ref|XP_006876351.1|  PREDICTED: 60S ribosomal protein L18a              154   4e-43   Chrysochloris asiatica
ref|XP_005682245.1|  PREDICTED: 60S ribosomal protein L18a              154   4e-43   
ref|XP_005419299.1|  PREDICTED: 60S ribosomal protein L18a-like         153   4e-43   Geospiza fortis
gb|ELR54862.1|  60S ribosomal protein L18a                              154   4e-43   Bos mutus
ref|XP_003413070.1|  PREDICTED: 60S ribosomal protein L18a              154   4e-43   Loxodonta africana [African bush elephant]
ref|XP_002808227.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    154   4e-43   
gb|EHH59357.1|  hypothetical protein EGM_09444                          154   4e-43   Macaca fascicularis [crab eating macaque]
ref|XP_533877.1|  PREDICTED: 60S ribosomal protein L18a isoform 1       154   4e-43   Canis lupus familiaris [dogs]
ref|XP_006035334.1|  PREDICTED: 60S ribosomal protein L18a-like         154   4e-43   Alligator sinensis
ref|XP_005303239.1|  PREDICTED: 60S ribosomal protein L18a              154   4e-43   Chrysemys picta bellii
dbj|BAE40206.1|  unnamed protein product                                154   4e-43   Mus musculus [mouse]
ref|XP_005588457.1|  PREDICTED: 60S ribosomal protein L18a isofor...    154   4e-43   Macaca fascicularis [crab eating macaque]
gb|KGN65560.1|  hypothetical protein Csa_1G448420                       151   5e-43   Cucumis sativus [cucumbers]
ref|XP_008942357.1|  PREDICTED: 60S ribosomal protein L18a              153   5e-43   Merops nubicus
gb|KFV71518.1|  60S ribosomal protein L18a                              154   5e-43   Picoides pubescens
ref|XP_005370652.1|  PREDICTED: 60S ribosomal protein L18a              154   5e-43   Microtus ochrogaster [prairie voles]
ref|XP_005499868.1|  PREDICTED: 60S ribosomal protein L18a-like         154   5e-43   Columba livia [carrier pigeon]
ref|NP_997675.1|  60S ribosomal protein L18a                            154   5e-43   
gb|EMC81423.1|  60S ribosomal protein L18a                              154   5e-43   
ref|XP_005409607.1|  PREDICTED: 60S ribosomal protein L18a              154   6e-43   
ref|XP_006887480.1|  PREDICTED: 60S ribosomal protein L18a-like         154   6e-43   
ref|XP_006890332.1|  PREDICTED: 60S ribosomal protein L18a-like         154   6e-43   
gb|EDL28886.1|  mCG14783, isoform CRA_b                                 154   6e-43   
gb|KFP08674.1|  60S ribosomal protein L18a                              154   6e-43   
ref|XP_006886145.1|  PREDICTED: 60S ribosomal protein L18a-like         154   6e-43   
gb|EDL28885.1|  mCG14783, isoform CRA_a                                 154   6e-43   
ref|XP_008822798.1|  PREDICTED: 60S ribosomal protein L18a isofor...    154   6e-43   
ref|XP_001505898.2|  PREDICTED: 60S ribosomal protein L18a              153   6e-43   
gb|ELK32292.1|  60S ribosomal protein L18a                              154   6e-43   
gb|KFV06361.1|  60S ribosomal protein L18a                              154   7e-43   
ref|NP_001291810.1|  ribosomal protein L18a                             154   7e-43   
ref|XP_007116964.1|  PREDICTED: 60S ribosomal protein L18a              154   8e-43   
ref|XP_004009216.1|  PREDICTED: 60S ribosomal protein L18a              155   8e-43   
ref|XP_006894400.1|  PREDICTED: 60S ribosomal protein L18a-like         154   8e-43   
ref|XP_006898371.1|  PREDICTED: 60S ribosomal protein L18a-like         154   8e-43   
gb|EFB19107.1|  hypothetical protein PANDA_000535                       153   8e-43   
gb|ELK19170.1|  60S ribosomal protein L18a                              154   8e-43   
ref|XP_005654963.1|  PREDICTED: 60S ribosomal protein L18a isofor...    154   9e-43   
ref|XP_002187596.1|  PREDICTED: 60S ribosomal protein L18a-like i...    153   9e-43   
ref|NP_957354.1|  60S ribosomal protein L18a                            153   9e-43   
ref|XP_004423023.1|  PREDICTED: 60S ribosomal protein L18a              153   1e-42   
ref|XP_009929895.1|  PREDICTED: 60S ribosomal protein L18a              152   1e-42   
gb|KFO58423.1|  60S ribosomal protein L18a                              153   1e-42   
ref|XP_004761042.1|  PREDICTED: 60S ribosomal protein L18a isofor...    154   1e-42   
ref|XP_006882833.1|  PREDICTED: 60S ribosomal protein L18a-like         153   1e-42   
ref|XP_005148123.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    153   1e-42   
gb|KFM08760.1|  60S ribosomal protein L18a                              153   1e-42   
gb|KFP71409.1|  60S ribosomal protein L18a                              153   1e-42   
ref|XP_005972333.1|  PREDICTED: 60S ribosomal protein L18a              153   1e-42   
gb|KFV79623.1|  60S ribosomal protein L18a                              152   1e-42   
ref|XP_005480619.1|  PREDICTED: 60S ribosomal protein L18a-like         153   1e-42   
ref|XP_004873387.1|  PREDICTED: 60S ribosomal protein L18a              153   1e-42   
ref|XP_003123559.3|  PREDICTED: 60S ribosomal protein L18a isoformX1    154   2e-42   
gb|KHN11975.1|  60S ribosomal protein L18a-2                            150   2e-42   
ref|XP_416064.3|  PREDICTED: 60S ribosomal protein L18a                 154   2e-42   
ref|XP_008950341.1|  PREDICTED: 60S ribosomal protein L18a-like         152   2e-42   
ref|XP_004277609.1|  PREDICTED: 60S ribosomal protein L18a              152   2e-42   
gb|AGH70166.1|  60S ribosomal protein L18a                              152   2e-42   
gb|EDL39919.1|  mCG14017                                                152   2e-42   
ref|XP_008109288.1|  PREDICTED: 60S ribosomal protein L18a              152   2e-42   
gb|KFH68950.1|  60S ribosomal protein L20                               152   2e-42   
ref|XP_004277364.1|  PREDICTED: 60S ribosomal protein L18a-like         152   2e-42   
ref|XP_006886772.1|  PREDICTED: 60S ribosomal protein L18a-like         152   2e-42   
ref|XP_007636083.1|  PREDICTED: 60S ribosomal protein L18a isofor...    152   2e-42   
ref|XP_007611098.1|  PREDICTED: 60S ribosomal protein L18a isofor...    152   2e-42   
ref|XP_006889246.1|  PREDICTED: 60S ribosomal protein L18a-like         152   2e-42   
gb|KFR06619.1|  60S ribosomal protein L18a                              152   2e-42   
ref|XP_005604175.1|  PREDICTED: 60S ribosomal protein L18a              154   3e-42   
gb|KFB49813.1|  AGAP012284-PA-like protein                              152   3e-42   
gb|EPZ32213.1|  60S ribosomal protein L20-B                             152   3e-42   
ref|XP_003898411.1|  PREDICTED: 60S ribosomal protein L18a-like         152   3e-42   
gb|ERE89015.1|  60S ribosomal protein L18a-like protein                 152   5e-42   
ref|XP_005444139.1|  PREDICTED: 60S ribosomal protein L18a-like         153   6e-42   
ref|XP_005029512.1|  PREDICTED: 60S ribosomal protein L18a-like         150   6e-42   
gb|EAW97746.1|  hCG2015272                                              151   6e-42   
gb|ELK24855.1|  60S ribosomal protein L18a                              150   6e-42   
gb|EMS66554.1|  60S ribosomal protein L18a                              150   7e-42   
ref|XP_008508109.1|  PREDICTED: 60S ribosomal protein L18a isofor...    151   7e-42   
gb|KFH68928.1|  large subunit ribosomal protein L18Ae                   153   7e-42   
ref|NP_523774.1|  ribosomal protein L18A                                151   7e-42   
gb|AAR09828.1|  similar to Drosophila melanogaster RpL18A               151   8e-42   
ref|XP_011203338.1|  PREDICTED: 60S ribosomal protein L18a              151   8e-42   
ref|XP_004384453.1|  PREDICTED: 60S ribosomal protein L18a              151   9e-42   
ref|XP_001960744.1|  GF13512                                            150   1e-41   
gb|ADX97197.1|  60S ribosomal protein l18a                              150   1e-41   
dbj|BAC56406.1|  similar to ribosomal protein L18a                      150   1e-41   
ref|XP_004417384.1|  PREDICTED: 60S ribosomal protein L18a-like         150   1e-41   
ref|XP_011177993.1|  PREDICTED: 60S ribosomal protein L18a              150   1e-41   
ref|XP_002063423.1|  GK21403                                            150   1e-41   
ref|XP_002006863.1|  GI21298                                            150   2e-41   
ref|XP_001652208.1|  AAEL006785-PA                                      149   2e-41   
ref|XP_004520736.1|  PREDICTED: 60S ribosomal protein L18a-like         150   2e-41   
gb|EHH29801.1|  hypothetical protein EGK_10314                          149   3e-41   
ref|XP_003976423.1|  PREDICTED: 60S ribosomal protein L18a-like         149   3e-41   
ref|XP_004087014.1|  PREDICTED: 60S ribosomal protein L18a              149   3e-41   
emb|CAF89492.1|  unnamed protein product                                149   3e-41   
ref|XP_320252.4|  AGAP012284-PA                                         149   3e-41   
dbj|BAN20250.1|  hypothetical protein                                   149   3e-41   
gb|KHF99199.1|  60S ribosomal L18a                                      148   3e-41   
gb|ADV03042.1|  ribosomal protein L18A                                  149   4e-41   
gb|ACD65123.1|  putative 60S ribosomal protein RPL18A                   149   4e-41   
gb|AFM87533.1|  60S ribosomal protein L18a-like protein                 149   4e-41   
gb|AFK10877.1|  60S ribosomal protein L18a-like protein                 149   4e-41   
ref|XP_005174872.1|  PREDICTED: 60S ribosomal protein L18a              149   4e-41   
gb|AFM89633.1|  60S ribosomal protein L18a-like protein                 149   4e-41   
gb|AAP20183.1|  ribosomal protein L18a                                  149   5e-41   
ref|XP_008313517.1|  PREDICTED: 60S ribosomal protein L18a              149   5e-41   
ref|NP_001279187.1|  ribosomal protein L18a                             149   5e-41   
ref|XP_005242188.1|  PREDICTED: uncharacterized protein LOC101921474    155   5e-41   
ref|XP_005715079.1|  unnamed protein product                            149   6e-41   
ref|XP_001652207.1|  AAEL006785-PB                                      149   6e-41   
sp|Q8WQI7.1|RL18A_SPOFR  RecName: Full=60S ribosomal protein L18a       149   7e-41   
ref|XP_010896328.1|  PREDICTED: 60S ribosomal protein L18a              148   8e-41   
dbj|BAF98666.1|  ribosomal protein L18a                                 148   8e-41   
ref|NP_001284617.1|  60S ribosomal protein L18a                         148   8e-41   
ref|XP_006730525.1|  PREDICTED: 60S ribosomal protein L18a-like         148   9e-41   
ref|XP_007540776.1|  PREDICTED: 60S ribosomal protein L18a              148   1e-40   
ref|XP_005809747.1|  PREDICTED: 60S ribosomal protein L18a-like         148   1e-40   
ref|XP_007235111.1|  PREDICTED: 60S ribosomal protein L18a-like         148   1e-40   
ref|XP_001607320.1|  PREDICTED: 60S ribosomal protein L18a-like         148   1e-40   
ref|NP_001187046.1|  60S ribosomal protein L18a                         148   1e-40   
ref|XP_003448789.1|  PREDICTED: 60S ribosomal protein L18a-like         148   1e-40   
ref|XP_008213454.1|  PREDICTED: 60S ribosomal protein L18a-like i...    147   1e-40   
emb|CAX71904.1|  putative ribosomal protein L18a                        148   1e-40   
ref|XP_001360626.1|  GA19650                                            148   1e-40   
gb|AEL28892.1|  ribosomal protein L18A                                  148   1e-40   
gb|AFM90776.1|  60S ribosomal protein L18a-like protein                 148   1e-40   
ref|XP_003923253.1|  PREDICTED: 60S ribosomal protein L18a              148   1e-40   
gb|AAV90708.1|  60S ribosomal protein L18a                              147   2e-40   
ref|XP_003707868.1|  PREDICTED: 60S ribosomal protein L18a-like         147   2e-40   
ref|XP_003393070.1|  PREDICTED: 60S ribosomal protein L18a-like         147   2e-40   
gb|AFM87268.1|  60S ribosomal protein L18a-like protein                 147   2e-40   
gb|EGI58526.1|  60S ribosomal protein L18a                              147   2e-40   
ref|XP_008213453.1|  PREDICTED: 60S ribosomal protein L18a-like i...    147   2e-40   
ref|NP_001037219.1|  ribosomal protein L18A                             147   3e-40   
ref|XP_637982.2|  S60 ribosomal protein L18a                            147   3e-40   
gb|AFM87509.1|  60S ribosomal protein L18a-like protein                 147   3e-40   
ref|XP_011065620.1|  PREDICTED: 60S ribosomal protein L18a              147   3e-40   
ref|XP_009521845.1|  hypothetical protein PHYSODRAFT_354168             147   3e-40   
gb|ABM55517.1|  putative ribosomal protein L18A                         147   3e-40   
ref|XP_006899250.1|  PREDICTED: 60S ribosomal protein L18a-like         147   3e-40   
gb|AFM87145.1|  ribosomal protein L18a                                  147   3e-40   
ref|XP_011265568.1|  PREDICTED: 60S ribosomal protein L18a-like         146   4e-40   
ref|XP_393322.1|  PREDICTED: 60S ribosomal protein L18a                 146   4e-40   
gb|EFZ20272.1|  hypothetical protein SINV_15860                         146   5e-40   
gb|ADT80712.1|  ribosomal protein L18A                                  146   5e-40   
gb|AAX62413.1|  ribosomal protein L18a                                  146   5e-40   
ref|XP_001087364.1|  PREDICTED: 60S ribosomal protein L18a-like i...    146   5e-40   
ref|XP_011300735.1|  PREDICTED: 60S ribosomal protein L18a              146   5e-40   
ref|XP_011494259.1|  PREDICTED: 60S ribosomal protein L18a              146   5e-40   
dbj|BAM17719.1|  ribosomal protein L18A                                 146   5e-40   
gb|ABY28362.1|  ribosomal protein L18a                                  146   5e-40   
ref|XP_011156394.1|  PREDICTED: 60S ribosomal protein L18a              146   6e-40   
gb|AFM90945.1|  60S ribosomal protein L18a-like protein                 146   6e-40   
gb|ACI69714.1|  60S ribosomal protein L18a                              146   6e-40   
ref|XP_011142006.1|  PREDICTED: 60S ribosomal protein L18a-like         146   6e-40   
ref|XP_011349291.1|  PREDICTED: 60S ribosomal protein L18a-like         146   7e-40   
gb|AFM87186.1|  60S ribosomal protein L18a-like protein                 146   7e-40   
ref|XP_009163133.1|  hypothetical protein T265_00954                    145   7e-40   
gb|EZA47602.1|  60S ribosomal protein L18a                              145   7e-40   
ref|XP_011253777.1|  PREDICTED: 60S ribosomal protein L18a-like         146   7e-40   
emb|CDI83837.1|  60S ribosomal protein L18a, putative                   146   7e-40   
dbj|GAA49152.1|  large subunit ribosomal protein L18Ae                  145   8e-40   
gb|ABR27953.1|  60S ribosomal protein L18a                              145   8e-40   
gb|EZA55499.1|  60S ribosomal protein L18a                              145   9e-40   
gb|ABZ04232.1|  ribosomal protein rpl18a                                145   9e-40   
gb|ACH70788.1|  ribosomal protein L18a                                  145   9e-40   
emb|CDQ92557.1|  unnamed protein product                                147   1e-39   
ref|XP_005363729.1|  PREDICTED: 60S ribosomal protein L18a-like         147   1e-39   
ref|XP_002720635.1|  PREDICTED: 60S ribosomal protein L18a              146   1e-39   
ref|XP_003697931.1|  PREDICTED: 60S ribosomal protein L18a-like         146   1e-39   
gb|ACY95363.1|  ribosomal protein L18A                                  145   1e-39   
emb|CAX78475.1|  putative ribosomal protein L18a                        145   1e-39   
emb|CAX78477.1|  putative ribosomal protein L18a                        145   1e-39   
ref|XP_001985733.1|  GH20961                                            145   1e-39   
ref|XP_004395636.1|  PREDICTED: 60S ribosomal protein L18a-like         145   1e-39   
dbj|BAD26689.1|  Ribosomal protein L18A                                 145   1e-39   
gb|ABD98777.1|  putative ribosomal protein L18A                         145   2e-39   
ref|XP_002599714.1|  hypothetical protein BRAFLDRAFT_116402             145   2e-39   
ref|XP_011336934.1|  PREDICTED: 60S ribosomal protein L18a-like         145   2e-39   
emb|CAQ37750.1|  60S ribosomal protein L18a                             145   2e-39   
gb|KDR15731.1|  60S ribosomal protein L18a                              145   2e-39   
emb|CAJ17298.1|  ribosomal protein L18Ae                                145   2e-39   
gb|ABW23173.1|  ribosomal protein rpl18a                                145   2e-39   
ref|XP_008897642.1|  hypothetical protein PPTG_05682                    145   2e-39   
gb|ACD65169.1|  putative 60S ribosomal protein RPL18A                   145   2e-39   
sp|P0DJ18.1|RL18A_TETTH  RecName: Full=60S ribosomal protein L18a       145   2e-39   
gb|EAR97130.3|  60S ribosomal protein L18a                              145   2e-39   
ref|XP_008552298.1|  PREDICTED: 60S ribosomal protein L18a              144   2e-39   
gb|EAW72846.1|  hCG2040224                                              144   3e-39   
ref|XP_002427739.1|  60S ribosomal protein L18A, putative               144   3e-39   
dbj|GAM28311.1|  hypothetical protein SAMD00019534_114870               144   3e-39   
ref|XP_006680278.1|  hypothetical protein BATDEDRAFT_17251              144   3e-39   
gb|ACN10349.1|  60S ribosomal protein L18a                              145   4e-39   
ref|XP_002897608.1|  60S ribosomal protein L18a                         144   4e-39   
ref|XP_002779521.1|  60S ribosomal protein L18A-2, putative             144   5e-39   
tpe|CAL69066.1|  TPA: putative 60S ribosomal protein L18a               144   5e-39   
emb|CAJ17297.1|  ribosomal protein L18Ae                                144   5e-39   
emb|CAX78467.1|  putative ribosomal protein L18a                        144   5e-39   
dbj|BAH28893.1|  ribosomal protein L18a                                 144   5e-39   
gb|ENN82589.1|  hypothetical protein YQE_01039                          143   5e-39   
gb|AAW24880.1|  SJCHGC06172 protein                                     144   5e-39   
emb|CAJ17299.1|  ribosomal protein L18Ae                                143   5e-39   
ref|XP_796731.2|  PREDICTED: 60S ribosomal protein L18a-like            144   6e-39   
ref|XP_002783609.1|  60S ribosomal protein L18A-2, putative             144   6e-39   
gb|EHH30176.1|  60S ribosomal protein L18a                              144   6e-39   
emb|CAX78481.1|  putative ribosomal protein L18a                        144   7e-39   
gb|AAN52374.1|  ribosomal protein L18a                                  143   7e-39   
ref|XP_004035306.1|  hypothetical protein IMG5_101240                   144   8e-39   
emb|CAX78482.1|  putative ribosomal protein L18a                        143   8e-39   
ref|XP_002634177.1|  C. briggsae CBR-RPL-20 protein                     143   8e-39   
ref|XP_003071410.1|  60S ribosomal protein L20                          142   8e-39   
ref|XP_005097851.1|  PREDICTED: 60S ribosomal protein L18a-like         143   1e-38   
gb|EFN82856.1|  60S ribosomal protein L18a                              142   1e-38   
ref|XP_011142007.1|  PREDICTED: 60S ribosomal protein L18a-like         142   1e-38   
gb|ETN61400.1|  hypothetical protein AND_006941                         147   1e-38   
ref|XP_008508108.1|  PREDICTED: 60S ribosomal protein L18a isofor...    143   1e-38   
ref|XP_003292885.1|  ribosomal protein L18a                             142   1e-38   
ref|XP_003383990.1|  PREDICTED: 60S ribosomal protein L18a-like         142   2e-38   
ref|XP_001896063.1|  60S ribosomal protein L18a                         142   2e-38   
gb|AEE62272.1|  unknown                                                 142   2e-38   
gb|ABX44821.1|  putative 60S ribosomal protein RPL18A                   142   2e-38   
gb|ABR23382.1|  60S ribosomal protein L18a                              142   2e-38   
ref|XP_001245490.1|  60S ribosomal protein L20                          142   2e-38   
gb|KGB36185.1|  60S ribosomal protein L18a                              142   2e-38   
emb|CAX78486.1|  putative ribosomal protein L18a                        142   2e-38   
ref|XP_972907.1|  PREDICTED: 60S ribosomal protein L18a                 142   3e-38   
ref|NP_001119646.1|  ribosomal protein L18A                             142   3e-38   
emb|CDP99545.1|  Protein Bm13771, isoform b                             142   3e-38   
gb|EJW80288.1|  ribosomal protein L18ae                                 142   3e-38   
ref|XP_004580268.1|  PREDICTED: uncharacterized protein LOC101525579    146   3e-38   
ref|XP_004365311.1|  ribosomal protein L18ae                            141   3e-38   
sp|O44480.2|RL18A_CAEEL  RecName: Full=60S ribosomal protein L18a       142   4e-38   
ref|XP_006896508.1|  PREDICTED: 60S ribosomal protein L18a-like         141   4e-38   
emb|CBK25000.2|  Ribosomal protein L18a                                 140   5e-38   
gb|ACF33126.1|  large ribosomal subunit L18a protein                    141   5e-38   
dbj|BAJ93879.1|  predicted protein                                      141   5e-38   
ref|XP_003145959.1|  60S ribosomal protein L18a                         141   5e-38   



