BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038H20

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP09213.1|  unnamed protein product                                197   9e-57   Coffea canephora [robusta coffee]
ref|XP_007026646.1|  Metallopeptidase M24 family protein isoform 1      191   2e-54   
ref|XP_010092793.1|  Proliferation-associated protein 2G4               191   4e-54   
ref|XP_011095038.1|  PREDICTED: proliferation-associated protein ...    189   7e-54   Sesamum indicum [beniseed]
gb|AFK46635.1|  unknown                                                 182   7e-54   Medicago truncatula
ref|XP_011077533.1|  PREDICTED: proliferation-associated protein ...    189   1e-53   Sesamum indicum [beniseed]
ref|XP_008442393.1|  PREDICTED: proliferation-associated protein ...    188   2e-53   Cucumis melo [Oriental melon]
ref|XP_007205303.1|  hypothetical protein PRUPE_ppa006778mg             188   2e-53   
ref|XP_010937887.1|  PREDICTED: proliferation-associated protein ...    188   2e-53   Elaeis guineensis
gb|KDP22867.1|  hypothetical protein JCGZ_00454                         188   3e-53   Jatropha curcas
gb|EPS71863.1|  hypothetical protein M569_02886                         187   3e-53   Genlisea aurea
gb|EYU26681.1|  hypothetical protein MIMGU_mgv1a007877mg                187   7e-53   Erythranthe guttata [common monkey flower]
ref|XP_002530504.1|  proliferation-associated 2g4, putative             186   1e-52   Ricinus communis
ref|XP_004137704.1|  PREDICTED: proliferation-associated protein ...    186   1e-52   Cucumis sativus [cucumbers]
gb|AFK36627.1|  unknown                                                 181   1e-52   Lotus japonicus
ref|XP_004302550.1|  PREDICTED: proliferation-associated protein 2G4    186   2e-52   Fragaria vesca subsp. vesca
ref|XP_004156612.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    186   2e-52   
ref|XP_008792832.1|  PREDICTED: proliferation-associated protein ...    186   2e-52   
ref|XP_010920808.1|  PREDICTED: proliferation-associated protein ...    186   2e-52   Elaeis guineensis
ref|XP_008792800.1|  PREDICTED: proliferation-associated protein ...    186   2e-52   Phoenix dactylifera
gb|KHN20329.1|  Proliferation-associated protein 2G4                    182   3e-52   Glycine soja [wild soybean]
ref|XP_006344058.1|  PREDICTED: proliferation-associated protein ...    185   3e-52   Solanum tuberosum [potatoes]
ref|XP_006344057.1|  PREDICTED: proliferation-associated protein ...    185   3e-52   Solanum tuberosum [potatoes]
gb|ACU22749.1|  unknown                                                 182   4e-52   Glycine max [soybeans]
ref|XP_011019082.1|  PREDICTED: proliferation-associated protein ...    185   4e-52   Populus euphratica
ref|XP_003529167.1|  PREDICTED: proliferation-associated protein 2G4    185   5e-52   Glycine max [soybeans]
ref|XP_009599246.1|  PREDICTED: proliferation-associated protein ...    184   6e-52   Nicotiana tomentosiformis
ref|XP_010676777.1|  PREDICTED: proliferation-associated protein 2G4    184   8e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010040429.1|  PREDICTED: proliferation-associated protein ...    179   9e-52   
ref|XP_004240407.1|  PREDICTED: proliferation-associated protein ...    183   1e-51   Solanum lycopersicum
ref|XP_010321752.1|  PREDICTED: proliferation-associated protein ...    183   1e-51   Solanum lycopersicum
ref|XP_003623305.1|  Proliferation-associated protein 2G4               183   1e-51   Medicago truncatula
gb|KHN39558.1|  Proliferation-associated protein 2G4                    183   2e-51   Glycine soja [wild soybean]
ref|XP_009789408.1|  PREDICTED: proliferation-associated protein ...    183   2e-51   Nicotiana sylvestris
ref|XP_002262986.2|  PREDICTED: proliferation-associated protein 2G4    183   2e-51   Vitis vinifera
ref|NP_001241588.1|  uncharacterized protein LOC100781302               183   2e-51   Glycine max [soybeans]
ref|XP_007140243.1|  hypothetical protein PHAVU_008G095900g             183   2e-51   Phaseolus vulgaris [French bean]
ref|XP_009376423.1|  PREDICTED: proliferation-associated protein ...    182   2e-51   Pyrus x bretschneideri [bai li]
ref|XP_006429434.1|  hypothetical protein CICLE_v10011909mg             183   3e-51   
ref|XP_003516956.1|  PREDICTED: proliferation-associated protein 2G4    182   3e-51   Glycine max [soybeans]
ref|XP_009376419.1|  PREDICTED: proliferation-associated protein ...    183   3e-51   Pyrus x bretschneideri [bai li]
gb|KDO56711.1|  hypothetical protein CISIN_1g016183mg                   182   3e-51   Citrus sinensis [apfelsine]
gb|KHN42848.1|  Proliferation-associated protein 2G4                    182   3e-51   Glycine soja [wild soybean]
ref|XP_002308228.2|  hypothetical protein POPTR_0006s10320g             182   3e-51   
gb|ABK95017.1|  unknown                                                 182   3e-51   Populus trichocarpa [western balsam poplar]
ref|XP_008366899.1|  PREDICTED: proliferation-associated protein ...    181   4e-51   
gb|KHN22549.1|  Proliferation-associated protein 2G4                    181   4e-51   Glycine soja [wild soybean]
gb|KJB17053.1|  hypothetical protein B456_002G262700                    182   4e-51   Gossypium raimondii
ref|XP_008362268.1|  PREDICTED: proliferation-associated protein ...    182   4e-51   Malus domestica [apple tree]
gb|KHG25370.1|  Proliferation-associated 2G4                            182   5e-51   Gossypium arboreum [tree cotton]
gb|KEH38647.1|  proliferation-associated 2G4-like protein               182   6e-51   Medicago truncatula
ref|XP_008805004.1|  PREDICTED: proliferation-associated protein ...    182   6e-51   Phoenix dactylifera
ref|XP_002322994.2|  hypothetical protein POPTR_0016s12720g             181   6e-51   
gb|ACJ85304.1|  unknown                                                 182   7e-51   Medicago truncatula
ref|XP_008789134.1|  PREDICTED: proliferation-associated protein ...    182   7e-51   Phoenix dactylifera
gb|KCW45226.1|  hypothetical protein EUGRSUZ_L01140                     179   8e-51   Eucalyptus grandis [rose gum]
ref|XP_006576221.1|  PREDICTED: uncharacterized protein LOC100784...    181   9e-51   
ref|XP_009599304.1|  PREDICTED: proliferation-associated protein ...    181   1e-50   Nicotiana tomentosiformis
ref|XP_007140242.1|  hypothetical protein PHAVU_008G095800g             181   1e-50   Phaseolus vulgaris [French bean]
gb|ABK24337.1|  unknown                                                 181   1e-50   Picea sitchensis
ref|XP_004242516.1|  PREDICTED: proliferation-associated protein ...    181   1e-50   Solanum lycopersicum
ref|XP_008388269.1|  PREDICTED: proliferation-associated protein ...    181   1e-50   Malus domestica [apple tree]
gb|AAF91445.1|AF281652_1  putative DNA binding protein                  181   2e-50   Atriplex hortensis
gb|ABF66654.1|  EBP1                                                    181   2e-50   Ammopiptanthus mongolicus
ref|XP_009402229.1|  PREDICTED: proliferation-associated protein ...    181   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011046861.1|  PREDICTED: proliferation-associated protein ...    181   2e-50   Populus euphratica
ref|XP_010650887.1|  PREDICTED: proliferation-associated protein ...    180   2e-50   
gb|KJB36949.1|  hypothetical protein B456_006G183700                    177   2e-50   Gossypium raimondii
ref|XP_002278744.2|  PREDICTED: proliferation-associated protein ...    180   2e-50   Vitis vinifera
ref|XP_010264591.1|  PREDICTED: proliferation-associated protein ...    180   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_010037691.1|  PREDICTED: proliferation-associated protein 2G4    180   3e-50   Eucalyptus grandis [rose gum]
ref|XP_002988189.1|  hypothetical protein SELMODRAFT_127648             179   3e-50   
gb|KHG01253.1|  Proliferation-associated 2G4                            180   3e-50   Gossypium arboreum [tree cotton]
ref|XP_009599303.1|  PREDICTED: proliferation-associated protein ...    181   3e-50   Nicotiana tomentosiformis
gb|EYU41925.1|  hypothetical protein MIMGU_mgv1a007938mg                180   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_004492468.1|  PREDICTED: proliferation-associated protein ...    180   4e-50   Cicer arietinum [garbanzo]
ref|XP_009384793.1|  PREDICTED: proliferation-associated protein ...    179   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008388270.1|  PREDICTED: proliferation-associated protein ...    179   4e-50   
ref|NP_001149216.1|  proliferation-associated protein 2G4               179   4e-50   Zea mays [maize]
gb|KJB36946.1|  hypothetical protein B456_006G183700                    179   4e-50   Gossypium raimondii
ref|XP_009773246.1|  PREDICTED: proliferation-associated protein ...    179   6e-50   Nicotiana sylvestris
gb|KJB36944.1|  hypothetical protein B456_006G183700                    179   6e-50   Gossypium raimondii
gb|KJB36945.1|  hypothetical protein B456_006G183700                    178   8e-50   Gossypium raimondii
ref|XP_002963479.1|  hypothetical protein SELMODRAFT_79780              178   8e-50   
ref|NP_001275188.1|  EBP1                                               179   9e-50   Solanum tuberosum [potatoes]
gb|AHA84129.1|  DNA-binding protein GBP16                               179   1e-49   Phaseolus vulgaris [French bean]
ref|XP_008464212.1|  PREDICTED: proliferation-associated protein ...    180   1e-49   Cucumis melo [Oriental melon]
ref|XP_010253797.1|  PREDICTED: proliferation-associated protein ...    178   2e-49   Nelumbo nucifera [Indian lotus]
ref|NP_001242070.1|  uncharacterized protein LOC100784176               177   3e-49   
ref|XP_010907413.1|  PREDICTED: proliferation-associated protein ...    176   3e-49   
ref|XP_002440927.1|  hypothetical protein SORBIDRAFT_09g016610          177   3e-49   Sorghum bicolor [broomcorn]
ref|XP_004489059.1|  PREDICTED: proliferation-associated protein ...    177   6e-49   Cicer arietinum [garbanzo]
ref|XP_010907411.1|  PREDICTED: proliferation-associated protein ...    176   7e-49   Elaeis guineensis
ref|XP_004962368.1|  PREDICTED: proliferation-associated protein ...    176   1e-48   Setaria italica
ref|XP_010920806.1|  PREDICTED: proliferation-associated protein ...    176   2e-48   
gb|AEY75257.1|  putative DNA binding protein                            175   3e-48   Atriplex canescens [shadscale]
ref|XP_004489058.1|  PREDICTED: proliferation-associated protein ...    176   3e-48   
ref|XP_010920804.1|  PREDICTED: proliferation-associated protein ...    176   3e-48   
gb|ADK78215.1|  methionine aminopeptiase                                174   3e-48   Hordeum vulgare [barley]
ref|XP_003568643.1|  PREDICTED: proliferation-associated protein 2G4    172   3e-47   Brachypodium distachyon [annual false brome]
gb|AFG29445.1|  Erb3 binding protein                                    172   3e-47   Nervilia fordii
ref|XP_010553237.1|  PREDICTED: proliferation-associated protein ...    172   3e-47   Tarenaya hassleriana [spider flower]
gb|KFK34423.1|  hypothetical protein AALP_AA5G142900                    171   1e-46   Arabis alpina [alpine rockcress]
ref|XP_001779761.1|  predicted protein                                  171   1e-46   
gb|EMT31637.1|  Proliferation-associated protein 2G4                    172   2e-46   
gb|EAY97646.1|  hypothetical protein OsI_19569                          170   2e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001055274.1|  Os05g0350500                                       169   3e-46   
ref|XP_009115883.1|  PREDICTED: proliferation-associated protein ...    169   6e-46   Brassica rapa
ref|XP_009115882.1|  PREDICTED: proliferation-associated protein ...    169   6e-46   Brassica rapa
ref|XP_009799003.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    167   8e-46   Nicotiana sylvestris
gb|EMS60472.1|  Proliferation-associated protein 2G4                    171   8e-46   Triticum urartu
ref|XP_001769950.1|  predicted protein                                  168   8e-46   
emb|CDX73690.1|  BnaC08g23130D                                          168   1e-45   
gb|AAB80919.1|  DNA-binding protein GBP16                               167   1e-45   Oryza sativa Japonica Group [Japonica rice]
emb|CDX78041.1|  BnaA09g32360D                                          168   2e-45   
ref|XP_010529897.1|  PREDICTED: proliferation-associated protein ...    167   3e-45   Tarenaya hassleriana [spider flower]
ref|XP_006654286.1|  PREDICTED: proliferation-associated protein ...    166   4e-45   Oryza brachyantha
ref|XP_010515611.1|  PREDICTED: proliferation-associated protein ...    166   6e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006403880.1|  hypothetical protein EUTSA_v10010435mg             166   7e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010426749.1|  PREDICTED: proliferation-associated protein ...    165   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010503881.1|  PREDICTED: proliferation-associated protein ...    165   1e-44   Camelina sativa [gold-of-pleasure]
emb|CDY16291.1|  BnaC01g23260D                                          164   2e-44   Brassica napus [oilseed rape]
ref|XP_009123761.1|  PREDICTED: proliferation-associated protein ...    164   2e-44   Brassica rapa
emb|CDY33263.1|  BnaA01g19300D                                          164   3e-44   Brassica napus [oilseed rape]
gb|AGV54689.1|  proliferation-associated protein 2G4-like protein       163   7e-44   Phaseolus vulgaris [French bean]
ref|XP_006291296.1|  hypothetical protein CARUB_v10017431mg             160   1e-43   
ref|XP_006291295.1|  hypothetical protein CARUB_v10017431mg             162   1e-43   
ref|NP_190748.1|  putative nuclear DNA-binding protein G2p              162   2e-43   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25936.1|AF360226_1  putative nuclear DNA-binding protein G2p      162   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190060.1|  putative nuclear DNA-binding protein G2p           160   5e-43   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19507.1|  AT3G51800                                              160   6e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877825.1|  hypothetical protein ARALYDRAFT_906530             160   9e-43   Arabidopsis lyrata subsp. lyrata
emb|CDY29047.1|  BnaC07g32530D                                          159   1e-42   Brassica napus [oilseed rape]
emb|CDX90633.1|  BnaA03g41480D                                          159   2e-42   
ref|XP_009136636.1|  PREDICTED: proliferation-associated protein ...    159   2e-42   Brassica rapa
ref|NP_850679.1|  putative nuclear DNA-binding protein G2p              154   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001765994.1|  predicted protein                                  153   3e-40   
gb|KCW45224.1|  hypothetical protein EUGRSUZ_L01138                     135   5e-35   Eucalyptus grandis [rose gum]
gb|EEE63363.1|  hypothetical protein OsJ_18175                          134   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_005650680.1|  proliferation-associated protein 1                 128   5e-31   Coccomyxa subellipsoidea C-169
gb|KIZ00762.1|  hypothetical protein MNEG_7198                          114   8e-26   Monoraphidium neglectum
gb|KHN18039.1|  Proliferation-associated protein 2G4                    106   3e-24   Glycine soja [wild soybean]
ref|XP_003062941.1|  predicted protein                                  109   3e-24   Micromonas pusilla CCMP1545
gb|KFM70392.1|  Proliferation-associated protein 2G4                    105   1e-23   Stegodyphus mimosarum
ref|XP_003084394.1|  putative DNA-binding protein GBP16 (ISS)           107   1e-23   
emb|CEG00817.1|  Peptidase M24, methionine aminopeptidase               107   1e-23   Ostreococcus tauri
ref|XP_001699126.1|  hypothetical protein CHLREDRAFT_139416             107   2e-23   Chlamydomonas reinhardtii
ref|XP_001422365.1|  predicted protein                                  106   3e-23   Ostreococcus lucimarinus CCE9901
gb|KDO19442.1|  DNA-binding protein                                     106   3e-23   Saprolegnia parasitica CBS 223.65
ref|XP_008619458.1|  hypothetical protein SDRG_15074                    106   3e-23   Saprolegnia diclina VS20
ref|XP_002508417.1|  predicted protein                                  106   4e-23   Micromonas commoda
ref|XP_010156890.1|  PREDICTED: proliferation-associated protein 2G4    101   5e-23   Eurypyga helias
ref|XP_002900555.1|  proliferation-associated protein, metallopro...    105   6e-23   Phytophthora infestans T30-4
gb|ETL29090.1|  DNA-binding protein, 42 kDa                             104   1e-22   Phytophthora parasitica
ref|XP_008912890.1|  DNA-binding protein, 42 kDa                        104   1e-22   Phytophthora parasitica INRA-310
ref|XP_002947167.1|  hypothetical protein VOLCADRAFT_79596              104   2e-22   Volvox carteri f. nagariensis
ref|XP_006843644.1|  hypothetical protein AMTR_s00007p00167240          103   2e-22   
ref|XP_005876787.1|  PREDICTED: proliferation-associated protein 2G4    104   2e-22   Myotis brandtii
ref|XP_005655696.1|  PREDICTED: proliferation-associated protein ...    102   2e-22   
gb|KFV57642.1|  Proliferation-associated protein 2G4                    100   2e-22   Tyto alba [Schleiereule]
ref|XP_008003570.1|  PREDICTED: proliferation-associated protein 2G4    103   3e-22   Chlorocebus sabaeus
ref|XP_009970305.1|  PREDICTED: proliferation-associated protein 2G4    101   3e-22   Tyto alba [Schleiereule]
ref|XP_003391218.2|  PREDICTED: proliferation-associated protein ...  99.8    4e-22   
ref|XP_010174926.1|  PREDICTED: proliferation-associated protein ...  98.6    4e-22   
ref|XP_009533169.1|  methionine aminopeptidase, merops subfamily M24    103   5e-22   Phytophthora sojae
ref|XP_011173347.1|  PREDICTED: proliferation-associated protein 2G4    102   5e-22   Solenopsis invicta [imported red fire ant]
ref|XP_011340977.1|  PREDICTED: proliferation-associated protein 2G4    102   5e-22   Ooceraea biroi
gb|EFZ09337.1|  hypothetical protein SINV_15911                         103   5e-22   
ref|XP_008318205.1|  PREDICTED: proliferation-associated protein ...    102   6e-22   Cynoglossus semilaevis [half-smooth tongue sole]
emb|CAA59260.1|  p38-2G4                                                102   7e-22   Mus musculus [mouse]
dbj|BAF84485.1|  unnamed protein product                                102   7e-22   Homo sapiens [man]
gb|AAH32111.1|  PA2G4 protein                                           102   7e-22   Homo sapiens [man]
ref|XP_011263181.1|  PREDICTED: proliferation-associated protein 2G4    102   7e-22   Camponotus floridanus
gb|AAH03777.1|  Pa2g4 protein                                           102   7e-22   Mus musculus [mouse]
gb|ELR50756.1|  Proliferation-associated protein 2G4                    102   7e-22   Bos mutus
dbj|BAE25986.1|  unnamed protein product                                102   7e-22   Mus musculus [mouse]
ref|XP_006908945.1|  PREDICTED: proliferation-associated protein 2G4    102   7e-22   Pteropus alecto
ref|NP_035249.1|  proliferation-associated protein 2G4                  102   7e-22   Mus musculus [mouse]
ref|NP_001029871.1|  proliferation-associated protein 2G4               102   7e-22   Bos taurus [bovine]
gb|ADT71645.1|  proliferation associated 2G4                            102   7e-22   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006179892.1|  PREDICTED: proliferation-associated protein 2G4    102   7e-22   Camelus ferus
ref|XP_002752647.1|  PREDICTED: proliferation-associated protein 2G4    102   7e-22   Callithrix jacchus [common marmoset]
ref|XP_002711114.1|  PREDICTED: proliferation-associated protein 2G4    102   7e-22   Oryctolagus cuniculus [domestic rabbit]