>ref|XP_009799848.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana sylvestris]
Length=178

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWY+ RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYYLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KA+RPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_009609142.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009627827.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009592293.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009757479.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
 ref|XP_009757480.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   260 bits (665),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWY+ RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYYLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KA+RPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_004241806.1| PREDICTED: 60S ribosomal protein L18a [Solanum lycopersicum]
Length=178

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KA++PN+F+
Sbjct  155  FKKVRPPSRKLKTTYKATKPNLFM  178



>gb|ADE42972.1| putative 60S ribosomal protein L18a [Gardenia jasminoides]
Length=178

 Score =   260 bits (665),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK AT+PAKLCKRES KQF  SKI+FPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRYHCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_006363066.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum tuberosum]
Length=178

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPPSRKLKTT KA++PN+F+
Sbjct  155  FKKIRPPSRKLKTTYKATKPNLFM  178



>ref|XP_009598886.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana tomentosiformis]
Length=178

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWY+ RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYYLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKIATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KA+RPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_008798296.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   260 bits (664),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMY EMA RHRVR HCIQIIK ATIPAKLCKRE+ KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYNEMASRHRVRSHCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_006387416.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
 gb|ERP46330.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
Length=150

 Score =   259 bits (661),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  127  FKKVRPPSRKLKTTYKASRPNLFM  150



>ref|XP_002528496.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF33913.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=178

 Score =   259 bits (663),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVK+SNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKRSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFSCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_011074018.1| PREDICTED: 60S ribosomal protein L18a-2-like [Sesamum indicum]
Length=178

 Score =   259 bits (663),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASRPNLFM  178



>ref|NP_001275107.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|AFX66998.1| 60S ribosomal protein L18a [Solanum tuberosum]
Length=178

 Score =   259 bits (662),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA++PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_011071121.1| PREDICTED: 60S ribosomal protein L18a [Sesamum indicum]
Length=178

 Score =   259 bits (662),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASRPNLFM  178



>emb|CDP06299.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   259 bits (662),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK AT+PAKLCKRES KQF  SKI+FPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRYHCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_009406265.1| PREDICTED: 60S ribosomal protein L18a [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR HCIQIIK ATIP+KLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRYHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_011085620.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=175

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  32   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  91

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  92   EYRDTTLNGAVEQMYTEMASRHRVRPHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  151

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  152  FRKVRPPTRKLKTTYKASRPNLFM  175



>ref|XP_006387417.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011009656.1| PREDICTED: 60S ribosomal protein L18a [Populus euphratica]
 gb|ABK93213.1| unknown [Populus trichocarpa]
 gb|ABK94632.1| unknown [Populus trichocarpa]
 gb|ERP46331.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_010324737.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum lycopersicum]
Length=178

 Score =   259 bits (661),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KA++PN+F+
Sbjct  155  FKKVRPPSRKLKTTYKATKPNLFM  178



>ref|XP_009782492.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWY+ RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYYLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KA+RPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKATRPNLFM  178



>gb|ABK92715.1| unknown [Populus trichocarpa]
Length=178

 Score =   258 bits (660),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_011009655.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
 ref|XP_011009657.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
Length=178

 Score =   258 bits (660),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_008789456.1| PREDICTED: 60S ribosomal protein L18a-2 [Phoenix dactylifera]
Length=178

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008811096.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMY EMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYNEMASRHRVRCHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FK VRPPSRKLKTT KASRPN+F+
Sbjct  155  FKMVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_009389413.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   258 bits (660),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  45   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  104

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR HCIQIIK ATIP+KLCKRES KQF  SKIKFPLV
Sbjct  105  EYRDTTLNGAVEQMYNEMASRHRVRHHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLV  164

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  165  FKKVRPPTRKLKTTYKASRPNLFM  188



>ref|XP_009399317.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   258 bits (659),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN G+WLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGVWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR HCIQIIK ATIP+KLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRQHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
            FKKVRPPSRKLKTT KASRPN+F
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLF  177



>ref|NP_001275234.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|ABB29928.1| unknown [Solanum tuberosum]
Length=178

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA++PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_010924380.1| PREDICTED: 60S ribosomal protein L18a [Elaeis guineensis]
Length=178

 Score =   258 bits (658),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVE MY EMA RHRVR HCIQIIK ATIPAKLCKRE+ KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEHMYNEMASRHRVRYHCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_011096544.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=178

 Score =   257 bits (657),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG+VEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGSVEQMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KA+RPN+F+
Sbjct  155  FRKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_010918885.1| PREDICTED: 60S ribosomal protein L18a-like [Elaeis guineensis]
Length=178

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDT  NGAVE MY EMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTALNGAVEHMYNEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_004147412.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004164939.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
Length=178