ref|XP_004093117.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    102   7e-22   Nomascus leucogenys [White-cheeked Gibbon]
gb|AAD00646.1|  erbB3 binding protein EBP1                              102   7e-22   Homo sapiens [man]
ref|XP_001504854.1|  PREDICTED: proliferation-associated protein ...    102   7e-22   
ref|XP_008846918.1|  PREDICTED: proliferation-associated protein 2G4    102   8e-22   
ref|XP_005335677.1|  PREDICTED: proliferation-associated protein 2G4    102   8e-22   Ictidomys tridecemlineatus
ref|NP_001271715.1|  uncharacterized protein LOC101867185               102   8e-22   Macaca fascicularis [crab eating macaque]
ref|XP_010348255.1|  PREDICTED: proliferation-associated protein 2G4    102   8e-22   Saimiri boliviensis boliviensis
ref|NP_006182.2|  proliferation-associated protein 2G4                  102   8e-22   Homo sapiens [man]
ref|NP_001004206.1|  proliferation-associated protein 2G4               102   8e-22   Rattus norvegicus [brown rat]
ref|XP_004274221.1|  PREDICTED: proliferation-associated protein 2G4    102   8e-22   
ref|XP_005799891.1|  PREDICTED: proliferation-associated protein ...    102   8e-22   Xiphophorus maculatus
ref|XP_004692692.1|  PREDICTED: proliferation-associated protein 2G4    102   8e-22   Condylura cristata
ref|XP_006165654.1|  PREDICTED: proliferation-associated protein 2G4    102   8e-22   Tupaia chinensis
ref|XP_011059200.1|  PREDICTED: proliferation-associated protein 2G4    102   8e-22   Acromyrmex echinatior
pdb|2Q8K|A  Chain A, The Crystal Structure Of Ebp1                      102   8e-22   Homo sapiens [man]
ref|XP_010643016.1|  PREDICTED: proliferation-associated protein 2G4    102   9e-22   Fukomys damarensis [Damara mole rat]
gb|AAB91536.1|  cell cycle protein p38-2G4 homolog                      102   9e-22   Homo sapiens [man]
ref|XP_004589712.1|  PREDICTED: proliferation-associated protein 2G4    102   9e-22   Ochotona princeps [southern American pika]
ref|XP_009179195.1|  PREDICTED: proliferation-associated protein 2G4    102   9e-22   
ref|NP_001085830.1|  ErbB3-binding protein 1                            102   9e-22   Xenopus laevis [clawed frog]
ref|XP_004379999.1|  PREDICTED: proliferation-associated protein 2G4    102   9e-22   Trichechus manatus latirostris
ref|XP_003476243.1|  PREDICTED: proliferation-associated protein 2G4    102   9e-22   Cavia porcellus [guinea pig]
ref|XP_003405168.1|  PREDICTED: proliferation-associated protein 2G4    102   9e-22   Loxodonta africana [African bush elephant]
ref|XP_008939686.1|  PREDICTED: proliferation-associated protein 2G4    100   9e-22   Merops nubicus
ref|NP_001008439.1|  ErbB3-binding protein 1                            102   9e-22   Xenopus tropicalis [western clawed frog]
emb|CAJ82581.1|  proliferation-associated 2G4                           102   9e-22   Xenopus tropicalis [western clawed frog]
gb|EHB06549.1|  Proliferation-associated protein 2G4                    102   1e-21   Heterocephalus glaber [naked mole rat]
ref|XP_005397344.1|  PREDICTED: proliferation-associated protein 2G4    102   1e-21   Chinchilla lanigera
ref|XP_005371237.1|  PREDICTED: proliferation-associated protein 2G4    102   1e-21   Microtus ochrogaster [prairie voles]
ref|XP_004649070.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    102   1e-21   Octodon degus
ref|XP_004890349.1|  PREDICTED: proliferation-associated protein 2G4    102   1e-21   
ref|XP_011409574.1|  PREDICTED: proliferation-associated protein ...    101   1e-21   
ref|XP_002605416.1|  hypothetical protein BRAFLDRAFT_278505             102   1e-21   Branchiostoma floridae
gb|KFQ91587.1|  Proliferation-associated protein 2G4                    101   1e-21   Nipponia nippon
ref|XP_009468808.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    101   1e-21   Nipponia nippon
ref|XP_004006644.1|  PREDICTED: proliferation-associated protein 2G4    101   1e-21   
ref|XP_002163189.2|  PREDICTED: proliferation-associated protein ...    102   1e-21   Hydra vulgaris
ref|XP_003506238.1|  PREDICTED: proliferation-associated protein 2G4    101   1e-21   Cricetulus griseus [Chinese hamsters]
ref|XP_011400941.1|  Proliferation-associated protein A                 101   1e-21   Auxenochlorella protothecoides
ref|XP_008641741.1|  PREDICTED: proliferation-associated protein 2G4    101   1e-21   Corvus brachyrhynchos
ref|XP_006629280.1|  PREDICTED: proliferation-associated protein ...    101   2e-21   Lepisosteus oculatus
ref|XP_005431428.1|  PREDICTED: proliferation-associated protein ...    101   2e-21   Geospiza fortis
ref|XP_004601656.1|  PREDICTED: proliferation-associated protein 2G4    101   2e-21   Sorex araneus [Eurasian shrew]
gb|AAH19222.1|  PA2G4 protein                                           101   2e-21   Homo sapiens [man]
gb|KFQ30813.1|  Proliferation-associated protein 2G4                  99.8    2e-21   Merops nubicus
ref|XP_007953297.1|  PREDICTED: proliferation-associated protein 2G4    101   2e-21   Orycteropus afer afer
ref|NP_001083993.1|  proliferation-associated 2G4, 38kD                 101   2e-21   Xenopus laevis [clawed frog]
ref|XP_004700624.1|  PREDICTED: proliferation-associated protein 2G4    101   2e-21   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005533908.1|  PREDICTED: proliferation-associated protein 2G4    101   2e-21   Pseudopodoces humilis [Tibetan ground-jay]
gb|KDR23244.1|  Proliferation-associated protein 2G4                    101   2e-21   Zootermopsis nevadensis
ref|XP_006987432.1|  PREDICTED: proliferation-associated protein 2G4    101   2e-21   
gb|EWM29247.1|  proliferation-associated protein 2g4                    103   2e-21   Nannochloropsis gaditana
ref|XP_006815930.1|  PREDICTED: proliferation-associated protein ...    100   2e-21   Saccoglossus kowalevskii
ref|XP_002734317.1|  PREDICTED: proliferation-associated protein ...    101   2e-21   Saccoglossus kowalevskii
ref|XP_780193.1|  PREDICTED: proliferation-associated protein 2G4...    101   2e-21   Strongylocentrotus purpuratus [purple urchin]
gb|AAH44287.1|  Pa2g4 protein                                           101   2e-21   Xenopus laevis [clawed frog]
ref|XP_004085494.1|  PREDICTED: proliferation-associated protein ...    100   2e-21   Oryzias latipes [Japanese rice fish]
gb|ETE68956.1|  Proliferation-associated protein 2G4                    100   3e-21   Ophiophagus hannah
ref|XP_007533407.1|  PREDICTED: proliferation-associated protein 2G4    100   3e-21   Erinaceus europaeus [common hedgehog]
ref|XP_003223249.1|  PREDICTED: proliferation-associated protein 2G4    100   3e-21   Anolis carolinensis [Carolina anole]
ref|XP_001363571.1|  PREDICTED: proliferation-associated protein 2G4    100   3e-21   Monodelphis domestica
ref|XP_003703942.1|  PREDICTED: proliferation-associated protein ...    100   3e-21   Megachile rotundata
gb|KGL81710.1|  Proliferation-associated protein 2G4                    100   3e-21   Tinamus guttatus
gb|KFP70431.1|  Proliferation-associated protein 2G4                  99.4    3e-21   Acanthisitta chloris
ref|XP_009073732.1|  PREDICTED: proliferation-associated protein 2G4  99.4    3e-21   Acanthisitta chloris
ref|XP_006859475.1|  PREDICTED: proliferation-associated protein 2G4    100   4e-21   Chrysochloris asiatica
ref|XP_010219357.1|  PREDICTED: proliferation-associated protein 2G4    100   4e-21   Tinamus guttatus
gb|KFP07640.1|  Proliferation-associated protein 2G4                    100   4e-21   Calypte anna
ref|XP_009557265.1|  PREDICTED: proliferation-associated protein 2G4    100   4e-21   Cuculus canorus
ref|XP_009882846.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    100   4e-21   Charadrius vociferus
gb|KFQ63630.1|  Proliferation-associated protein 2G4                    100   4e-21   Pelecanus crispus
gb|KGL92866.1|  Proliferation-associated protein 2G4                    100   4e-21   Charadrius vociferus
ref|XP_423059.4|  PREDICTED: proliferation-associated protein 2G4       100   4e-21   
ref|XP_008500839.1|  PREDICTED: proliferation-associated protein 2G4    100   4e-21   Calypte anna
ref|XP_009921703.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    100   4e-21   Haliaeetus albicilla
ref|XP_009586223.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    100   4e-21   Fulmarus glacialis
gb|KFV87572.1|  Proliferation-associated protein 2G4                    100   4e-21   Struthio camelus australis
ref|XP_009278316.1|  PREDICTED: proliferation-associated protein 2G4    100   4e-21   Aptenodytes forsteri
gb|KFP09829.1|  Proliferation-associated protein 2G4                    100   4e-21   Egretta garzetta
ref|XP_009685364.1|  PREDICTED: proliferation-associated protein 2G4    100   4e-21   Struthio camelus australis
gb|KFM08039.1|  Proliferation-associated protein 2G4                    100   4e-21   Aptenodytes forsteri
ref|XP_005235817.1|  PREDICTED: proliferation-associated protein 2G4    100   4e-21   Falco peregrinus [peregrine]
gb|KFR05935.1|  Proliferation-associated protein 2G4                    100   4e-21   Opisthocomus hoazin [hoatzin]
ref|XP_010282642.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    100   4e-21   Phaethon lepturus
ref|XP_009701955.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    100   4e-21   Cariama cristata
ref|XP_009485967.1|  PREDICTED: proliferation-associated protein 2G4  99.8    4e-21   Pelecanus crispus
gb|KFO08279.1|  Proliferation-associated protein 2G4                    100   4e-21   Balearica regulorum gibbericeps
gb|KFV11001.1|  Proliferation-associated protein 2G4                    100   4e-21   Pterocles gutturalis
ref|XP_010725225.1|  PREDICTED: proliferation-associated protein 2G4  99.8    4e-21   Meleagris gallopavo [common turkey]
ref|XP_005499208.1|  PREDICTED: proliferation-associated protein 2G4  99.8    5e-21   
ref|XP_005031270.1|  PREDICTED: proliferation-associated protein 2G4  99.8    5e-21   
ref|XP_008472310.1|  PREDICTED: proliferation-associated protein 2G4    100   5e-21   Diaphorina citri
gb|EHH20847.1|  Cell cycle protein p38-2G4-like protein                 100   5e-21   Macaca mulatta [rhesus macaque]
ref|XP_007064970.1|  PREDICTED: proliferation-associated protein 2G4  99.8    5e-21   
ref|XP_011502791.1|  PREDICTED: proliferation-associated protein 2G4    100   5e-21   Ceratosolen solmsi marchali
gb|KFV99294.1|  Proliferation-associated protein 2G4                  99.8    5e-21   Fulmarus glacialis
gb|KFP66746.1|  Proliferation-associated protein 2G4                  99.8    5e-21   
gb|KFO74722.1|  Proliferation-associated protein 2G4                  99.4    5e-21   
ref|XP_006011099.1|  PREDICTED: proliferation-associated protein ...    100   5e-21   
ref|XP_009929445.1|  PREDICTED: proliferation-associated protein 2G4  99.8    5e-21   
ref|XP_005741395.1|  PREDICTED: proliferation-associated protein ...    100   5e-21   
gb|EHJ70953.1|  hypothetical protein KGM_14785                        99.8    6e-21   
ref|XP_006897700.1|  PREDICTED: proliferation-associated protein 2G4  99.8    6e-21   
ref|XP_006131250.1|  PREDICTED: proliferation-associated protein 2G4  99.8    6e-21   
ref|XP_004544946.1|  PREDICTED: proliferation-associated protein ...    100   6e-21   
ref|XP_010183489.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  98.6    6e-21   
ref|XP_006807648.1|  PREDICTED: proliferation-associated protein ...  99.8    6e-21   
ref|XP_005311138.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  99.8    7e-21   
gb|EFX72560.1|  hypothetical protein DAPPUDRAFT_308181                99.8    7e-21   
ref|XP_011154366.1|  PREDICTED: proliferation-associated protein 2G4  99.8    7e-21   
ref|XP_005079873.1|  PREDICTED: receptor tyrosine-protein kinase ...    102   8e-21   
pdb|2V6C|A  Chain A, Crystal Structure Of Erbb3 Binding Protein 1...  99.4    8e-21   
gb|KFO54080.1|  Proliferation-associated protein 2G4                  99.0    9e-21   
ref|XP_008877833.1|  DNA-binding protein, 42 kDa                      99.4    9e-21   
ref|XP_008066667.1|  PREDICTED: proliferation-associated protein 2G4  99.4    9e-21   
ref|XP_004931156.1|  PREDICTED: proliferation-associated protein ...  99.0    1e-20   
ref|XP_003383390.1|  PREDICTED: proliferation-associated protein ...  99.4    1e-20   
ref|XP_011408355.1|  PREDICTED: proliferation-associated protein ...  98.2    1e-20   
gb|KFQ36395.1|  Proliferation-associated protein 2G4                  97.4    1e-20   
ref|XP_009996179.1|  PREDICTED: proliferation-associated protein 2G4  98.6    1e-20   
ref|XP_005061405.1|  PREDICTED: proliferation-associated protein 2G4  99.4    1e-20   
gb|KFU89768.1|  Proliferation-associated protein 2G4                  98.6    1e-20   
ref|XP_007423593.1|  PREDICTED: proliferation-associated protein 2G4  98.6    1e-20   
ref|XP_009839077.1|  DNA-binding protein, 42 kDa                      98.6    1e-20   
ref|XP_001647519.1|  predicted protein                                98.6    2e-20   
ref|NP_001002070.1|  proliferation-associated 2G4, a                  98.6    2e-20   
ref|XP_009641743.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  99.4    2e-20   
ref|XP_009983110.1|  PREDICTED: proliferation-associated protein 2G4  98.2    2e-20   
gb|ACN60176.1|  Proliferation-associated protein 2G4                  95.5    2e-20   
gb|EOA93068.1|  Proliferation-associated protein 2G4                  98.2    2e-20   
gb|KFV16945.1|  Proliferation-associated protein 2G4                  98.2    2e-20   
ref|XP_003772221.1|  PREDICTED: proliferation-associated protein 2G4  99.0    2e-20   
gb|AFW79940.1|  hypothetical protein ZEAMMB73_092884                  94.0    2e-20   
ref|XP_010747198.1|  PREDICTED: proliferation-associated protein 2G4  98.2    2e-20   
ref|XP_001113953.2|  PREDICTED: receptor tyrosine-protein kinase ...    101   2e-20   
ref|XP_011306002.1|  PREDICTED: proliferation-associated protein 2G4  98.2    3e-20   
ref|NP_001124717.1|  proliferation-associated protein 2G4             98.2    3e-20   
ref|XP_007559711.1|  PREDICTED: proliferation-associated protein 2G4  97.8    3e-20   
ref|XP_008408124.1|  PREDICTED: proliferation-associated protein 2G4  97.8    3e-20   
gb|EQB77766.1|  hypothetical protein CB1_000449019                      100   3e-20   
gb|KFO24578.1|  Proliferation-associated protein 2G4                    100   3e-20   
gb|ELK15270.1|  Proliferation-associated protein 2G4                    100   3e-20   
ref|XP_003963121.1|  PREDICTED: proliferation-associated protein ...  97.8    3e-20   
gb|AAC34392.1|  PAS1                                                  97.8    3e-20   
ref|XP_008294311.1|  PREDICTED: proliferation-associated protein 2G4  97.8    4e-20   
ref|XP_003441515.1|  PREDICTED: proliferation-associated protein ...  97.4    4e-20   
gb|AFM86347.1|  proliferation-associated 2G4                          97.1    4e-20   
gb|AFM85909.1|  proliferation-associated 2G4                          97.1    5e-20   
ref|XP_006035312.1|  PREDICTED: proliferation-associated protein 2G4  97.4    5e-20   
ref|XP_006267753.1|  PREDICTED: proliferation-associated protein 2G4  97.1    5e-20   
ref|XP_008279469.1|  PREDICTED: proliferation-associated protein ...  97.1    6e-20   
ref|NP_997806.1|  proliferation-associated 2G4-like                   97.1    6e-20   
ref|XP_007508742.1|  predicted protein                                97.1    6e-20   
ref|XP_002423336.1|  Proliferation-associated protein 2G4, putative   97.1    6e-20   
ref|NP_001279838.1|  proliferation-associated 2G4, 38kDa              97.1    7e-20   
gb|ACO12262.1|  Proliferation-associated protein 2G4                  97.1    7e-20   
ref|XP_009041985.1|  hypothetical protein AURANDRAFT_55591            96.7    8e-20   
ref|XP_003790559.1|  PREDICTED: receptor tyrosine-protein kinase ...  99.4    9e-20   
emb|CDQ74715.1|  unnamed protein product                              96.3    1e-19   
ref|XP_009039553.1|  hypothetical protein AURANDRAFT_54512            95.9    1e-19   
ref|XP_008549132.1|  PREDICTED: proliferation-associated protein 2G4  95.9    1e-19   
ref|XP_008317097.1|  PREDICTED: proliferation-associated protein ...  95.9    2e-19   
ref|XP_002116398.1|  hypothetical protein TRIADDRAFT_64279            95.5    2e-19   
ref|XP_006615964.1|  PREDICTED: proliferation-associated protein ...  95.5    2e-19   
ref|XP_003689614.1|  PREDICTED: proliferation-associated protein ...  95.5    2e-19   
ref|XP_006560659.1|  PREDICTED: proliferation-associated protein ...  95.5    2e-19   
ref|XP_010764812.1|  PREDICTED: proliferation-associated protein 2G4  95.5    2e-19   
ref|XP_001602273.2|  PREDICTED: proliferation-associated protein ...  94.0    2e-19   
ref|XP_007253393.1|  PREDICTED: proliferation-associated protein ...  95.5    2e-19   
gb|EPY82330.1|  hypothetical protein CB1_000661020                    91.3    3e-19   
ref|XP_003485618.1|  PREDICTED: proliferation-associated protein ...  94.7    3e-19   
ref|XP_003394756.1|  PREDICTED: proliferation-associated protein ...  94.7    3e-19   
ref|XP_010865536.1|  PREDICTED: proliferation-associated protein ...  94.7    4e-19   
gb|ACI33868.1|  Proliferation-associated protein 2G4                  94.7    4e-19   
dbj|BAM19228.1|  proliferation-associated 2g4                         94.4    4e-19   
ref|XP_004466155.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  94.7    4e-19   
gb|EMP31026.1|  Proliferation-associated protein 2G4                  96.7    4e-19   
ref|XP_008411912.1|  PREDICTED: proliferation-associated protein ...  94.0    7e-19   
ref|XP_969584.1|  PREDICTED: proliferation-associated protein 2G4     94.0    7e-19   
gb|ACI33074.1|  Proliferation-associated protein 2G4                  94.0    7e-19   
emb|CDQ85755.1|  unnamed protein product                              94.0    7e-19   
ref|XP_007556640.1|  PREDICTED: proliferation-associated protein ...  94.0    7e-19   
ref|XP_005801435.1|  PREDICTED: proliferation-associated protein ...  94.0    8e-19   
ref|XP_009011773.1|  hypothetical protein HELRODRAFT_156370           94.0    8e-19   
gb|ADX97052.1|  proliferation-associated protein 2g4                  94.0    8e-19   
ref|WP_028832180.1|  hypothetical protein                             94.0    8e-19   
ref|XP_010879916.1|  PREDICTED: proliferation-associated protein ...  93.6    9e-19   
ref|XP_003973252.1|  PREDICTED: proliferation-associated protein ...  93.6    1e-18   
ref|XP_005826372.1|  hypothetical protein GUITHDRAFT_96731            93.2    1e-18   
ref|XP_003448224.1|  PREDICTED: proliferation-associated protein ...  93.2    1e-18   
ref|XP_007656709.1|  PREDICTED: proliferation-associated protein 2G4  91.3    1e-18   
emb|CDQ89185.1|  unnamed protein product                              93.2    1e-18   
ref|XP_004558839.1|  PREDICTED: proliferation-associated protein ...  93.2    1e-18   
gb|ACO10060.1|  Proliferation-associated protein 2G4                  93.2    1e-18   
gb|ELT99251.1|  hypothetical protein CAPTEDRAFT_152656                92.8    2e-18   
ref|XP_011419861.1|  PREDICTED: proliferation-associated protein ...  92.8    2e-18   
ref|XP_010782747.1|  PREDICTED: proliferation-associated protein ...  92.8    2e-18   
ref|XP_010745944.1|  PREDICTED: proliferation-associated protein ...  92.8    2e-18   
gb|AAV36985.2|  LD30448p                                              92.4    2e-18   
ref|XP_004070502.1|  PREDICTED: proliferation-associated protein ...  92.4    2e-18   
emb|CAG06775.1|  unnamed protein product                              92.4    2e-18   
ref|NP_647984.1|  CG10576, isoform A                                  92.4    3e-18   
ref|XP_002007862.1|  GI13173                                          92.4    3e-18   