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTKVKN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_002317384.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ABK93710.1| unknown [Populus trichocarpa]
 gb|EEE97996.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_009394206.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR HCIQIIK ATIP+KLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRCHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>ref|NP_001275252.1| uncharacterized protein LOC102577837 [Solanum tuberosum]
 ref|XP_004233112.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 ref|XP_010316931.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 gb|ABA46783.1| unknown [Solanum tuberosum]
Length=178

 Score =   257 bits (657),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KA++PN+F+
Sbjct  155  FKKVRPPSRKLKTTYKATKPNLFM  178



>ref|XP_008796386.1| PREDICTED: 60S ribosomal protein L18a-like [Phoenix dactylifera]
Length=178

 Score =   257 bits (656),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             KKVRPP+RKLKTT KASRPN+F+
Sbjct  155  LKKVRPPTRKLKTTYKASRPNLFM  178



>gb|ABB29925.1| unknown [Solanum tuberosum]
Length=178

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT  A++PN+F+
Sbjct  155  FKKVRPPTRKLKTTYWATKPNLFM  178



>ref|XP_007215058.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
 gb|EMJ16257.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
Length=178

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA+RPNIFV
Sbjct  155  FKKVRPPTRKLKTTYKATRPNIFV  178



>ref|XP_008444078.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   256 bits (655),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTKVKN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKL+TT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLRTTYKASKPNLFM  178



>gb|KJB34967.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
 gb|KJB42783.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
 gb|KJB69798.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=150

 Score =   255 bits (652),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  127  FKKVRPPTRKLKTTYKASKPNLFM  150



>gb|KHG16522.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   256 bits (654),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASKPNLFM  178



>gb|KJB10615.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=150

 Score =   255 bits (651),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA++PN+F+
Sbjct  127  FKKVRPPTRKLKTTYKATKPNLFM  150



>gb|ADU56180.1| hypothetical protein [Jatropha curcas]
Length=154

 Score =   255 bits (651),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  11   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  70

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK  TIPAKLCKRES KQF  SKIKFPLV
Sbjct  71   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTGTIPAKLCKRESSKQFHNSKIKFPLV  130

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKL+TT KASRPN+F+
Sbjct  131  FKKVRPPTRKLRTTYKASRPNLFM  154



>emb|CDX98480.1| BnaC05g38950D [Brassica napus]
Length=150

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  67   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  127  FRKVRPPTRKLKTTYKASKPNLFM  150



>gb|KHN38335.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   256 bits (653),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010052071.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Eucalyptus 
grandis]
Length=178

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>emb|CDX82474.1| BnaA03g33470D [Brassica napus]
Length=150

 Score =   254 bits (650),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  67   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  127  FRKVRPPTRKLKTTYKASKPNLFM  150



>ref|XP_011002051.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
Length=178

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT  ASRPN+F+
Sbjct  155  FKKVRPPSRKLKTTYNASRPNLFM  178



>ref|XP_006449674.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 ref|XP_006467485.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X1 [Citrus 
sinensis]
 gb|ESR62914.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 gb|KDO78150.1| hypothetical protein CISIN_1g035537mg [Citrus sinensis]
Length=178

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKL+TT KA+RPN+F+
Sbjct  155  FRKVRPPSRKLRTTYKATRPNLFM  178



>ref|XP_010053843.1| PREDICTED: 60S ribosomal protein L18a [Eucalyptus grandis]
Length=178

 Score =   255 bits (652),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KCW89756.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=213

 Score =   256 bits (655),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  70   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  129

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  130  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  189

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  190  FKKVRPPTRKLKTTYKASRPNLFM  213



>gb|KHG16962.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB69799.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=178

 Score =   255 bits (652),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASKPNLFM  178



>gb|KHG02356.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB34966.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
Length=178

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASKPNLFM  178



>gb|ACS96446.1| 60S ribosomal protein L18a [Jatropha curcas]
 gb|KDP37961.1| hypothetical protein JCGZ_04604 [Jatropha curcas]
Length=178

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK  TIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTGTIPAKLCKRESSKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKL+TT KASRPN+F+
Sbjct  155  FKKVRPPTRKLRTTYKASRPNLFM  178



>gb|KJB42782.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
Length=178

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASKPNLFM  178



>gb|EYU33347.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=150

 Score =   254 bits (648),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGAVEHMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F KVRPP+RKLKTT KA++PN+F+
Sbjct  127  FHKVRPPTRKLKTTYKATKPNLFM  150



>ref|XP_007212144.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
 ref|XP_008225467.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Prunus mume]
 gb|EMJ13343.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
Length=178

 Score =   255 bits (651),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KASRPN+FV
Sbjct  155  FRKVRPPSRKLKTTYKASRPNLFV  178



>gb|KJB10614.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=178

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA++PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_007025105.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOY27727.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_006477944.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Citrus 
sinensis]
 gb|KDO49363.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=202

 Score =   256 bits (653),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  59   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  118

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQII+ ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  119  EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLV  178

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  179  FKKVRPPTRKLKTTYKASRPNLFM  202



>emb|CDX97587.1| BnaA05g24920D [Brassica napus]
Length=178

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009407842.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG+VEQMY EMA RHRVR HCIQIIK ATIP+KLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGSVEQMYNEMASRHRVRCHCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
            FKKVRPP+RKLKTT KASRPN+F
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLF  177



>ref|XP_002300869.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011026230.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
 gb|ABK92614.1| unknown [Populus trichocarpa]
 gb|EEE80142.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVR+KSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRSKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_007048983.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOX93140.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   254 bits (650),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>gb|EYU33348.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=178

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEHMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F KVRPP+RKLKTT KA++PN+F+
Sbjct  155  FHKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_009135390.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   254 bits (649),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>emb|CDX84313.1| BnaC04g10750D [Brassica napus]
Length=150

 Score =   253 bits (646),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  67   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  127  FRKVRPPTRKLKTTYKASKPNLFM  150



>ref|XP_004134633.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004162601.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 gb|KGN49388.1| hypothetical protein Csa_6G522810 [Cucumis sativus]
Length=178

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEAMYTEMASRHRVRHPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FK VRPP+RKLKTT KASRPN+F+
Sbjct  155  FKTVRPPTRKLKTTYKASRPNLFM  178



>emb|CDX84643.1| BnaA03g15870D [Brassica napus]
Length=150

 Score =   253 bits (645),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  127  FRKVRPPSRKLKTTYKASKPNLFM  150



>ref|XP_008371596.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Malus domestica]
 ref|XP_008383489.1| PREDICTED: 60S ribosomal protein L18a-2 [Malus domestica]
 ref|XP_009360875.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Pyrus x bretschneideri]
Length=178

 Score =   254 bits (648),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KASRPN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_010542333.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Tarenaya hassleriana]
Length=178

 Score =   253 bits (647),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009146339.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   253 bits (647),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NG+VEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGSVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>gb|KDO51884.1| hypothetical protein CISIN_1g030276mg [Citrus sinensis]
Length=180

 Score =   253 bits (647),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWY+ RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  37   NEVRAKSKFWYYLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  96

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  97   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  156

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKL+TT KASRPN+F+
Sbjct  157  FRKVRPPTRKLRTTYKASRPNLFM  180



>gb|KHG26670.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   253 bits (647),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYAEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASKPNLFM  178



>ref|NP_001237207.1| uncharacterized protein LOC100527007 [Glycine max]
 gb|ACU16044.1| unknown [Glycine max]
Length=178

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTKIKNCGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKI+FPLV
Sbjct  95   EYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIEFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010263115.1| PREDICTED: 60S ribosomal protein L18a-2 [Nelumbo nucifera]
Length=178

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  +KIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRYPCIQIIKTATIPASLCKRESTKQFHNAKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KCW75929.1| hypothetical protein EUGRSUZ_D00304 [Eucalyptus grandis]
Length=255

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  112  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  171

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  172  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  231

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  232  FKKVRPPTRKLKTTYKASRPNLFM  255



>ref|NP_001237792.1| uncharacterized protein LOC100305604 [Glycine max]
 gb|ACU13370.1| unknown [Glycine max]
Length=150

 Score =   252 bits (643),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK AT PAKLCKRES KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATTPAKLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPP+RKLKTT K SRPN+F+
Sbjct  127  FKKIRPPTRKLKTTYKTSRPNLFM  150



>gb|EYU36633.1| hypothetical protein MIMGU_mgv1a014793mg [Erythranthe guttata]
Length=178

 Score =   253 bits (646),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEHMYTEMASRHRVRSHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +KVRPP+RKLKTT KA++PN+F+
Sbjct  155  TRKVRPPTRKLKTTYKATKPNLFM  178



>emb|CDX79564.1| BnaC03g19000D [Brassica napus]
Length=178

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTNIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_002276260.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CAN71860.1| hypothetical protein VITISV_019859 [Vitis vinifera]
 emb|CBI30856.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPL 
Sbjct  95   EYRDTTLNGAVEQMYAEMASRHRVRSPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLT  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASRPNLFM  178



>emb|CDY43672.1| BnaA04g20190D [Brassica napus]
 emb|CDY17253.1| BnaA05g09350D [Brassica napus]
Length=150

 Score =   252 bits (643),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  127  FRKVRPPTRKLKTTYKASKPNLFM  150



>ref|XP_010655647.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Vitis vinifera]
 emb|CAN82658.1| hypothetical protein VITISV_011977 [Vitis vinifera]
Length=178

 Score =   253 bits (645),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPL 
Sbjct  95   EYRDTTLNGAVEQMYAEMASRHRVRSPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLT  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008380196.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_008342343.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_009377204.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
 ref|XP_009356606.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
Length=178

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKYPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTE+A RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEAMYTELASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KASRPN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_008439644.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   252 bits (644),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEAMYTEMASRHRVRHPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FK VRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKTVRPPTRKLKTTYKASKPNLFM  178



>emb|CDX75778.1| BnaC03g38610D [Brassica napus]
Length=258

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  115  NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYK  174

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  175  EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAGLCKRESTKQFHNSKIKFPLV  234

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  235  FRKVRPPTRKLKTTYKASKPNLFM  258



>ref|XP_010538246.1| PREDICTED: 60S ribosomal protein L18a-like [Tarenaya hassleriana]
Length=178

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDITLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>gb|ABK94361.1| unknown [Populus trichocarpa]
Length=178

 Score =   252 bits (643),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVR+KSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRSKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKR S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRGSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KJB69800.1| hypothetical protein B456_011G042900 [Gossypium raimondii]
Length=178

 Score =   251 bits (642),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKS GQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSIGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006437137.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
 gb|ESR50377.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
Length=180

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWY+ RKLKKVKKSNGQVL INEIFEK P K+KN GIWLRYQSRTGYHNMYK
Sbjct  37   NEVRAKSKFWYYLRKLKKVKKSNGQVLAINEIFEKNPAKIKNYGIWLRYQSRTGYHNMYK  96

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  97   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  156

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKL+TT KASRPN+F+
Sbjct  157  FRKVRPPTRKLRTTYKASRPNLFM  180



>ref|XP_006407062.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48515.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=178

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRA SKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAMSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009141387.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
 ref|XP_009143771.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>gb|KHG29727.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR++ KQF  SKIKFPL+
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDNTKQFHNSKIKFPLM  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             KKVRPP+RKLKTT KASRPN+F+
Sbjct  155  VKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_002268750.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CBI22128.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   251 bits (641),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG+VEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQ   SKIKFPLV
Sbjct  95   EYRDTTLNGSVEQMYTEMASRHRVRYPCIQIIKTATIPAKLCKRESTKQMHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +KVRPP+RKLKTT KASRPN+F+
Sbjct  155  VRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_006407063.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48516.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=203

 Score =   252 bits (644),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRA SKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  60   NEVRAMSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  119

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  120  EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  179

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  180  FRKVRPPTRKLKTTYKASKPNLFM  203



>ref|XP_006410594.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
 gb|ESQ52047.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
Length=178

 Score =   251 bits (641),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_009132991.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   251 bits (641),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   ESRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASKPNLFM  178



>gb|KFK36339.1| hypothetical protein AALP_AA4G109800 [Arabis alpina]
Length=178

 Score =   251 bits (640),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASKPNLFM  178



>gb|AFK33651.1| unknown [Lotus japonicus]
Length=178

 Score =   251 bits (640),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEHMYNEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KK+RPP+RKLKTT KASRPN+F+
Sbjct  155  YKKIRPPTRKLKTTYKASRPNLFM  178



>ref|NP_001237679.1| uncharacterized protein LOC100306365 [Glycine max]
 gb|ACU14501.1| unknown [Glycine max]
 gb|KHN35898.1| 60S ribosomal protein L18a-2 [Glycine soja]
Length=178

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEHMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA++PN+F+
Sbjct  155  FKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_010540563.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRD T NGAVEQMY EMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDITLNGAVEQMYNEMASRHRVRFPCIQIIKTATVPAKLCKRESSKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>gb|KHG27228.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             KKVRPP+RKLKTT KA++PN+F+
Sbjct  155  SKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_006841639.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
 gb|ERN03314.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
Length=178

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRE+ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRYPCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+K RPP+RKLKTT KASRPN+F+
Sbjct  155  FRKFRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006442292.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
 gb|ESR55532.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
Length=224

 Score =   252 bits (644),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L I+EIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  81   NEVRAKSKFWYFLRKLKKVKKSNGQMLAIDEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  140

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMYTEMA RHRVR  CIQII+ ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  141  EYRDITLNGAVEQMYTEMASRHRVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLV  200

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  201  FKKVRPPTRKLKTTYKASRPNLFM  224



>ref|XP_004486036.1| PREDICTED: 60S ribosomal protein L18a-like [Cicer arietinum]
Length=178

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAV+ MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVDLMYNEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPPSRKLKTT KA +PN+F+
Sbjct  155  FKKIRPPSRKLKTTYKAKKPNLFM  178



>ref|XP_006601742.1| PREDICTED: uncharacterized protein LOC100306365 isoform X1 [Glycine 
max]
Length=184

 Score =   251 bits (640),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  41   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  100

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  101  EYRDTTLNGAVEHMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  160

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA++PN+F+
Sbjct  161  FKKVRPPTRKLKTTYKATKPNLFM  184



>ref|XP_007159262.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
 gb|ESW31256.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
Length=178

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVE MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEHMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPPSRKLKTT KA +PN+F+
Sbjct  155  FKKIRPPSRKLKTTYKAKKPNLFM  178



>gb|KFK44821.1| hypothetical protein AALP_AA1G307200 [Arabis alpina]
Length=178

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006295085.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
 gb|EOA27983.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
Length=178

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEI+EK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KA++PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKANKPNLFM  178



>gb|AFK44558.1| unknown [Lotus japonicus]
Length=178

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAV+ MYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVDAMYTEMASRHRVRSPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPPSRKLKTT KA +PN+F+
Sbjct  155  YRKVRPPSRKLKTTYKAKKPNLFM  178



>ref|NP_180995.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 ref|XP_002881337.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 sp|P51418.2|R18A2_ARATH RecName: Full=60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 gb|AAC26708.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAK68743.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM14956.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAM53336.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAN15395.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAP21367.1| At2g34480 [Arabidopsis thaliana]
 gb|EFH57596.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|AEC08980.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
Length=178

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEI+EK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KA++PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_007136179.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
 gb|ESW08173.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
Length=178

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK++N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIQNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVE MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEHMYNEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPPSRKLKTT KA +PN+F+
Sbjct  155  FKKIRPPSRKLKTTYKAKKPNLFM  178



>ref|XP_010504908.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010509745.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010516589.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Camelina 
sativa]
 ref|XP_010516590.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Camelina 
sativa]
Length=178

 Score =   250 bits (638),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEI+EK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KA++PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_010465351.1| PREDICTED: 60S ribosomal protein L18a-3 [Camelina sativa]
Length=178

 Score =   249 bits (637),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KASRPN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASRPNLFM  178



>gb|KJB57268.1| hypothetical protein B456_009G155900 [Gossypium raimondii]
Length=178

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIP KLCKR++ KQF  SKIKFPL+
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPTKLCKRDNTKQFHNSKIKFPLM  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             KKVRPP+RKLKTT KASRPN+F+
Sbjct  155  VKKVRPPTRKLKTTYKASRPNLFM  178



>ref|NP_001238728.1| uncharacterized protein LOC100306174 [Glycine max]
 gb|ACU14228.1| unknown [Glycine max]
 gb|KHN33136.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEAMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KKVRPP+RKLKTT KA +PN+F+
Sbjct  155  YKKVRPPTRKLKTTYKAKKPNLFM  178



>ref|XP_007147889.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
 gb|ESW19883.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
Length=178

 Score =   249 bits (637),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVE MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEHMYNEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPPSRKLKTT KA +PN+F+
Sbjct  155  FKKIRPPSRKLKTTYKAKKPNLFM  178



>ref|XP_010552158.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   249 bits (636),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK++N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIRNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG+VEQMYTEMA RHRVR  C+QIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGSVEQMYTEMASRHRVRFPCVQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASKPNLFM  178



>ref|XP_002519698.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF42671.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=303

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NE RAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  160  NEFRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  219

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  220  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  279

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  280  FKKVRPPTRKLKTTYKASRPNLFM  303



>ref|XP_006467486.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Citrus 
sinensis]
Length=307

 Score =   253 bits (647),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  164  NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  223

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  224  EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  283

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKL+TT KA+RPN+F+
Sbjct  284  FRKVRPPSRKLRTTYKATRPNLFM  307



>gb|EYU43268.1| hypothetical protein MIMGU_mgv1a013972mg [Erythranthe guttata]
Length=204

 Score =   250 bits (638),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN G+WLRYQSRTGYHNMYK
Sbjct  61   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGVWLRYQSRTGYHNMYK  120

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  121  EYRDTTLNGGVEQMYTEMASRHRVRPHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  180

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRP SRKLKTT KA++PN+F+
Sbjct  181  YRKVRPHSRKLKTTYKATKPNLFM  204



>gb|AFK46978.1| unknown [Lotus japonicus]
Length=178

 Score =   249 bits (635),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK AT+ AKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEHMYNEMASRHRVRSPCIQIIKTATVEAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KK+RPP+RKLKTT KASRPN+F+
Sbjct  155  YKKIRPPTRKLKTTYKASRPNLFM  178



>gb|AFK40398.1| unknown [Medicago truncatula]
 gb|KEH33553.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   249 bits (635),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEYMYNEMASRHRVRHPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPP+RKLKTT KA++PN+F+
Sbjct  155  FKKIRPPTRKLKTTYKATKPNMFM  178



>gb|KEH33554.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=176

 Score =   249 bits (635),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  33   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  92

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV
Sbjct  93   EYRDTTLNGAVEYMYNEMASRHRVRHPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLV  152

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPP+RKLKTT KA++PN+F+
Sbjct  153  FKKIRPPTRKLKTTYKATKPNMFM  176



>ref|XP_006298665.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
 gb|EOA31563.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
Length=178

 Score =   249 bits (635),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_008225468.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Prunus mume]
Length=320

 Score =   253 bits (647),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  177  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  236

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  237  EYRDTTLNGAVEQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  296

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KASRPN+FV
Sbjct  297  FRKVRPPSRKLKTTYKASRPNLFV  320



>ref|NP_001236918.1| uncharacterized protein LOC100500108 [Glycine max]
 gb|ACU14971.1| unknown [Glycine max]
 gb|KHN47310.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   248 bits (634),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG+VE MY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGSVEAMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KA +PN+F+
Sbjct  155  FQKVRPPTRKLKTTYKAKKPNLFM  178



>ref|XP_004303885.2| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   248 bits (634),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT + N GIWLRYQSRTGYHNMYK
Sbjct  38   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYK  97

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+R+TT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  98   EYRNTTLNGAVEDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  157

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPPSRKLKTT KASRPNIF+
Sbjct  158  LRKIRPPSRKLKTTYKASRPNIFM  181



>ref|XP_004303886.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   248 bits (634),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT + N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+R+TT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRNTTLNGAVEDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPPSRKLKTT KASRPNIF+
Sbjct  155  LRKIRPPSRKLKTTYKASRPNIFM  178



>ref|XP_010052072.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Eucalyptus 
grandis]
Length=317

 Score =   253 bits (646),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  174  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  233

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  234  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  293

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  294  FKKVRPPTRKLKTTYKASRPNLFM  317



>sp|Q9ATF5.1|RL18A_CASSA RecName: Full=60S ribosomal protein L18a [Castanea sativa]
 gb|AAK25759.1|AF334839_1 ribosomal protein L18a [Castanea sativa]
Length=178

 Score =   248 bits (633),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPPSRKLKT  KASRPN+F+
Sbjct  155  TRKIRPPSRKLKTHYKASRPNLFM  178



>ref|XP_004488610.1| PREDICTED: 60S ribosomal protein L18a-like isoform X2 [Cicer 
arietinum]
Length=178

 Score =   248 bits (632),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KK+RPP+RKLKTT KA++PN+F+
Sbjct  155  YKKIRPPTRKLKTTYKATKPNLFM  178



>ref|XP_004488609.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Cicer 
arietinum]
Length=182

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  39   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  98

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV
Sbjct  99   EYRDTTLNGAVETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLV  158

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KK+RPP+RKLKTT KA++PN+F+
Sbjct  159  YKKIRPPTRKLKTTYKATKPNLFM  182



>ref|XP_008371597.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Malus domestica]
Length=315

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  172  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  231

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  232  EYRDTTLNGAVEQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  291

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KASRPN+F+
Sbjct  292  FRKVRPPSRKLKTTYKASRPNLFM  315



>ref|XP_009360876.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Pyrus x bretschneideri]
Length=321

 Score =   252 bits (644),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  178  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  237

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  238  EYRDTTLNGAVEQMYIEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  297

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KASRPN+F+
Sbjct  298  FRKVRPPSRKLKTTYKASRPNLFM  321



>ref|XP_006415527.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
 gb|ESQ33880.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
Length=317

 Score =   251 bits (642),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  174  NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYK  233

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  234  EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLV  293

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  294  FRKVRPPTRKLKTTYKASKPNLFM  317



>ref|XP_010542335.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X3 [Tarenaya 
hassleriana]
Length=316

 Score =   251 bits (642),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  173  NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  232

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  233  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  292

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  293  FRKVRPPTRKLKTTYKASKPNLFM  316



>ref|XP_010499515.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
 ref|XP_010478371.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
Length=178

 Score =   246 bits (629),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF R+ KKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVLAKSKFWYFLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPANLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010549484.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score =   250 bits (639),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  169  NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  228

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  229  EYRDITLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  288

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  289  FRKVRPPTRKLKTTYKASKPNLFM  312



>ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Vitis vinifera]
Length=299

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  156  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  215

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPL 
Sbjct  216  EYRDTTLNGAVEQMYAEMASRHRVRSPCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLT  275

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  276  FRKVRPPTRKLKTTYKASRPNLFM  299



>dbj|BAH20340.1| AT3G14600 [Arabidopsis thaliana]
Length=150

 Score =   244 bits (623),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  7    NEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRE  KQF  SKIKFPLV
Sbjct  67   EYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLV  126

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  127  FRKVRPPSRKLKTTYKASKPNLFM  150



>ref|XP_003597433.1| 60S ribosomal protein L18a [Medicago truncatula]
 ref|XP_003617397.1| 60S ribosomal protein L18a [Medicago truncatula]
 gb|ACJ84852.1| unknown [Medicago truncatula]
 gb|AES67684.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AET00356.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AFK39885.1| unknown [Medicago truncatula]
 gb|AFK41441.1| unknown [Medicago truncatula]
 gb|AFK43765.1| unknown [Medicago truncatula]
 gb|AFK46613.1| unknown [Medicago truncatula]
 gb|KEH28400.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   245 bits (626),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KK+RPP+R LKTT KA +PN+F+
Sbjct  155  YKKIRPPTRSLKTTYKAKKPNLFM  178



>ref|XP_010501986.1| PREDICTED: 60S ribosomal protein L18a-3-like [Camelina sativa]
Length=178

 Score =   245 bits (625),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV A SKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVCAMSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  S+IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSEIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSR LKTT KASRPN+F+
Sbjct  155  FRKVRPPSRMLKTTYKASRPNLFM  178



>gb|ABK26330.1| unknown [Picea sitchensis]
 gb|ABR16921.1| unknown [Picea sitchensis]
 gb|ABR17139.1| unknown [Picea sitchensis]
Length=178

 Score =   244 bits (624),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAV+QMY EMA RHRVR  CIQIIK ATIP +LCKRE+ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVQQMYDEMASRHRVRYPCIQIIKTATIPNELCKRENTKQFQDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_188078.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 sp|Q9LUD4.1|R18A3_ARATH RecName: Full=60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 dbj|BAB02392.1| 60S ribosomal protein L18A-like [Arabidopsis thaliana]
 gb|AAL60048.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AAM19893.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AEE75546.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
Length=178

 Score =   244 bits (623),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRE  KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_002882886.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59145.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   243 bits (620),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRE  KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_010460775.1| PREDICTED: 60S ribosomal protein L18a-1-like [Camelina sativa]
Length=178

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF R+ KKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVLAKSKFWYFLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+ A LCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVQANLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KASRPN+F+
Sbjct  155  FRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010679799.1| PREDICTED: 60S ribosomal protein L18a-2 [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score =   243 bits (620),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N+VRAKSKFWYF RKLKKVKKS GQVL INEI+EK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NDVRAKSKFWYFLRKLKKVKKSVGQVLAINEIYEKNPTLIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+P +LCKRE+ KQF    IKFPLV
Sbjct  95   EFRDTTLNGAVEQMYTEMASRHRVRAPCIQIIKTATVPDELCKRENTKQFHAKDIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FKKVRPPSRKLKTTYKASKPNLFM  178



>emb|CDY35269.1| BnaC03g59540D [Brassica napus]
Length=178

 Score =   243 bits (619),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRA SKFWYF RK  K+KKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAMSKFWYFLRKQVKIKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KAS+PN+F+
Sbjct  155  YRKVRPPTRKLKTTYKASKPNLFM  178



>gb|EMS54441.1| 60S ribosomal protein L18a [Triticum urartu]
Length=178

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KA+RPN+F+
Sbjct  155  YQKVRPPTRKLKTTYKATRPNLFM  178



>gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis thaliana]
Length=178

 Score =   242 bits (618),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTE+A RHRVR  CIQIIK AT+PAKLCKRE  KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEIASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPPSRKLKTT KAS+PN+F+
Sbjct  155  FRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_008229704.1| PREDICTED: uncharacterized protein LOC103329046 [Prunus mume]
Length=776

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  633  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYK  692

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  693  EYRDTTLNGAVEDMYTEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  752

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KA+RPNIFV
Sbjct  753  FKKVRPPTRKLKTTYKATRPNIFV  776