ref|XP_002047403.1|  GJ11948                                          92.4    3e-18   
emb|CBK24689.2|  unnamed protein product                              92.0    3e-18   
ref|XP_004525166.1|  PREDICTED: proliferation-associated protein ...  92.0    4e-18   
gb|EJK49958.1|  hypothetical protein THAOC_31113                      92.8    4e-18   
ref|XP_009512308.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  90.9    4e-18   
ref|XP_001984453.1|  GH15010                                          91.7    4e-18   
emb|CCI48095.1|  unnamed protein product                              91.7    4e-18   
ref|XP_011209005.1|  PREDICTED: proliferation-associated protein 2G4  91.7    5e-18   
dbj|BAJ87032.1|  predicted protein                                    91.7    5e-18   
emb|CBJ31951.1|  conserved unknown protein                            91.3    7e-18   
gb|EHH65552.1|  hypothetical protein EGM_02333                        90.5    7e-18   
gb|EFX83198.1|  hypothetical protein DAPPUDRAFT_48538                 87.4    7e-18   
ref|XP_002290444.1|  DNA-binding protein                              90.1    9e-18   
emb|CCA18784.1|  proliferationassociated protein putative             90.5    1e-17   
ref|XP_001951269.1|  PREDICTED: proliferation-associated protein 2G4  90.9    1e-17   
ref|XP_001972015.1|  GG14116                                          90.5    1e-17   
ref|XP_005095772.1|  PREDICTED: proliferation-associated protein ...  90.5    1e-17   
gb|EHH19926.1|  hypothetical protein EGK_02674                        90.1    1e-17   
ref|XP_002093823.1|  GE20541                                          90.1    1e-17   
ref|XP_002035467.1|  GM13901                                          90.1    1e-17   
ref|XP_002083760.1|  GD13178                                          90.1    1e-17   
ref|XP_003741970.1|  PREDICTED: proliferation-associated protein ...  89.7    2e-17   
ref|XP_002868588.1|  predicted protein                                87.0    2e-17   
gb|EJK55571.1|  hypothetical protein THAOC_24688                      85.9    2e-17   
ref|XP_011180648.1|  PREDICTED: proliferation-associated protein 2G4  89.7    2e-17   
ref|XP_004148633.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...  88.6    2e-17   
tpg|DAA34047.1|  TPA: metallopeptidase                                89.4    2e-17   
gb|ACN41199.1|  unknown                                               84.3    3e-17   
ref|XP_005769829.1|  proliferation-associated protein 2G4             89.7    4e-17   
gb|KDD75813.1|  hypothetical protein H632_c489p2                      88.6    4e-17   
gb|EFX83265.1|  hypothetical protein DAPPUDRAFT_315717                88.6    5e-17   
ref|XP_005793747.1|  proliferation-associated protein 2G4             88.2    7e-17   
ref|XP_003880798.1|  methionine aminopeptidase,related                88.2    8e-17   
gb|KFH72903.1|  hypothetical protein MVEG_00128                       88.2    9e-17   
ref|XP_002028721.1|  GL24799                                          87.0    9e-17   
ref|XP_001913309.1|  proliferation-associated protein 1               87.8    9e-17   
ref|XP_001957516.1|  GF10449                                          87.8    1e-16   
ref|XP_002062021.1|  GK16873                                          87.8    1e-16   
gb|EFX84381.1|  hypothetical protein DAPPUDRAFT_24528                 86.3    1e-16   
ref|XP_001353865.1|  GA10407                                          87.4    1e-16   
gb|EFX62733.1|  hypothetical protein DAPPUDRAFT_67763                 87.4    2e-16   
ref|XP_005184671.1|  PREDICTED: proliferation-associated protein 2G4  87.0    2e-16   
emb|CDQ78322.1|  unnamed protein product                              87.0    3e-16   
gb|EJW72899.1|  hypothetical protein WUBG_16193                       83.2    3e-16   
gb|EFX84375.1|  hypothetical protein DAPPUDRAFT_46898                 86.7    3e-16   
gb|AEE62360.1|  unknown                                               86.3    4e-16   
gb|ENN76413.1|  hypothetical protein YQE_07074                        86.3    4e-16   
ref|XP_001865752.1|  proliferation-associated 2g4                     86.3    5e-16   
ref|XP_002371979.1|  proliferation-associated protein 2G4, putative   86.7    5e-16   
gb|EPR57248.1|  putative proliferation-associated protein 2G4         86.7    5e-16   
ref|XP_009052849.1|  hypothetical protein LOTGIDRAFT_115903           85.5    6e-16   
ref|XP_008887722.1|  proliferation-associated protein 2G4, putative   86.3    6e-16   
gb|ERG85130.1|  proliferation-associated protein 2g4                  85.1    1e-15   
ref|XP_001894006.1|  DNA-binding protein, 42 kDa containing protein   84.7    2e-15   
emb|CCD59701.1|  proliferation-associated protein 2G4, 38kDa (M24...  83.2    2e-15   
dbj|GAA35285.2|  metalloprotease ARX1                                 83.6    2e-15   
ref|XP_001688498.1|  AGAP005108-PB                                    83.6    3e-15   
ref|XP_005680429.1|  PREDICTED: proliferation-associated protein ...  82.8    3e-15   
gb|EDL84837.1|  proliferation-associated 2G4, isoform CRA_b           82.8    3e-15   
ref|XP_002182273.1|  predicted protein                                83.6    4e-15   
ref|XP_009161956.1|  hypothetical protein T265_00035                  83.2    4e-15   
gb|ERL94099.1|  hypothetical protein D910_11381                       85.1    4e-15   
emb|CCD59700.1|  proliferation-associated protein 2G4, 38kDa (M24...  83.2    4e-15   
ref|XP_313985.4|  AGAP005108-PA                                       83.2    5e-15   
ref|NP_500311.1|  Protein W08E12.7                                    82.4    8e-15   
ref|XP_002324717.2|  hypothetical protein POPTR_0018s07240g           79.7    8e-15   
ref|XP_002128302.1|  PREDICTED: proliferation-associated protein 2G4  82.4    9e-15   
gb|ETO19191.1|  hypothetical protein RFI_18041                        80.9    1e-14   
ref|XP_666677.1|  nuclear DNA-binding protein G2p -related            82.0    1e-14   
gb|EPQ14145.1|  Proliferation-associated protein 2G4                  79.3    1e-14   
ref|XP_626802.1|  proliferation-associated protein 2G4 metallopro...  81.6    1e-14   
emb|CAP22983.2|  Protein CBG01630                                     81.3    2e-14   
ref|XP_003143613.1|  DNA-binding protein                              82.0    2e-14   
ref|XP_005705833.1|  DNA binding protein                              81.6    2e-14   
ref|XP_002634084.1|  Hypothetical protein CBG01630                    81.3    2e-14   
ref|XP_002634083.1|  Hypothetical protein CBG01629                    80.9    3e-14   
emb|CAX83116.1|  Proliferation-associated protein 2G4                 80.5    3e-14   
gb|EGT53148.1|  hypothetical protein CAEBREN_04692                    80.9    3e-14   
gb|EGT46940.1|  hypothetical protein CAEBREN_29895                    80.9    3e-14   
gb|AAX27414.2|  SJCHGC05984 protein                                   80.5    3e-14   
emb|CAX74794.1|  Proliferation-associated protein 2G4                 80.5    3e-14   
ref|XP_003108289.1|  hypothetical protein CRE_10205                   80.9    3e-14   
emb|CDJ02959.1|  Proliferation associated protein 2G4                 80.5    3e-14   
emb|CDS15413.1|  Proliferation associated protein 2G4                 80.5    3e-14   
emb|CEF70564.1|  Proliferation-associated protein 2G4                 80.5    4e-14   
gb|ETN66740.1|  proliferation-associated 2g4                          80.9    4e-14   
emb|CCF73397.1|  unnamed protein product                              80.1    5e-14   
ref|XP_005853761.1|  proliferation-associated protein 2g4             79.7    7e-14   
gb|EUB65031.1|  Proliferation-associated protein 2G4                  79.7    7e-14   
ref|XP_001662411.1|  AAEL012312-PA                                    80.1    8e-14   
gb|KHN80833.1|  Proliferation-associated protein 2G4                  80.1    9e-14   
ref|XP_954371.1|  proliferation-associated protein 2g4                79.7    9e-14   
ref|XP_007873749.1|  hypothetical protein PNEG_01781                  79.3    9e-14   
ref|XP_002171665.1|  curved DNA-binding protein Cdb4                  79.3    1e-13   
gb|AFX73011.1|  Proliferation-associated protein 2G4                  79.3    1e-13   
gb|EYC11494.1|  hypothetical protein Y032_0050g1942                   79.3    1e-13   
emb|CDW52768.1|  proliferation associated protein 2g4                 79.3    1e-13   
ref|XP_765891.1|  proliferation-associated protein 2g4                78.6    2e-13   
gb|KFB44440.1|  AGAP005108-PA-like protein                            79.0    2e-13   
ref|XP_001010313.1|  metallopeptidase family M24 containing protein   78.2    2e-13   
gb|ETN87016.1|  DNA-binding protein                                   78.6    2e-13   
ref|XP_005710371.1|  unnamed protein product                          78.2    2e-13   
ref|XP_003370229.1|  proliferation-associated protein 2G4             78.2    3e-13   
gb|EFA84439.1|  proliferation associated protein                      77.8    3e-13   
ref|XP_005537086.1|  probable DNA binding protein                     78.2    3e-13   
gb|KFH67450.1|  hypothetical protein MVEG_06182                       77.8    3e-13   
gb|KHJ46298.1|  DNA-binding protein                                   79.3    3e-13   
emb|CDS30134.1|  Proliferation associated protein 2G4                 77.8    3e-13   
gb|ACO15498.1|  Proliferation-associated protein 2G4                  77.0    4e-13   
ref|XP_002675553.1|  methionyl aminopeptidase                         77.4    4e-13   
emb|CDW84742.1|  proliferation-associated protein 2g4                 77.4    5e-13   
gb|KHJ89061.1|  putative DNA-binding protein                          76.3    7e-13   
gb|EGT51482.1|  hypothetical protein CAEBREN_28512                    77.0    8e-13   
gb|AGG11522.1|  hypothetical protein                                  76.6    8e-13   