>ref|NP_001044264.1| Os01g0752300 [Oryza sativa Japonica Group]
 ref|XP_006644713.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
 sp|Q943F3.1|RL18A_ORYSJ RecName: Full=60S ribosomal protein L18a [Oryza sativa Japonica 
Group]
 pdb|3J61|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAB67920.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAB89536.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF06178.1| Os01g0752300 [Oryza sativa Japonica Group]
 gb|EAY75840.1| hypothetical protein OsI_03756 [Oryza sativa Indica Group]
 gb|EAZ13560.1| hypothetical protein OsJ_03475 [Oryza sativa Japonica Group]
Length=178

 Score =   241 bits (616),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_849729.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
 sp|Q8L7K0.1|R18A1_ARATH RecName: Full=60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AAM91614.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AAN15378.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AEE31159.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
Length=178

 Score =   241 bits (615),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWY+ R+ KKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVLAKSKFWYYLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KA++PN+F+
Sbjct  155  FRKVRPPTRKLKTTFKANKPNLFM  178



>ref|XP_002449311.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
 gb|EES08299.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
Length=178

 Score =   241 bits (615),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVR+KSKFWYF RKLKKVKKSNGQVL INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRSKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_003567891.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   241 bits (615),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+   LCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KA+RPN+F+
Sbjct  155  YQKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_009109630.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=194

 Score =   241 bits (616),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRA SKFWYF RK  K+KKSNGQ+L INEIFEK PT + N GIWLRYQSRTGYHNMYK
Sbjct  51   NEVRAMSKFWYFLRKQVKIKKSNGQMLAINEIFEKNPTTINNFGIWLRYQSRTGYHNMYK  110

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  111  EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLV  170

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KAS+PN+F+
Sbjct  171  YRKVRPPTRKLKTTYKASKPNLFM  194



>ref|XP_006595492.1| PREDICTED: uncharacterized protein LOC100305604 isoform X1 [Glycine 
max]
Length=753

 Score =   257 bits (656),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  610  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  669

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  670  EYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  729

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPP+RKLKTT KASRPN+F+
Sbjct  730  FKKIRPPTRKLKTTYKASRPNLFM  753



>ref|XP_006306031.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
 gb|EOA38929.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
Length=319

 Score =   246 bits (627),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF R+ KKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  176  NEVLAKSKFWYFLRRQKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYK  235

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  236  EFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPANLCKRESTKQFHNSKIKFPLV  295

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KA++PN+F+
Sbjct  296  FRKVRPPTRKLKTTYKANKPNLFM  319



>gb|EMT24993.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   241 bits (614),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKK+NGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKANGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRAPCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KA+RPN+F+
Sbjct  155  YQKVRPPTRKLKTTYKATRPNLFM  178



>dbj|BAJ85943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   241 bits (614),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKK+NGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKANGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG VEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGGVEQMYTEMASRHRVRSPCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KA+RPN+F+
Sbjct  155  YQKVRPPTRKLKTTYKATRPNLFM  178



>gb|EMT07340.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   241 bits (614),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT K +RPN+F+
Sbjct  155  YQKVRPPTRKLKTTYKVTRPNLFM  178



>ref|XP_002440257.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
 gb|EES18687.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
Length=178

 Score =   241 bits (614),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001149475.1| LOC100283101 [Zea mays]
 ref|XP_002458279.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 gb|ACF85683.1| unknown [Zea mays]
 gb|ACF85980.1| unknown [Zea mays]
 gb|ACG29474.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35503.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35547.1| 60S ribosomal protein L18a [Zea mays]
 gb|EES03399.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 tpg|DAA58211.1| TPA: hypothetical protein ZEAMMB73_000159 [Zea mays]
Length=178

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S+IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001056335.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|AAT77404.1| putative 60S ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF18249.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|EAY99039.1| hypothetical protein OsI_20997 [Oryza sativa Indica Group]
 dbj|BAG95664.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64706.1| hypothetical protein OsJ_19561 [Oryza sativa Japonica Group]
Length=178

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNSNIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_003569521.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+   LCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KA+RPN+F+
Sbjct  155  YQKVRPPTRKLKTTFKATRPNLFM  178



>ref|XP_010940708.1| PREDICTED: 60S ribosomal protein L18a-2-like [Elaeis guineensis]
Length=178

 Score =   240 bits (612),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF  KLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLSKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVE MY EMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EFRDTTLNGAVEHMYNEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPP+RKLKTT KASRPN+F+
Sbjct  155  FKKIRPPTRKLKTTYKASRPNLFM  178



>ref|XP_004166596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=752

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  609  NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  668

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  669  EYRDTTLNGAVEQMYTEMASRHRVRCPCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLV  728

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KAS+PN+F+
Sbjct  729  FKKVRPPTRKLKTTYKASKPNLFM  752



>ref|XP_010936051.1| PREDICTED: 60S ribosomal protein L18a-2 [Elaeis guineensis]
Length=178

 Score =   239 bits (611),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF  KLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLSKLKKVKKSNGQVLAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR HCIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEHMYNEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  155  FKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_006574359.1| PREDICTED: uncharacterized protein LOC100527007 isoform X1 [Glycine 
max]
Length=784

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  641  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYK  700

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  701  EYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  760

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKKVRPP+RKLKTT KASRPN+F+
Sbjct  761  FKKVRPPTRKLKTTYKASRPNLFM  784



>ref|XP_008465452.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=751

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  608  NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  667

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES KQF  SKIKFPLV
Sbjct  668  EYRDTTLNGAVEQMYTEMASRHRVRCPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLV  727

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KKVRPP+RKLKTT KAS+PN+F+
Sbjct  728  YKKVRPPTRKLKTTYKASKPNLFM  751



>ref|XP_006644488.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   239 bits (609),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  + IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNASIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_004969468.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   239 bits (609),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRAPCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPP+RKLKTT KASRPN+F+
Sbjct  155  SRKIRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006654794.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   239 bits (609),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF    IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>gb|ACF78859.1| unknown [Zea mays]
Length=178

 Score =   238 bits (608),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF R LKKVKKSNGQVL INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRNLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S+IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001043805.2| Os01g0666900 [Oryza sativa Japonica Group]
 gb|EEC71234.1| hypothetical protein OsI_03189 [Oryza sativa Indica Group]
 dbj|BAF05719.2| Os01g0666900 [Oryza sativa Japonica Group]
Length=178

 Score =   238 bits (608),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF    IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  YRKVRPPTRKLKTTFKASRPNLFM  178



>gb|ACG30921.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW81142.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   238 bits (608),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S+IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKL+TT KASRPN+F+
Sbjct  155  YRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_002893593.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69852.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score =   243 bits (620),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWYF R+ KKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  171  NEVLAKSKFWYFLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  230

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  231  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPANLCKRESTKQFHNSKIKFPLV  290

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  291  FRKVRPPTRKLKTTFKASKPNLFM  314



>ref|NP_001148024.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG29459.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   238 bits (607),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKL+TT KASRPN+F+
Sbjct  155  YRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_004979031.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   238 bits (606),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  +KIKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRAPCIQIIKTATVHFKLCKRDNTKQFHNAKIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPP+RKLKTT KASRPN+F+
Sbjct  155  SRKIRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006484924.1| PREDICTED: uncharacterized protein LOC102625748 [Citrus sinensis]
Length=820

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWY+ RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  677  NEVRAKSKFWYYLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  736

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLV
Sbjct  737  EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLV  796

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKL+TT KASRPN+F+
Sbjct  797  FRKVRPPTRKLRTTYKASRPNLFM  820



>ref|NP_001152227.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG46491.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW83498.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   237 bits (605),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/144 (79%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S+IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +KVRPP+RKL+TT KASRPN+F+
Sbjct  155  HRKVRPPTRKLRTTFKASRPNLFM  178



>gb|ACN28455.1| unknown [Zea mays]
 gb|AFW79177.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   237 bits (604),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKL+TT K+SRPN+F+
Sbjct  155  YRKVRPPTRKLRTTFKSSRPNLFM  178



>ref|XP_010666370.1| PREDICTED: 60S ribosomal protein L18a-like [Beta vulgaris subsp. 
vulgaris]
Length=177

 Score =   236 bits (603),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 113/144 (78%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N+VRAKSKFWYF RKLKKVKKS GQVL INEI+EK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  34   NDVRAKSKFWYFLRKLKKVKKSVGQVLAINEIYEKNPTIIKNYGIWLRYQSRTGYHNMYK  93

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAVEQMY EMA RHRVR  CIQIIK AT+P +LCKRE+ KQF    IKFP+V
Sbjct  94   EFRDTTLNGAVEQMYCEMASRHRVRAPCIQIIKTATVPDELCKRENTKQFHSKDIKFPMV  153

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KAS+PN+F+
Sbjct  154  FRKVRPPTRKLKTTYKASKPNLFM  177



>ref|XP_003569823.1| PREDICTED: 60S ribosomal protein L18a [Brachypodium distachyon]
Length=178

 Score =   236 bits (603),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L  NEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAFNEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+   +CKR++ KQF  S IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRSPCIQIIKTATVHFSICKRDNTKQFHKSDIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KA+RPN+F+
Sbjct  155  YQKVRPPTRKLKTTFKATRPNLFM  178



>gb|KJB69797.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=145

 Score =   234 bits (598),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  623  YFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGA  444
            YF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYKE+RDTT NGA
Sbjct  12   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  71

Query  443  VEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRK  264
            VEQMYTEMA RHRVR  CIQIIK ATIPAKLCKR+S KQF  SKIKFPLVFKKVRPP+RK
Sbjct  72   VEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRK  131

Query  263  LKTTXKASRPNIFV  222
            LKTT KAS+PN+F+
Sbjct  132  LKTTYKASKPNLFM  145



>ref|NP_001077626.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AEE31161.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=312

 Score =   240 bits (613),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKSKFWY+ R+ KKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  169  NEVLAKSKFWYYLRRQKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYK  228

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES KQF  SKIKFPLV
Sbjct  229  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLV  288

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            F+KVRPP+RKLKTT KA++PN+F+
Sbjct  289  FRKVRPPTRKLKTTFKANKPNLFM  312



>ref|XP_004491319.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartic protease At2g35615-like 
[Cicer arietinum]
Length=748

 Score =   250 bits (638),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 128/144 (89%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  605  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  664

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV
Sbjct  665  EYRDTTLNGAVETMYNEMASRHRVRFPCIQIIKTATIPASLCKRESTKQFHNSKIKFPLV  724

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KK+RPPSRKLKTT KA++PN+F+
Sbjct  725  YKKIRPPSRKLKTTYKANKPNLFM  748



>ref|XP_006828776.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
 gb|ERM96192.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
Length=138

 Score =   232 bits (592),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/134 (84%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = -2

Query  623  YFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGA  444
            YF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYKE+RDTT NGA
Sbjct  5    YFLRKLKKVKKSNGQVLAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  64

Query  443  VEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRK  264
            VEQMY EMA RHRVR  CIQIIK ATIPAKLCKRE+ KQF  S+IKFPLVF+KVRPP+RK
Sbjct  65   VEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRENTKQFHDSRIKFPLVFRKVRPPTRK  124

Query  263  LKTTXKASRPNIFV  222
            LKTT KASRPN+F+
Sbjct  125  LKTTFKASRPNLFM  138



>ref|XP_004961208.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=339

 Score =   239 bits (609),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  196  NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  255

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  SKIKFPLV
Sbjct  256  EYRDTTLNGAVEQMYNEMASRHRVRAPCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLV  315

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKLKTT KASRPN+F+
Sbjct  316  YRKVRPPTRKLKTTFKASRPNLFM  339



>ref|NP_001152434.1| LOC100286074 [Zea mays]
 gb|ACG47606.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   233 bits (593),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKS GQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSXGQMLAINEIFERXPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+R TT NGAVEQMY EMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S+IKFPLV
Sbjct  95   EYRXTTLNGAVEQMYNEMASRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KVRPP+RKL+TT KASRPN+F+
Sbjct  155  YRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_001762693.1| predicted protein [Physcomitrella patens]
 ref|XP_001768277.1| predicted protein [Physcomitrella patens]
 gb|EDQ66891.1| predicted protein [Physcomitrella patens]
 gb|EDQ72492.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   231 bits (590),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKL+KVKK++GQ+L INEIFEK PT +KN GIW+RYQSRTGYHNMYK
Sbjct  34   NEVRAKSKFWYFLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYK  93

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMY EMA RHRVR  CIQIIK ATIP  LCKR + KQF  SKIKFPL 
Sbjct  94   EYRDLTLNGAVEQMYDEMASRHRVRFPCIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLT  153

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPPSR LKTT KASRPN FV
Sbjct  154  TRKIRPPSRSLKTTYKASRPNTFV  177



>ref|XP_003617399.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=749

 Score =   247 bits (630),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  606  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  665

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV
Sbjct  666  EYRDTTLNGAVETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLV  725

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            +KK+RPP+R LKTT KA +PN+F+
Sbjct  726  YKKIRPPTRSLKTTYKAKKPNLFM  749



>ref|XP_001765218.1| predicted protein [Physcomitrella patens]
 ref|XP_001774990.1| predicted protein [Physcomitrella patens]
 gb|EDQ60256.1| predicted protein [Physcomitrella patens]
 gb|EDQ69946.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   230 bits (587),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKL+KVKK++GQ+L INEIFEK PT +KN GIW+RYQSRTGYHNMYK
Sbjct  34   NEVRAKSKFWYFLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYK  93

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMY EMA RHRVR  CIQIIK ATIP  LCKR + KQF  SKIKFPL 
Sbjct  94   EYRDLTLNGAVEQMYDEMASRHRVRFPCIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLT  153

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPP+R LKTT KASRPN FV
Sbjct  154  TRKIRPPTRSLKTTYKASRPNTFV  177



>ref|XP_009419339.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=173

 Score =   230 bits (587),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 123/143 (86%), Gaps = 5/143 (3%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NE RAKSKFWYF RKLKKVKKSNGQVL IN IFE+ PTK+KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEARAKSKFWYFLRKLKKVKKSNGQVLAINVIFERKPTKIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQII+ ATIP+KLC     KQF  SKIKFP+V
Sbjct  95   EYRDTTLNGAVEQMYNEMASRHRVRCLCIQIIRTATIPSKLC-----KQFHDSKIKFPVV  149

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
            FKKVRPP+RKLKTT KASRP++F
Sbjct  150  FKKVRPPTRKLKTTFKASRPSLF  172



>ref|XP_001760636.1| predicted protein [Physcomitrella patens]
 gb|EDQ74375.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            +EVRAKSKFWYF RKL+KVKK++GQ+L INEIFEK PT +KN GIW+RYQSRTGYHNMYK
Sbjct  34   DEVRAKSKFWYFLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYK  93

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMY EMA RHRVR  CIQIIK ATIP  LCKR + KQF  SKIKFPL 
Sbjct  94   EYRDLTLNGAVEQMYDEMASRHRVRSPCIQIIKTATIPVALCKRVNTKQFHNSKIKFPLT  153

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPPSR LKTT KASRPN FV
Sbjct  154  SRKIRPPSRSLKTTYKASRPNTFV  177



>gb|ACG47612.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   229 bits (584),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFE+ PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NG V QMY EM  RHRVR  CIQIIK AT+  KLCKR++ KQF  S+IKFPLV
Sbjct  95   EYRDTTLNGXVXQMYNEMXSRHRVRSPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLV  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            ++KV PP+RKL+TT KASRPN+F+
Sbjct  155  YRKVXPPTRKLRTTFKASRPNLFM  178



>ref|XP_001752605.1| predicted protein [Physcomitrella patens]
 gb|EDQ82476.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   229 bits (583),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKL+KVKK++GQ+L INEIFEK PT +KN GIW+RYQSRTGYHNMYK
Sbjct  34   NEVRAKSKFWYFLRKLQKVKKAHGQLLAINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYK  93

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMY EMA RHRVR  CIQIIK  TIP  LCKR + KQF  SKIKFPL 
Sbjct  94   EYRDLTLNGAVEQMYDEMASRHRVRFPCIQIIKTGTIPVSLCKRVNTKQFHNSKIKFPLT  153

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+RPP+R LKTT KASRPN FV
Sbjct  154  TRKIRPPTRSLKTTYKASRPNTFV  177



>ref|XP_011460183.1| PREDICTED: 60S ribosomal protein L18a [Fragaria vesca subsp. 
vesca]
Length=178

 Score =   229 bits (583),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 127/144 (88%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF +KLKKVKKSNGQ+L INEIFEK PT V+N GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLKKLKKVKKSNGQMLAINEIFEKKPTVVENYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAV+QMY EMA RHRVR  CIQIIK ATIPAKLCKRE  KQF  SKIKFPL+
Sbjct  95   EYRDTTLNGAVDQMYNEMASRHRVRFPCIQIIKIATIPAKLCKRECTKQFHNSKIKFPLI  154

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +KVRPP+RKLKTT KASRPN+FV
Sbjct  155  TRKVRPPTRKLKTTYKASRPNLFV  178



>ref|XP_006387717.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
 gb|ERP46631.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
Length=152

 Score =   226 bits (577),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/129 (85%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = -2

Query  608  LKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMY  429
            LKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMY
Sbjct  24   LKKVKKSNGQILAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMY  83

Query  428  TEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTX  249
            TEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIKFPLVFKKVRPP+RKLKTT 
Sbjct  84   TEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTY  143

Query  248  KASRPNIFV  222
            KASRPN+F+
Sbjct  144  KASRPNLFM  152



>gb|AAG52055.1|AC022455_9 60S ribosomal protein L18A, putative; 23187-20334 [Arabidopsis 
thaliana]
Length=321

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/156 (74%), Positives = 127/156 (81%), Gaps = 12/156 (8%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINE------------IFEKCPTKVKNXGIWLR  510
            NEV AKSKFWY+ R+ KKVKKSNGQ+L INE            IFEK PT +KN GIWLR
Sbjct  166  NEVLAKSKFWYYLRRQKKVKKSNGQMLAINEVLAVGSEFDLFSIFEKNPTTIKNFGIWLR  225

Query  509  YQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXK  330
            YQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA LCKRES K
Sbjct  226  YQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTK  285

Query  329  QFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            QF  SKIKFPLVF+KVRPP+RKLKTT KA++PN+F+
Sbjct  286  QFHNSKIKFPLVFRKVRPPTRKLKTTFKANKPNLFM  321



>pdb|3IZS|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 
80s Ribosome
Length=167

 Score =   224 bits (572),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQ+L INEIFEK PT +KN GIWLRYQSRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCKR++ KQF  S IKFPLV
Sbjct  95   EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLV  154

Query  293  FKKVRPPSRKLKT  255
            ++KVRPP+RKLKT
Sbjct  155  YRKVRPPTRKLKT  167



>ref|XP_003617398.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=147

 Score =   223 bits (569),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = -2

Query  623  YFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGA  444
            YF RKLKKVKKSNGQVL INEIFEK PTK+KN GIWLRYQSRTGYHNMYKE+RDTT NGA
Sbjct  14   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  73

Query  443  VEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRK  264
            VE MY EMA RHRVR  CIQIIK ATIPA LCKRES KQF  SKIKFPLV+KK+RPP+R 
Sbjct  74   VETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRS  133

Query  263  LKTTXKASRPNIFV  222
            LKTT KA +PN+F+
Sbjct  134  LKTTYKAKKPNLFM  147



>ref|XP_002961150.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
 ref|XP_002966859.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ31458.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ38689.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
Length=177

 Score =   224 bits (571),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 120/144 (83%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            +EVRAKSKFWYF RKLKKVKKS+GQ+L INEIFEK PT +KN GIW+RYQSRTGYHNMYK
Sbjct  34   DEVRAKSKFWYFLRKLKKVKKSHGQILAINEIFEKNPTTIKNYGIWVRYQSRTGYHNMYK  93

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMY EMA RHRVR  CIQIIK A++P   CKRE+ KQF  S+IKFPL+
Sbjct  94   EYRDITLNGAVEQMYDEMASRHRVRFPCIQIIKTASVPDSACKRENTKQFHSSEIKFPLM  153

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+R PSRKLKTT KA RPN F 
Sbjct  154  NRKIRAPSRKLKTTFKAKRPNTFA  177



>gb|EEE55145.1| hypothetical protein OsJ_02939 [Oryza sativa Japonica Group]
Length=198

 Score =   224 bits (571),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 125/164 (76%), Gaps = 20/164 (12%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINE--------------------IFEKCPTKV  534
            NEVRAKSKFWYF RKLKKVKKSNGQ+L IN                     IFE+ PT +
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQMLAINGGGPSAFANEFFIFLHHGFVGIFERNPTTI  94

Query  533  KNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAK  354
            KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  K
Sbjct  95   KNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFK  154

Query  353  LCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            LCKR++ KQF    IKFPLV++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  LCKRDNTKQFHNGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  198



>dbj|BAB90499.1| ribosomal protein L18a-like [Oryza sativa Japonica Group]
Length=195

 Score =   222 bits (566),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 126/161 (78%), Gaps = 17/161 (11%)
 Frame = -2

Query  653  NEVRAKSKF----------W-------YFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNX  525
            NEVRAKSKF          W       YF RKLKKVKKSNGQ+L INEIFE+ PT +KN 
Sbjct  35   NEVRAKSKFCSSYLVRFADWGACPVCRYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNY  94

Query  524  GIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCK  345
            GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+  KLCK
Sbjct  95   GIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCK  154

Query  344  RESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            R++ KQF    IKFPLV++KVRPP+RKLKTT KASRPN+F+
Sbjct  155  RDNTKQFHNGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  195



>gb|AAT08714.1| ribosomal protein L18A [Hyacinthus orientalis]
Length=178

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 120/148 (81%), Gaps = 8/148 (5%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHN---  483
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+    I LR+ +     N   
Sbjct  35   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKI----IELRHMAEVPEQNRLS  90

Query  482  -MYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIK  306
             MYKE+RDTT NG VEQMYTEMA RHRVR  CIQIIK ATIPAKLCKRES KQF  SKIK
Sbjct  91   YMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHDSKIK  150

Query  305  FPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            FPLVFKKVRPP+RKLKTT KASRPN+F+
Sbjct  151  FPLVFKKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_005652280.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
 gb|EIE27736.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
Length=179

 Score =   211 bits (537),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            + VRAKSKFWYF RKL+KVKK+NGQ+L  NEIFEK PT VKN G+W+RYQSRTGYHNMYK
Sbjct  35   DPVRAKSKFWYFLRKLRKVKKANGQILAANEIFEKKPTTVKNFGVWVRYQSRTGYHNMYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQ+Y EMA RHRVR  C+QIIK AT+PA L KR + KQF  SKIKFPL 
Sbjct  95   EYRDTTLNGAVEQLYQEMASRHRVRAPCMQIIKTATVPAALTKRVNIKQFHDSKIKFPLT  154

Query  293  FKKVRPPSRKLKTTXKASRPNI  228
             +  RP SR  KTT KA RPN+
Sbjct  155  RRMARPSSRTFKTTFKAVRPNV  176



>ref|XP_006384076.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ERP61873.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=121

 Score =   203 bits (516),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = -2

Query  560  IFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQI  381
            IFEK PTK+KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR  CIQI
Sbjct  9    IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  68

Query  380  IKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            IK ATIPAKLCKRES KQF  SKIKFPLVFKKVRPPSRKLKTT KASRPN+F+
Sbjct  69   IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  121



>gb|KDO49364.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=124

 Score =   203 bits (516),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  563  EIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQ  384
            EIFEK PTK+KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR  CIQ
Sbjct  11   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQ  70

Query  383  IIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            II+ ATIPAKLCKRES KQF  SKIKFPLVFKKVRPP+RKLKTT KASRPN+F+
Sbjct  71   IIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  124



>ref|XP_007146225.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
 gb|ESW18219.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
Length=159

 Score =   204 bits (518),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 112/144 (78%), Gaps = 19/144 (13%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RK+KKVKKSNGQ+L INE                   SRTGYHNMYK
Sbjct  35   NEVRAKSKFWYFLRKVKKVKKSNGQMLAINE-------------------SRTGYHNMYK  75

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK ATIPAKLCKRE  KQF  SKIKFPLV
Sbjct  76   EYRDTTLNGAVEQMYNEMASRHRVRCPCIQIIKTATIPAKLCKRECTKQFLDSKIKFPLV  135

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
            FKK+RPP+RKLKTT KAS+PN+F+
Sbjct  136  FKKIRPPTRKLKTTYKASKPNLFM  159



>ref|XP_005848088.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
 gb|EFN55986.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
Length=181

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            + VRAKSKFWYF RKL+KVKK+NGQ+L  NEIFE+ PT VKN GIW+RYQSRTG+HN YK
Sbjct  37   DPVRAKSKFWYFLRKLRKVKKANGQILACNEIFERNPTTVKNYGIWVRYQSRTGFHNAYK  96

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGAVEQMY EM  RHRVR  CIQIIK ATI A  CKR + +Q   SKI FPL 
Sbjct  97   EYRDTTLNGAVEQMYQEMGSRHRVRSPCIQIIKTATITAAQCKRAATQQLHDSKISFPLT  156

Query  293  FKKVRPPSRKLKTTXKASRPNI  228
             K +RP SRK +TT KA RPN+
Sbjct  157  RKVLRPSSRKYRTTFKAVRPNV  178



>gb|KIZ01204.1| 60S ribosomal protein L18a-2 [Monoraphidium neglectum]
Length=182

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            + V AKSKFWYF RKL++VKK+NGQVL +NEIFE+  T VKN G+W+RYQSRTGYHNMYK
Sbjct  38   DAVCAKSKFWYFLRKLRRVKKANGQVLAVNEIFERKTTTVKNFGVWVRYQSRTGYHNMYK  97

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RDTT NGA+ QMY EMA RHRVR  CIQ+IK AT+PA  CKR +  QF  SKIKFPL 
Sbjct  98   EYRDTTLNGAIGQMYGEMASRHRVRYPCIQVIKTATVPASACKRANTLQFHDSKIKFPLT  157

Query  293  FKKVRPPSRKLKTTXKASRPNI  228
               +RP S+  KT  KA RPN+
Sbjct  158  HNALRPSSKVFKTLYKAKRPNV  179



>ref|XP_004144680.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=757

 Score =   209 bits (532),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/156 (69%), Positives = 118/156 (76%), Gaps = 19/156 (12%)
 Frame = -2

Query  653  NEVRAKSKFW------------YFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLR  510
            NEVRAKSKFW            +      K+K + G       IFEK PTK+KN GIWLR
Sbjct  609  NEVRAKSKFWCVVILSVDVSLSFXLVTCXKMKANKG-------IFEKNPTKIKNYGIWLR  661

Query  509  YQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXK  330
            YQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PAKLCKRES K
Sbjct  662  YQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRCPCIQIIKTATVPAKLCKRESTK  721

Query  329  QFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            QF  SKIKFPLVFKKVRPP+RKLKTT KAS+PN+F+
Sbjct  722  QFHDSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  757



>gb|AFW81143.1| hypothetical protein ZEAMMB73_376835 [Zea mays]
Length=119

 Score =   192 bits (488),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -2

Query  578  VLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVR  399
            +L INEIFE+ PT +KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMY EMA RHRVR
Sbjct  1    MLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  60