>emb|CDP09213.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   197 bits (501),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 115/136 (85%), Positives = 125/136 (92%), Gaps = 1/136 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+H LQ+LN TK +D DPEIKAWL+LP KTKKKGGGKKKKGKKG+K 
Sbjct  317  FTVLLMPNGSDRITSHSLQELNPTKTVDSDPEIKAWLSLPIKTKKKGGGKKKKGKKGDKA  376

Query  380  eEAPQTEPTDEATNKS  333
            E++ QTEP DEA N +
Sbjct  377  EDSMQTEPVDEAANGA  392



>ref|XP_007026646.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
 gb|EOY07148.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
Length=393

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K SRFI+ EI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL TKTKKKGGGKKKKGKKG+K E
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLALGTKTKKKGGGKKKKGKKGDKAE  376

Query  377  EAPQTEPTDEATNKSKS  327
            E+ + EP DEATN + S
Sbjct  377  ESAEAEPMDEATNGATS  393



>ref|XP_010092793.1| Proliferation-associated protein 2G4 [Morus notabilis]
 gb|EXB52379.1| Proliferation-associated protein 2G4 [Morus notabilis]
Length=424

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  286  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  345

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+HPLQ+L  TK I+DPEIK+WLAL  KTKKKGGGKKKKGKKGEKTE
Sbjct  346  FTVLLMPNGSDRITSHPLQELQPTKIIEDPEIKSWLALGIKTKKKGGGKKKKGKKGEKTE  405

Query  377  EAPQTEPTDEATNKSKS  327
            ++ + EP D ATN ++S
Sbjct  406  DSTEAEPMDAATNGAES  422



>ref|XP_011095038.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 93/99 (94%), Gaps = 0/99 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALP  441
            FTVLLMPNGSDRIT HPLQ+L  TK +DDPEIKAWLALP
Sbjct  317  FTVLLMPNGSDRITTHPLQELQPTKTVDDPEIKAWLALP  355



>gb|AFK46635.1| unknown [Medicago truncatula]
Length=139

 Score =   182 bits (461),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGD VAHIK
Sbjct  2    KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKPGDFVAHIK  61

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  62   FTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  99



>ref|XP_011077533.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQDL  TK +DDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHPLQDLQPTKTVDDPEIKAWLAL  354



>ref|XP_008442393.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=396

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KASRFIFSEITQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQDL  TK IDDPEIKAWLAL
Sbjct  318  FTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLAL  355



>ref|XP_007205303.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_007205304.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_008243362.1| PREDICTED: proliferation-associated protein 2G4 [Prunus mume]
 gb|EMJ06502.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 gb|EMJ06503.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
Length=395

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI +KFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEIREKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+HPLQ+L  TK IDDPEIKAWLAL TKTKKKGGGKKKKGKK +K E
Sbjct  317  FTVLLMPNGSDRITSHPLQELQPTKQIDDPEIKAWLALGTKTKKKGGGKKKKGKKSDKAE  376

Query  377  EAPQTEPTDEATNKSKS  327
            E+ + EP D  TN ++S
Sbjct  377  ESTEAEPMDATTNGAES  393



>ref|XP_010937887.1| PREDICTED: proliferation-associated protein 2G4-like [Elaeis 
guineensis]
Length=397

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP++PFTAR L+EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  258  KASRFIFSEINQKFPILPFTARALDEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+HPLQ+L  TK IDD PEIKAWLAL TKTKKKGGGKKKKGKK E  
Sbjct  318  FTVLLMPNGSDRITSHPLQELKPTKSIDDNPEIKAWLALGTKTKKKGGGKKKKGKKAEAK  377

Query  380  eEAPQTEPTDEATNKSKS  327
            ++A + EP DEA+N + S
Sbjct  378  DDAVEAEPMDEASNDAAS  395



>gb|KDP22867.1| hypothetical protein JCGZ_00454 [Jatropha curcas]
Length=396

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 2/142 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+HPLQ+L  TK I+DPEIKAWLAL TKTKKKGGGKKKK KKG+K E
Sbjct  317  FTVLLMPNGSDRITSHPLQELQPTKTIEDPEIKAWLALGTKTKKKGGGKKKKAKKGDKAE  376

Query  377  EAPQTEPTDEATNKSKS*RNAS  312
            E+ + EP D ATN +++ +N S
Sbjct  377  ESTEAEPMD-ATNGAET-KNES  396



>gb|EPS71863.1| hypothetical protein M569_02886, partial [Genlisea aurea]
Length=369

 Score =   187 bits (475),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDL+AHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLLAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK +DDPEIKAWL+L
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQTTKTVDDPEIKAWLSL  354



>gb|EYU26681.1| hypothetical protein MIMGU_mgv1a007877mg [Erythranthe guttata]
Length=392

 Score =   187 bits (474),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T HPLQ+L  TK +DDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRVTTHPLQELQPTKTVDDPEIKAWLAL  354



>ref|XP_002530504.1| proliferation-associated 2g4, putative [Ricinus communis]
 gb|EEF31888.1| proliferation-associated 2g4, putative [Ricinus communis]
Length=394

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/98 (89%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD+VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDIVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_004137704.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
sativus]
 gb|KGN58739.1| EBP1 [Cucumis sativus]
Length=393

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KASRFIFSEITQKYPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQDL  TK IDDPEIKAWL+L
Sbjct  318  FTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLSL  355



>gb|AFK36627.1| unknown [Lotus japonicus]
Length=203

 Score =   181 bits (458),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  70   KASRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  129

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ+L  TK ++DPEIKAWLAL
Sbjct  130  FTVLLMPNGSDRITFHPLQELQTTKTVEDPEIKAWLAL  167



>ref|XP_004302550.1| PREDICTED: proliferation-associated protein 2G4 [Fragaria vesca 
subsp. vesca]
Length=395

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFPLMPFTAR LEEKRARLGL ECVNHDLLQPYPVLHEKPGD+VAHIK
Sbjct  258  KASRFIFSEITQKFPLMPFTARALEEKRARLGLFECVNHDLLQPYPVLHEKPGDIVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ+L  TK +DDPEIKAWLAL
Sbjct  318  FTVLLMPNGSDRITSHPLQELQPTKQVDDPEIKAWLAL  355



>ref|XP_004156612.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=395

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  260  KASRFIFSEITQKYPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  319

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQDL  TK IDDPEIKAWL+L
Sbjct  320  FTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLSL  357



>ref|XP_008792832.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Phoenix 
dactylifera]
Length=376

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  237  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  296

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWLAL TKTKKKGGGKKKKGKKGE  
Sbjct  297  FTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLALGTKTKKKGGGKKKKGKKGEAK  356

Query  380  eEAPQTEPTDEATNKSKS  327
            +++ + EP DEA+N + S
Sbjct  357  DDSAEAEPMDEASNGAPS  374



>ref|XP_010920808.1| PREDICTED: proliferation-associated protein 2G4 isoform X3 [Elaeis 
guineensis]
Length=397

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  258  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWL+L TKTKKKGGGKKKKGKKGE  
Sbjct  318  FTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLSLGTKTKKKGGGKKKKGKKGEAK  377

Query  380  eEAPQTEPTDEATNKSKS  327
            +++ + EP DEA+N + S
Sbjct  378  DDSAEAEPMDEASNGAAS  395



>ref|XP_008792800.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792807.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792815.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792823.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
Length=397

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  258  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWLAL TKTKKKGGGKKKKGKKGE  
Sbjct  318  FTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLALGTKTKKKGGGKKKKGKKGEAK  377