Query  398  XHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
              CIQIIK AT+  KLCKR++ KQF  S+IKFPLV++KVRPP+RKL+TT KASRPN+F+
Sbjct  61   SPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  119



>ref|XP_009144150.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=117

 Score =   191 bits (486),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -2

Query  560  IFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQI  381
            IFEK PT +KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR  CIQI
Sbjct  5    IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  64

Query  380  IKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            IK AT+PAKLCKRES K F  SKIKFP VF+KVRPP+RKLKTT KAS+PN+F+
Sbjct  65   IKTATVPAKLCKRESTKLFHNSKIKFPSVFRKVRPPTRKLKTTYKASKPNLFM  117



>gb|KDD75676.1| ribosomal protein L18ae/LX [Helicosporidium sp. ATCC 50920]
Length=182

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 108/141 (77%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            + VRAKSKFWYF RKL+KVKK+NGQV+ +NEI EK PT VKN GIW+RY SRTG HNMYK
Sbjct  38   DSVRAKSKFWYFMRKLRKVKKANGQVVAVNEIVEKRPTVVKNYGIWVRYTSRTGVHNMYK  97

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRDTT NGAV QMY+EMA RHRVR   +QIIK A IPA+L KR   KQF  +KI+FP+ 
Sbjct  98   EFRDTTLNGAVSQMYSEMAGRHRVRHSALQIIKTAEIPAELVKRPGVKQFLSAKIRFPIT  157

Query  293  FKKVRPPSRKLKTTXKASRPN  231
             + VRP SR  K+  +  RPN
Sbjct  158  RRLVRPSSRVHKSLFQDRRPN  178



>ref|XP_011401286.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
 gb|KFM28272.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
Length=182

 Score =   188 bits (477),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 107/144 (74%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            + VRAKSKFWYF  KL+KVKK+NGQ++ +NEIFE+ PT +KN GIW+RY SRTG HNM+K
Sbjct  38   DTVRAKSKFWYFLAKLRKVKKANGQIVAVNEIFERRPTTIKNFGIWVRYTSRTGVHNMFK  97

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMY EM  RHRVR   +QIIK ATI A   KR + KQF  SKI FPL 
Sbjct  98   EYRDVTLNGAVEQMYQEMGSRHRVRSSALQIIKTATIKAADTKRANIKQFHDSKISFPLT  157

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +  RP   + KTT KA+RPN+ +
Sbjct  158  RRMARPSDPRFKTTFKANRPNVAI  181



>gb|ACN30573.1| unknown [Zea mays]
Length=117

 Score =   185 bits (469),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -2

Query  563  EIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHCIQ  384
            +IFE+ PT +KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMY EMA RHRVR  CIQ
Sbjct  4    QIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRSPCIQ  63

Query  383  IIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            IIK AT+  KLCKR++ KQF  S+IKFPLV++KVRPP+RKLKTT KASRPN+F+
Sbjct  64   IIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  117



>ref|XP_001689743.1| ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09481.1| ribosomal protein L18a [Chlamydomonas reinhardtii]
Length=182

 Score =   185 bits (469),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            ++V+AKSKFWYF RKL++VKK+NGQ++  NEIFE+ PT  KN GIW+RYQSRTG HNMYK
Sbjct  38   DDVKAKSKFWYFLRKLRRVKKANGQIIACNEIFERKPTLAKNYGIWVRYQSRTGVHNMYK  97

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NG+V QMY EMA RHRVR   IQIIK AT+    CKR + KQF   KI FP+ 
Sbjct  98   EYRDVTLNGSVSQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNEKISFPVT  157

Query  293  FKKVRPPSRKLKTTXKASRPNI  228
             K  RP S   +T  KA+RPN+
Sbjct  158  QKLARPSSATFRTLFKANRPNV  179



>ref|XP_002948508.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
 gb|EFJ50383.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
Length=182

 Score =   184 bits (467),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            ++V+AKSKFWYF RKL++VKK+NGQ++  NEIFE+ PT  KN G+W+RYQSRTG HNMYK
Sbjct  38   DDVKAKSKFWYFLRKLRRVKKANGQIIACNEIFERKPTLAKNYGVWVRYQSRTGVHNMYK  97

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NG+V QMY EMA RHRVR   IQIIK AT+    CKR + KQF    IKFP+ 
Sbjct  98   EYRDVTLNGSVAQMYQEMASRHRVRPSSIQIIKTATVDYHSCKRANTKQFHNENIKFPVT  157

Query  293  FKKVRPPSRKLKTTXKASRPNI  228
             K  RP + + +T  KASRPN+
Sbjct  158  HKLSRPSNPEFRTLFKASRPNV  179



>gb|KCW89757.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=178

 Score =   183 bits (464),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 89/99 (90%), Gaps = 0/99 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  70   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYK  129

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPA  357
            E+RDTT NGAVEQMYTEMA RHRVR  CIQIIK AT+PA
Sbjct  130  EYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPA  168



>gb|KHN49096.1| 60S ribosomal protein L18a-2, partial [Glycine soja]
Length=116

 Score =   178 bits (452),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/116 (73%), Positives = 95/116 (82%), Gaps = 0/116 (0%)
 Frame = -2

Query  569  INEIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVRXHC  390
            I + FEK PTK+KN GIWLRYQSRTGY +MYKE+RDTT NGA+  MY EMA RHRVR  C
Sbjct  1    IFQTFEKNPTKIKNYGIWLRYQSRTGYDSMYKEYRDTTLNGAIRVMYNEMASRHRVRSPC  60

Query  389  IQIIKXATIPAKLCKRESXKQFXXSKIKFPLVFKKVRPPSRKLKTTXKASRPNIFV  222
            IQIIK  TIPAKLCKRES KQF  SKI FPLV+KKVRPP+RKLK T KA +PN+F+
Sbjct  61   IQIIKIVTIPAKLCKRESTKQFHNSKINFPLVYKKVRPPTRKLKATYKAKKPNLFM  116



>ref|XP_001418811.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97104.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=179

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 102/141 (72%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            ++V+A+SKFWYF  +LKKVKK+NGQ++  NEIFE   T VKN GIW+RYQSRTGYHN YK
Sbjct  35   DDVKARSKFWYFMSRLKKVKKANGQIIACNEIFEADTTTVKNFGIWIRYQSRTGYHNSYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+R+TT N AV+ +Y EMA RHRVR  C+QIIK A +  K  +RE+ +QF    + FP+V
Sbjct  95   EYRETTMNAAVDALYEEMASRHRVRASCLQIIKIAEVADKDVRRENTRQFIQDDLSFPVV  154

Query  293  FKKVRPPSRKLKTTXKASRPN  231
             K  R PS+  KT  K  RPN
Sbjct  155  TKVTRHPSKASKTIIKYKRPN  175



>emb|CDY71447.1| BnaAnng37490D, partial [Brassica napus]
Length=98

 Score =   171 bits (434),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  578  VLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYKEFRDTTXNGAVEQMYTEMAXRHRVR  399
            +L INEIFEK PT +KN GIWLRYQSRTGYHNMYKE+RDTT NGAVEQMYTEMA RHRVR
Sbjct  1    MLAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVR  60

Query  398  XHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLVFKK  285
              CIQIIK AT+PAKLCKRES KQF  SKIKFPLVF+K
Sbjct  61   FPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRK  98



>ref|XP_007508296.1| unknown [Bathycoccus prasinos]
 emb|CCO20400.1| unknown [Bathycoccus prasinos]
Length=211

 Score =   173 bits (438),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 103/144 (72%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            +  RA+SKFWYF  +L+KVKK+NGQ++  NEIFEK  T VKN G+W+RYQSR G+HN YK
Sbjct  67   DATRARSKFWYFLSRLRKVKKANGQIIACNEIFEKDDTTVKNYGVWIRYQSRVGFHNAYK  126

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+R+TT N AV+ +YTEMA RHRVR H +QIIK A +  +  +RE+ +QF    + FP+V
Sbjct  127  EYRETTMNAAVDALYTEMASRHRVRSHALQIIKIAEVANEDVRRENTRQFLADDVSFPVV  186

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             K +R  S+  KTT K  RPN  +
Sbjct  187  RKTLRHDSKSQKTTFKYQRPNFAI  210



>gb|ABQ42114.1| 60S ribosomal protein L18a [Sonneratia caseolaris]
Length=107

 Score =   169 bits (428),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/93 (87%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PTK+ N GIWLRYQSRTGYHNMYK
Sbjct  15   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIDNYGIWLRYQSRTGYHNMYK  74

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIK  375
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK
Sbjct  75   EYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>gb|ABQ42113.1| 60S ribosomal protein L18a [Sonneratia alba]
 gb|ABQ42115.1| 60S ribosomal protein L18a [Sonneratia ovata]
 gb|ABQ42116.1| 60S ribosomal protein L18a [Sonneratia apetala]
Length=107

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/93 (86%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT++ N GIWLRYQSRTGYHNMYK
Sbjct  15   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRYQSRTGYHNMYK  74

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIK  375
            E+RDTT NGAVEQMY EMA RHRVR  CIQIIK
Sbjct  75   EYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>gb|ACS68696.1| 60S RPL18aB [Sonneratia alba]
 gb|ACS68767.1| 60S RPL18aB, partial [Sonneratia alba]
Length=101

 Score =   163 bits (413),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/90 (86%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEVRAKSKFWYF RKLKKVKKSNGQVL INEIFEK PT++ N GIWLRYQSRTGYHNMYK
Sbjct  12   NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRYQSRTGYHNMYK  71

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQ  384
            E+RDTT NGAVEQMY EMA RHRVR  CIQ
Sbjct  72   EYRDTTLNGAVEQMYNEMASRHRVRFPCIQ  101



>emb|CEF98555.1| Ribosomal protein L18ae [Ostreococcus tauri]
Length=179

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 103/141 (73%), Gaps = 0/141 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            ++V+A+SKFWYF  +LKKVKK+NGQ++  NEIFE+  T VKN GIW+RYQSRTG+HN YK
Sbjct  35   DDVKARSKFWYFMSRLKKVKKANGQIIACNEIFEEDTTTVKNFGIWIRYQSRTGFHNSYK  94

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+R+TT N AV+ +Y EMA RHRVR   +QIIK A +  +  +RE+ +QF    + FP+V
Sbjct  95   EYRETTMNKAVDALYEEMASRHRVRSSQLQIIKIAEVSDENVRRENTRQFLAEDLSFPVV  154

Query  293  FKKVRPPSRKLKTTXKASRPN  231
             K +R PS+  KT  K  RPN
Sbjct  155  NKVMRHPSKATKTIFKYKRPN  175



>gb|ADV03035.1| ribosomal protein L18A [Karlodinium veneficum]
Length=187

 Score =   166 bits (419),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 101/144 (70%), Gaps = 1/144 (1%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF +K+ K K+S G++L +NE+F++ PTKVKN GIWLRY+SRT  HNMYK
Sbjct  44   NAVLAKSRFWYFMKKINKAKRSGGELLGVNELFDRAPTKVKNYGIWLRYESRTNTHNMYK  103

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            EFRD T NGAV Q+Y+EMA RHR +   IQII    + A  CKR+   +   S +KFP V
Sbjct  104  EFRDVTINGAVSQLYSEMAGRHRAQPGSIQIIDTKVLKASECKRDHVTEMHKSDLKFP-V  162

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +K+   ++KLKTT  A RP  FV
Sbjct  163  IRKMPMSAKKLKTTFTAKRPMTFV  186



>ref|XP_008880083.1| hypothetical protein H310_14105 [Aphanomyces invadans]
 gb|ETV91246.1| hypothetical protein H310_14105 [Aphanomyces invadans]
Length=177

 Score =   164 bits (416),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 103/143 (72%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKS+FWYF  ++KK+KK+ G++L INE+ EK    VKN G+W+RY SR+G HNMYK
Sbjct  33   NEVLAKSRFWYFLHQMKKMKKTTGEILSINELREKNKRIVKNYGVWIRYNSRSGTHNMYK  92

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGA+EQ+Y E+A RHR R   IQI++ A + AK CK+ +  Q+  SKIKFPL 
Sbjct  93   EYRDVTLNGAIEQLYAELAGRHRARPRSIQIMRTAILAAKDCKKPNTLQYHDSKIKFPLS  152

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             +  RP  +K +T  KA+RP+ F
Sbjct  153  HRVPRPSLKKFRTVYKANRPSTF  175



>gb|ACO51977.1| 60S ribosomal protein L18a [Rana catesbeiana]
Length=176

 Score =   160 bits (405),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 98/143 (69%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KK++G+++   ++FEK P KVKN GIWLRY SR+G HNMY+
Sbjct  36   NHVVAKSRFWYFVSQLKKMKKASGEIVYCGQVFEKSPLKVKNFGIWLRYDSRSGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  96   EYRDLTTAGAVTQCYRDMGARHRARAHAIQIMKVEVIPANKCRRPAIKQFHDSKIKFPLP  155

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPNIF
Sbjct  156  HRVLR---RQHKPRFTTKRPNIF  175



>ref|XP_002501229.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62487.1| predicted protein [Micromonas sp. RCC299]
Length=188

 Score =   160 bits (405),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            ++ RAKSKFWYF  +LKKVKK+NGQ+L  NEIFE+  T +KN GIW+RYQSRTG+HN YK
Sbjct  42   DDTRAKSKFWYFLSRLKKVKKANGQILACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYK  101

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSK--IKFP  300
            E+R+ + N AV+ +Y EMA RHRVR  C+QIIK A +     KR++  QF   K  + FP
Sbjct  102  EYREVSMNKAVDALYEEMASRHRVRAPCLQIIKIAQVADADVKRDNTIQFLGVKEPVSFP  161