Query  380  eEAPQTEPTDEATNKSKS  327
            +++ + EP DEA+N + S
Sbjct  378  DDSAEAEPMDEASNGAPS  395



>gb|KHN20329.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=284

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  147  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDFVAHIK  206

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKAWLAL
Sbjct  207  FTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  244



>ref|XP_006344058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum tuberosum]
Length=390

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  441
            FTVLLMPNGSDRIT+H LQ+L + K I D+PEIK WLALP
Sbjct  317  FTVLLMPNGSDRITSHALQELTLAKTIEDEPEIKTWLALP  356



>ref|XP_006344057.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum tuberosum]
Length=391

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  441
            FTVLLMPNGSDRIT+H LQ+L + K I D+PEIK WLALP
Sbjct  317  FTVLLMPNGSDRITSHALQELTLAKTIEDEPEIKTWLALP  356



>gb|ACU22749.1| unknown [Glycine max]
Length=280

 Score =   182 bits (461),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  147  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDDVAHIK  206

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  207  FTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  244



>ref|XP_011019082.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FT+LLMPNGSDRIT+H LQ+L  +K IDDPEIKAWLAL TKTKKKGGGKKKK +K  +  
Sbjct  318  FTLLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLALGTKTKKKGGGKKKKARKSGEKA  377

Query  377  EAPQTEPTDEATN  339
            E+ + EP D +TN
Sbjct  378  ESTEAEPMDASTN  390



>ref|XP_003529167.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=394

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/98 (88%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKAWLAL
Sbjct  317  FTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_009599246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPVMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT H LQ+L  TK +D +PEIK WLALP KTKKKGGGKKKK KKGEKT
Sbjct  317  FTVLLMPNGSDRITTHALQELKPTKTVDEEPEIKTWLALPVKTKKKGGGKKKKAKKGEKT  376

Query  380  eEAPQTEPTDEATNKSKS  327
            E++ Q EP +  +N ++S
Sbjct  377  EDSSQAEPMEGESNGAES  394



>ref|XP_010676777.1| PREDICTED: proliferation-associated protein 2G4 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   184 bits (467),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEINQKYPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDR+T+HPLQ+L  TK I+DPEIKAWLAL TKTKKKGGGKKKKGK     E
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIEDPEIKAWLALGTKTKKKGGGKKKKGKNKSGAE  376

Query  377  EAPQTEPTDEATNKSKS  327
            E+ + EP  E +N + +
Sbjct  377  ESAEAEPMAETSNGATA  393



>ref|XP_010040429.1| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Eucalyptus grandis]
Length=237

 Score =   179 bits (455),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP++PF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD  AHIK
Sbjct  102  KASRFIFSEINQKFPILPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYAAHIK  161

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL     K       K KKG+K  
Sbjct  162  FTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL---GTKTKKKGGGKKKKGKKGT  218

Query  377  EAPQTEPTDEATNKSKS  327
            E+ +TEP D  TN ++S
Sbjct  219  ESAETEPMDATTNGAES  235



>ref|XP_004240407.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum lycopersicum]
Length=390

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALP  441
            FT LLMPNGSDRIT+H LQ+L+  K IDD PEIK WLALP
Sbjct  317  FTALLMPNGSDRITSHALQELSPAKTIDDEPEIKTWLALP  356



>ref|XP_010321752.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum lycopersicum]
Length=391

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALP  441
            FT LLMPNGSDRIT+H LQ+L+  K IDD PEIK WLALP
Sbjct  317  FTALLMPNGSDRITSHALQELSPAKTIDDEPEIKTWLALP  356



>ref|XP_003623305.1| Proliferation-associated protein 2G4 [Medicago truncatula]
 gb|AES79523.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=394

 Score =   183 bits (465),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>gb|KHN39558.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=394

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LE+KRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEDKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKAWLAL
Sbjct  317  FTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_009789408.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=394

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPVMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT H LQ+L   K I D+PEIK WLALP K+KKKGGGKKKK KKGEKT
Sbjct  317  FTVLLMPNGSDRITTHTLQELKPAKTIEDEPEIKTWLALPVKSKKKGGGKKKKAKKGEKT  376

Query  380  eEAPQTEPTDEATNKSKS  327
            E++ Q EP +  +N ++S
Sbjct  377  EDSSQAEPMEGESNGAES  394



>ref|XP_002262986.2| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 ref|XP_010653323.1| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 emb|CBI18248.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK  DDPEIKAWLAL TKTKKKGGGKKKKGKKG+K E
Sbjct  317  FTVLLMPNGSDRITSHSLQELQPTKTTDDPEIKAWLALGTKTKKKGGGKKKKGKKGDKPE  376

Query  377  EAPQTEPTDEATN  339
            E+ + EP D  TN
Sbjct  377  ESAEAEPMDATTN  389



>ref|NP_001241588.1| uncharacterized protein LOC100781302 [Glycine max]
 gb|ACU19677.1| unknown [Glycine max]
Length=394

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKAWLAL
Sbjct  317  FTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_007140243.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
 gb|ESW12237.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
Length=392

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDP+IKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_009376423.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  317  FTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>ref|XP_006429434.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006429435.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006481067.1| PREDICTED: proliferation-associated protein 2G4-like [Citrus 
sinensis]
 gb|ESR42674.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 gb|ESR42675.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
Length=394

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ++  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHTLQEIQSTKTIDDPEIKAWLAL  354



>ref|XP_003516956.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=390

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDDVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_009376419.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376420.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  317  FTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>gb|KDO56711.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
 gb|KDO56712.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
Length=394

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ++  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHTLQEIQSTKTIDDPEIKAWLAL  354



>gb|KHN42848.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=390

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/98 (87%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDDVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_002308228.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|EEE91751.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=398

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGL+ECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  260  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLLECVNHDLLQPYPVLHEKPGDYVAHIK  319

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  +K IDDPEIKAWLAL TKTKKKGGGKKKK KK  +  
Sbjct  320  FTVLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLALGTKTKKKGGGKKKKAKKSGEKA  379

Query  377  EAPQTEPTDEATN  339
            E+ + EP D  TN
Sbjct  380  ESTEAEPMDATTN  392



>gb|ABK95017.1| unknown [Populus trichocarpa]
Length=396

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGL+ECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLLECVNHDLLQPYPVLHEKPGDYVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  +K IDDPEIKAWLAL TKTKKKGGGKKKK KK  +  
Sbjct  318  FTVLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLALGTKTKKKGGGKKKKAKKSGEKA  377

Query  377  EAPQTEPTDEATN  339
            E+ + EP D  TN
Sbjct  378  ESTEAEPMDATTN  390



>ref|XP_008366899.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=352

 Score =   181 bits (460),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKPGD VA IK
Sbjct  214  KASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKPGDFVARIK  273

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  274  FTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  311



>gb|KHN22549.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=327

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  194  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  253

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+H LQ+L  TK IDDPEIKAWLAL
Sbjct  254  FTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKAWLAL  291



>gb|KJB17053.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17054.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17055.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=393

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+Q+FP++PFTAR LEEKRARLGLVECVNHDLLQPYPVL+EKPGD VAHIK
Sbjct  257  KASRFIFSEINQRFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLYEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+HPLQ+L  TK IDDPEIKAWLAL TKTKKKGGGKKKKGKKG+K E
Sbjct  317  FTVLLMPNGSDRITSHPLQELQPTKTIDDPEIKAWLALGTKTKKKGGGKKKKGKKGDKAE  376

Query  377  EAPQTEPTDEATNKSKS  327
               + E  D +TN   S
Sbjct  377  GGAEGEAMDASTNGGAS  393



>ref|XP_008362268.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=394

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FT+LLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  317  FTILLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>gb|KHG25370.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=393

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+Q+FP++PFTAR LEEKRARLGLVECVNHDLLQPYPVL+EKPGD VAHIK
Sbjct  257  KASRFIFSEINQRFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLYEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+HPLQ+L  TK IDDPEIKAWLAL TKTKKKGGGKKKKGKKG+K E
Sbjct  317  FTVLLMPNGSDRITSHPLQELQPTKTIDDPEIKAWLALGTKTKKKGGGKKKKGKKGDKAE  376

Query  377  EAPQTEPTDEATNKSKS  327
               + E  D +TN   S
Sbjct  377  GGAEGEAMDASTNGGAS  393



>gb|KEH38647.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=391

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFIY EISQ FP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIYSEISQNFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ++  TK +DDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHPLQEIQPTKTVDDPEIKAWLAL  354



>ref|XP_008805004.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
 ref|XP_008805005.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=396

 Score =   182 bits (461),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 118/134 (88%), Gaps = 1/134 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+HPLQ L  TK ID DPEIKAWL+L TKTKKKGGGKKKKGKKG   
Sbjct  317  FTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLSLGTKTKKKGGGKKKKGKKGGAR  376

Query  380  eEAPQTEPTDEATN  339
            ++  +TEP D  +N
Sbjct  377  DDTAETEPMDATSN  390



>ref|XP_002322994.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
 gb|EEF04755.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
Length=375

 Score =   181 bits (460),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDCVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL
Sbjct  318  FTVLLMPNGSDRITSHALQELQPTKTIDDPEIKAWLAL  355



>gb|ACJ85304.1| unknown [Medicago truncatula]
 gb|AFK40979.1| unknown [Medicago truncatula]
Length=394

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 121/137 (88%), Gaps = 1/137 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKR RLGLVEC+NH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRVRLGLVECMNHELLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL TKTKKKGGGKKKKGK+ +K +
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLALGTKTKKKGGGKKKKGKEEDKAD  376

Query  377  EAPQTEPTDEATNKSKS  327
            E  + EP D +TN++ S
Sbjct  377  ETAEAEPVD-STNEATS  392



>ref|XP_008789134.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=397

 Score =   182 bits (461),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 93/99 (94%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  258  KASRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ+L  T+ IDD PEIKAWLAL
Sbjct  318  FTVLLMPNGSDRITSHPLQELKPTRSIDDNPEIKAWLAL  356



>gb|KCW45226.1| hypothetical protein EUGRSUZ_L01140 [Eucalyptus grandis]
Length=325