Query  299  LVFKKVRPPSRKLKTTXKASRPN  231
            +V K +R  S+  KTT K  RPN
Sbjct  162  VVNKVLRHDSKSQKTTFKYKRPN  184



>ref|XP_009831602.1| hypothetical protein H257_07690 [Aphanomyces astaci]
 gb|ETV78883.1| hypothetical protein H257_07690 [Aphanomyces astaci]
Length=177

 Score =   159 bits (402),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKS+FWYF  ++KK+KK+ G++L +NE+ EK    VKN G+W+RY SR+G HNMYK
Sbjct  33   NEVLAKSRFWYFLHQMKKMKKTTGEILSVNELREKNKRIVKNYGVWIRYNSRSGTHNMYK  92

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T N A+EQ+Y E+A RHR R   IQI++ A + AK CK+ +  Q+  S IKFPL 
Sbjct  93   EYRDVTLNSAIEQLYAELAGRHRARPRSIQIMRTAILAAKDCKKPNTLQYHNSAIKFPLS  152

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             +  RP  +K +T  KA+RP+ F
Sbjct  153  HRVPRPSLKKFRTIFKANRPSTF  175



>ref|XP_008604133.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
 gb|EQC42710.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
Length=177

 Score =   158 bits (400),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 100/143 (70%), Gaps = 0/143 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV AKS+FWYF  ++KK+KK+ G++L +NE+ EK    VKN G+W+RY SR+G HNMYK
Sbjct  33   NEVLAKSRFWYFLHQMKKMKKTTGEILCLNELREKNKRIVKNYGVWIRYNSRSGTHNMYK  92

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAVEQMY E+A RHR R   IQI++ A + AK CK+ +  Q+  S IKFPL 
Sbjct  93   EYRDVTLCGAVEQMYAELAGRHRARPRSIQIMRTAILAAKDCKKPNTLQYHDSAIKFPLS  152

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             +  RP ++  +T  KASRP  F
Sbjct  153  HRVPRPANKNQRTVFKASRPTTF  175



>ref|XP_010604767.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Fukomys damarensis]
Length=147

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   ++FEK P +VKN GIWLRY SR+G HNMY+
Sbjct  7    NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYR  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  67   EYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIPASKCRRPAVKQFHDSKIKFPLP  126

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  127  HRVLR---RQHKPRFTTKRPNTF  146



>ref|XP_001362363.1| PREDICTED: 60S ribosomal protein L18a [Monodelphis domestica]
Length=176

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   ++FEK P +VKN GIWLRY SR+G HNMY+
Sbjct  36   NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  96   EYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIPASKCRRPAVKQFHDSKIKFPLP  155

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  156  HRVLR---RQHKPRFTTKRPNTF  175



>ref|XP_005702735.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
 gb|EME26215.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
Length=178

 Score =   158 bits (399),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 99/144 (69%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF RKLK+VKKS+G++L I+EIFEK  T+VKN GIW+RY+SR+   NMY+
Sbjct  34   NVVNAKSRFWYFLRKLKRVKKSSGEILNISEIFEKKSTQVKNYGIWIRYKSRSDTINMYR  93

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T NGAVEQMY +M+ RHR R   I ++K   + AK C+R    QF  SKIKF L 
Sbjct  94   EYRDVTVNGAVEQMYKDMSGRHRARWSSIWVLKAMPVAAKDCRRSKVTQFHDSKIKFALP  153

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
              + R P +K  T  KA RP   V
Sbjct  154  HMRPRAPLKKYNTPFKAKRPTTIV  177



>ref|XP_004616713.1| PREDICTED: 60S ribosomal protein L18a [Sorex araneus]
 ref|XP_010604766.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Fukomys damarensis]
Length=176

 Score =   157 bits (398),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   ++FEK P +VKN GIWLRY SR+G HNMY+
Sbjct  36   NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKSPLRVKNFGIWLRYDSRSGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  96   EYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIPASKCRRPAVKQFHDSKIKFPLP  155

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  156  HRVLR---RQHKPRFTTKRPNTF  175



>gb|KFM72761.1| 60S ribosomal protein L18a, partial [Stegodyphus mimosarum]
Length=165

 Score =   157 bits (397),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 89/119 (75%), Gaps = 0/119 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            ++V AKS+FWYF RKLKK+KKSNG+++ I+EI++K PTKVKN GIWLRY SRTG HNMY+
Sbjct  36   DKVTAKSRFWYFTRKLKKLKKSNGEIVCISEIYDKTPTKVKNFGIWLRYNSRTGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPL  297
            E+RD T   AV Q Y +M  RHR R   IQI+K   IPA  C+R   KQF  SKIKFPL
Sbjct  96   EYRDMTVASAVTQCYRDMGARHRARADSIQIMKVEEIPASKCRRPHVKQFHDSKIKFPL  154



>ref|XP_010706034.1| PREDICTED: 60S ribosomal protein L18a [Meleagris gallopavo]
Length=147

 Score =   156 bits (395),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   +++EK P +VKN GIWLRY SR+G HNMY+
Sbjct  7    NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVYEKTPLRVKNFGIWLRYDSRSGTHNMYR  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  67   EYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEQIPASKCRRPAVKQFHDSKIKFPLP  126

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  127  HRVLR---RQHKPRFTTKRPNTF  146



>ref|XP_006633700.1| PREDICTED: 60S ribosomal protein L18a-like [Lepisosteus oculatus]
Length=176

 Score =   157 bits (396),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +L+K+KK++G+++   ++FEK P KVKN GIWLRY SR+G HNMY+
Sbjct  36   NHVVAKSRFWYFVSQLRKMKKASGEIVYCGQVFEKSPLKVKNFGIWLRYDSRSGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  96   EYRDLTTAGAVTQCYRDMGARHRARAHSIQIMKVEEIPASKCRRPAIKQFHDSKIKFPLP  155

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  156  HRVLR---RQHKPRFTTKRPNTF  175



>gb|AAI67657.1| Unknown (protein for IMAGE:7718161) [Xenopus (Silurana) tropicalis]
Length=162

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   +++EK P KVKN GIWLRY SR+G HNMY+
Sbjct  22   NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVYEKTPLKVKNFGIWLRYDSRSGTHNMYR  81

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T   AV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  82   EYRDLTTAAAVTQCYRDMGARHRARAHAIQIMKVEVIPASKCRRPAIKQFHDSKIKFPLP  141

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  142  HRVLR---RQHKPRFTTKRPNTF  161



>gb|ACO51820.1| 60S ribosomal protein L18a [Rana catesbeiana]
Length=176

 Score =   156 bits (395),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KK++G+++   ++FEK P KVKN GIWL Y SR+G HNMY+
Sbjct  36   NHVVAKSRFWYFVSQLKKMKKASGEIVYCGQVFEKSPLKVKNFGIWLHYDSRSGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  96   EYRDLTTAGAVTQCYRDMGARHRARAHAIQIMKVEVIPANKCRRPAIKQFHDSKIKFPLP  155

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  156  HRVLR---RQHKPRFTTKRPNTF  175



>gb|AAH42256.1| RPL18A protein, partial [Xenopus laevis]
Length=178

 Score =   156 bits (395),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KK++G+++   ++FEK P KVKN GIWLRY SR+G HNMY+
Sbjct  38   NHVVAKSRFWYFVSQLKKMKKASGEIVYCGQVFEKTPLKVKNFGIWLRYDSRSGTHNMYR  97

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T   AV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  98   EYRDLTTAAAVTQCYRDMGARHRARAHAIQIMKVEVIPASKCRRPAIKQFHDSKIKFPLP  157

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  158  HRVLR---RQHKPRFTTKRPNTF  177



>gb|AAI61335.1| LOC549444 protein [Xenopus (Silurana) tropicalis]
Length=165

 Score =   156 bits (394),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   +++EK P KVKN GIWLRY SR+G HNMY+
Sbjct  25   NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVYEKTPLKVKNFGIWLRYDSRSGTHNMYR  84

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T   AV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  85   EYRDLTTAAAVTQCYRDMGARHRARAHAIQIMKVEVIPASKCRRPAIKQFHDSKIKFPLP  144

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  145  HRVLR---RQHKPRFTTKRPNTF  164



>emb|CBN79653.1| ribosomal protein L18 [Ectocarpus siliculosus]
Length=238

 Score =   158 bits (400),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 0/144 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            NEV   S+FWY   +++K+KK+ G++L I E+ EK    +KN GIWLRY SR+G HNMY+
Sbjct  94   NEVTGASQFWYLMHQMRKMKKTTGEILDIVELTEKNARIIKNYGIWLRYDSRSGTHNMYR  153

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T  GAV+QMY+EMA RHR R   IQII+   + AK  KR   +QF  + IKFPL 
Sbjct  154  EYRDLTLTGAVDQMYSEMAGRHRCRPRSIQIIRTGIVAAKDTKRPDVQQFHNANIKFPLT  213

Query  293  FKKVRPPSRKLKTTXKASRPNIFV  222
             +  R P +K +TT KASRP  F+
Sbjct  214  HRLPRAPKKKFRTTFKASRPTTFL  237



>ref|NP_001090206.1| ribosomal protein L18a [Xenopus laevis]
 gb|AAH53761.1| MGC64263 protein [Xenopus laevis]
 gb|AAI52716.1| Hypothetical protein MGC64263 [Xenopus laevis]
Length=176

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KK++G+++   ++FEK P KVKN GIWLRY SR+G HNMY+
Sbjct  36   NHVVAKSRFWYFVSQLKKMKKASGEIVYCGQVFEKTPLKVKNFGIWLRYDSRSGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T   AV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  96   EYRDLTTAAAVTQCYRDMGARHRARAHAIQIMKVEVIPASKCRRPAIKQFHDSKIKFPLP  155

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  156  HRVLR---RQHKPRFTTKRPNTF  175



>ref|NP_001016690.1| ribosomal protein L18a [Xenopus (Silurana) tropicalis]
 gb|AAI67567.1| hypothetical protein LOC549444 [Xenopus (Silurana) tropicalis]
Length=176

 Score =   156 bits (394),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 96/143 (67%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   +++EK P KVKN GIWLRY SR+G HNMY+
Sbjct  36   NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVYEKTPLKVKNFGIWLRYDSRSGTHNMYR  95

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T   AV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  96   EYRDLTTAAAVTQCYRDMGARHRARAHAIQIMKVEVIPASKCRRPAIKQFHDSKIKFPLP  155

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  156  HRVLR---RQHKPRFTTKRPNTF  175



>ref|XP_003062312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53131.1| predicted protein [Micromonas pusilla CCMP1545]
Length=185

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            ++ RAKSKFWYF  +LKKVKK+NGQ++  NEIFE+  T +KN GIW+RYQSRTG+HN YK
Sbjct  39   DDTRAKSKFWYFLSRLKKVKKANGQIIACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYK  98

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSK--IKFP  300
            E+R+ + N AV+ +Y EMA RHRVR  C+QIIK   +     KR++  QF   K  + FP
Sbjct  99   EYREISMNKAVDALYEEMASRHRVRAPCLQIIKICQVADADVKRDNTIQFLGVKEPVSFP  158

Query  299  LVFKKVRPPSRKLKTTXKASRPN  231
            +V K +R  S+  KTT K  RPN
Sbjct  159  VVNKVLRHDSKSQKTTFKYKRPN  181



>ref|XP_005988720.1| PREDICTED: 60S ribosomal protein L18a-like isoform X2 [Latimeria 
chalumnae]
Length=147

 Score =   154 bits (390),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 96/143 (67%), Gaps = 3/143 (2%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N V AKS+FWYF  +LKK+KKS+G+++   ++FEK P KVKN GIWLRY SR+G HNMY+
Sbjct  7    NHVVAKSRFWYFVSQLKKMKKSSGEIVYCGQVFEKKPEKVKNFGIWLRYDSRSGTHNMYR  66

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD T   AV Q Y +M  RHR R H IQI+K   IPA  C+R + KQF  SKIKFPL 
Sbjct  67   EYRDMTTAAAVTQCYRDMGARHRARAHSIQIMKVEEIPANKCRRPAIKQFHDSKIKFPLP  126

Query  293  FKKVRPPSRKLKTTXKASRPNIF  225
             + +R   R+ K      RPN F
Sbjct  127  HRVLR---RQHKPRFTTKRPNTF  146



>ref|XP_005830017.1| large subunit ribosomal protein L18Ae, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX43037.1| large subunit ribosomal protein L18Ae, cytoplasmic [Guillardia 
theta CCMP2712]
Length=187

 Score =   155 bits (393),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = -2

Query  653  NEVRAKSKFWYFXRKLKKVKKSNGQVLXINEIFEKCPTKVKNXGIWLRYQSRTGYHNMYK  474
            N+V AKS+FWY+   LK+VKK+NG++L INEIFEK P+ V N GIW+RY SRTG+HNMY+
Sbjct  42   NKVVAKSRFWYYMSLLKRVKKANGEILQINEIFEKKPSTVSNYGIWMRYDSRTGHHNMYR  101

Query  473  EFRDTTXNGAVEQMYTEMAXRHRVRXHCIQIIKXATIPAKLCKRESXKQFXXSKIKFPLV  294
            E+RD +  GAV +MY ++A RHR R   +QI++ A +P  + ++   K++    IKFP+ 
Sbjct  102  EYRDVSICGAVSKMYQDVAARHRSRFSNVQIVRTAQVPDDMLRKTWNKEYLEKDIKFPIT  161

Query  293  FKKVRPPSRKLKTTXKASRP  234
             + +RP S+ LK T  A RP
Sbjct  162  HRVLRPSSKALKKTFVARRP  181



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1028498319500