 Score =   179 bits (455),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP++PF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD  AHIK
Sbjct  190  KASRFIFSEINQKFPILPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYAAHIK  249

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL     K       K KKG+K  
Sbjct  250  FTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLALG---TKTKKKGGGKKKKGKKGT  306

Query  377  EAPQTEPTDEATNKSKS  327
            E+ +TEP D  TN ++S
Sbjct  307  ESAETEPMDATTNGAES  323



>ref|XP_006576221.1| PREDICTED: uncharacterized protein LOC100784176 isoform X1 [Glycine 
max]
Length=390

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+H LQ+L  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_009599304.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009599305.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=387

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/100 (86%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  441
            FTVLLMPNGSDRIT+H LQ+L   K I ++PEIKAWLALP
Sbjct  317  FTVLLMPNGSDRITSHALQELKPAKTIENEPEIKAWLALP  356



>ref|XP_007140242.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
 gb|ESW12236.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
Length=394

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ +ISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSDISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK IDDP+IKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKAIDDPDIKAWLAL  354



>gb|ABK24337.1| unknown [Picea sitchensis]
Length=394

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASR I+ EI+QKFP+MPFTAR LE+KRARLGLVECVNH+LLQPYPVLHEKPG+LVAHIK
Sbjct  258  KASRLIFTEINQKFPIMPFTARALEDKRARLGLVECVNHELLQPYPVLHEKPGELVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSD+IT HPLQ+LN TK IDDPEIK WLAL
Sbjct  318  FTVLLMPNGSDKITGHPLQELNPTKAIDDPEIKTWLAL  355



>ref|XP_004242516.1| PREDICTED: proliferation-associated protein 2G4-like [Solanum 
lycopersicum]
Length=387

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/100 (85%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  441
            FTVLLMPNGSDR+T+H LQ+L  TK   ++PEIKAWLALP
Sbjct  317  FTVLLMPNGSDRVTSHSLQELQPTKSTENEPEIKAWLALP  356



>ref|XP_008388269.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Malus domestica]
Length=395

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKPGD VA IK
Sbjct  257  KASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKPGDFVARIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  317  FTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>gb|AAF91445.1|AF281652_1 putative DNA binding protein [Atriplex hortensis]
Length=397

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 92/98 (94%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVL+EKPGD VAHIK
Sbjct  258  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLYEKPGDYVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T++P+Q+L  TK IDDPEIKAWLAL
Sbjct  318  FTVLLMPNGSDRVTSYPVQELQPTKSIDDPEIKAWLAL  355



>gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus]
 gb|ABQ23586.1| EBP1 [Ammopiptanthus mongolicus]
Length=395

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQ FP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQNFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T++PLQ+L  TK IDDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSYPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_009402229.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402230.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  258  KSSRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+HPLQ L  +K IDD  EIKAW+AL TKTKKKGGGKKKKGKKG+  
Sbjct  318  FTVLLMPNGSDRITSHPLQQLLPSKMIDDNAEIKAWMALGTKTKKKGGGKKKKGKKGDAQ  377

Query  380  eEAPQTEPTDEATNKSKS  327
            ++A ++EP D A+N + +
Sbjct  378  DDAVESEPKDSASNSTAA  395



>ref|XP_011046861.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPF+AR LEEKRARLGLVEC+NHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECMNHDLLQPYPVLHEKPGDCVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL
Sbjct  318  FTVLLMPNGSDRITSHALQELQPTKTIDDPEIKAWLAL  355



>ref|XP_010650887.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Vitis 
vinifera]
Length=384

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ+L  TK ID DPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHPLQELRPTKTIDNDPEIKAWLAL  355



>gb|KJB36949.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=291

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K SRFI+ EI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  156  KTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  215

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ L  TK IDDPEIK WLAL
Sbjct  216  FTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  253



>ref|XP_002278744.2| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Vitis 
vinifera]
 emb|CBI15928.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/99 (87%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ+L  TK ID DPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHPLQELRPTKTIDNDPEIKAWLAL  355



>ref|XP_010264591.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 121/138 (88%), Gaps = 1/138 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+H LQ+L  TK I DDPEIKAWLAL TKTKKKGGGKKKKGKK +K 
Sbjct  318  FTVLLMPNGSDRITSHALQELQPTKKIDDDPEIKAWLALGTKTKKKGGGKKKKGKKADKV  377

Query  380  eEAPQTEPTDEATNKSKS  327
            +E+ + EP D  +N++ S
Sbjct  378  DESIEAEPMDATSNEAAS  395



>ref|XP_010037691.1| PREDICTED: proliferation-associated protein 2G4 [Eucalyptus grandis]
 gb|KCW49439.1| hypothetical protein EUGRSUZ_K02971 [Eucalyptus grandis]
Length=392

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 109/137 (80%), Gaps = 3/137 (2%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP++PF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD  AHIK
Sbjct  257  KASRFIFSEINQKFPILPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYAAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL     K       K KKG+K  
Sbjct  317  FTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLALG---TKTKKKGGGKKKKGKKGT  373

Query  377  EAPQTEPTDEATNKSKS  327
            E+ +TEP D  TN ++S
Sbjct  374  ESAETEPMDATTNGAES  390



>ref|XP_002988189.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
 gb|EFJ10608.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
Length=371

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFPLMPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEK GDLVAHIK
Sbjct  258  KASRFIFSEISQKFPLMPFTARQLEEKRARLGLVECVNHELLQPYPVLHEKTGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT H +QD+  +  +DDPEIK+WLA+
Sbjct  318  FTVLLMPNGSDRITGHSVQDVQPSSTVDDPEIKSWLAM  355



>gb|KHG01253.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=392

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K SRFI+ EI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ+L  TK IDDPEIK WLAL
Sbjct  317  FTVLLMPNGSDRITLHPLQELQPTKTIDDPEIKGWLAL  354



>ref|XP_009599303.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 120/130 (92%), Gaps = 1/130 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  297  KASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  356

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+H LQ+L   K I ++PEIKAWLALP KTKKKGGGKKKKGKKG+KT
Sbjct  357  FTVLLMPNGSDRITSHALQELKPAKTIENEPEIKAWLALPVKTKKKGGGKKKKGKKGDKT  416

Query  380  eEAPQTEPTD  351
            E++ Q EPT+
Sbjct  417  EDSSQAEPTE  426



>gb|EYU41925.1| hypothetical protein MIMGU_mgv1a007938mg [Erythranthe guttata]
Length=390

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPY VLHEKPGDLVAHIK
Sbjct  258  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYSVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+H LQ+L  TK +DD EIKAWLAL
Sbjct  318  FTVLLMPNGSDRVTSHALQELQPTKTVDDDEIKAWLAL  355



>ref|XP_004492468.1| PREDICTED: proliferation-associated protein 2G4-like [Cicer arietinum]
Length=394

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKPGDFVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+HPLQ+L  TK I+DPEI AWLAL
Sbjct  317  FTVLLMPNGSDRVTSHPLQELQPTKTIEDPEINAWLAL  354



>ref|XP_009384793.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384794.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK
Sbjct  258  KSSRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  444
            FT+LLMPNGSDR+T+HPLQ L  TK IDD PEIKAWLAL
Sbjct  318  FTLLLMPNGSDRVTSHPLQQLQPTKTIDDNPEIKAWLAL  356



>ref|XP_008388270.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Malus domestica]
Length=388

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/98 (84%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQPYPVLHEKPGD VA IK
Sbjct  257  KASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQPYPVLHEKPGDFVARIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  317  FTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>ref|NP_001149216.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACG34597.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACR36319.1| unknown [Zea mays]
 gb|AFW77740.1| hypothetical protein ZEAMMB73_275925 [Zea mays]
Length=394

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 109/138 (79%), Gaps = 5/138 (4%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSD+IT+HPLQ+L  TK I D+ EIKAWLAL      K   K    KK  K 
Sbjct  319  FTVLLMPNGSDKITSHPLQELKPTKSIEDNAEIKAWLALG----TKSKKKGGGKKKKGKK  374

Query  380  eEAPQTEPTDEATNKSKS  327
             +A + +P +EATN + S
Sbjct  375  GDAAEADPMEEATNGATS  392



>gb|KJB36946.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K SRFI+ EI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ L  TK IDDPEIK WLAL
Sbjct  317  FTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  354



>ref|XP_009773246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773247.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773248.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=387

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFT RDLEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFTTRDLEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  441
            FTVLLMPNGSDR+T+H LQ+L   K I ++PEIKAWLALP
Sbjct  317  FTVLLMPNGSDRVTSHALQELKPAKTIENEPEIKAWLALP  356



>gb|KJB36944.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36947.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36948.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=392

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K SRFI+ EI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  257  KTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ L  TK IDDPEIK WLAL
Sbjct  317  FTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  354



>gb|KJB36945.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K SRFI+ EI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  236  KTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIK  295

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT HPLQ L  TK IDDPEIK WLAL
Sbjct  296  FTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  333



>ref|XP_002963479.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
 gb|EFJ35350.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
Length=371

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFPLMPFTAR LEEKRARLGLVECVNH+LLQPYPVLHE+ GDLVAHIK
Sbjct  258  KASRFIFSEISQKFPLMPFTARQLEEKRARLGLVECVNHELLQPYPVLHERTGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT H +QD+  +  +DDPEIK+WLA+
Sbjct  318  FTVLLMPNGSDRITGHSVQDVQPSSTVDDPEIKSWLAM  355



>ref|NP_001275188.1| EBP1 [Solanum tuberosum]
 gb|ABJ97690.1| EBP1 [Solanum tuberosum]
Length=387

 Score =   179 bits (453),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 93/100 (93%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTARDLEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  257  KASRFIFSEINQKFPIMPFTARDLEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  441
            FTVLLMPNGSDR+T+H LQ+L  TK   ++PEIKAWLALP
Sbjct  317  FTVLLMPNGSDRVTSHXLQELQPTKTTENEPEIKAWLALP  356



>gb|AHA84129.1| DNA-binding protein GBP16 [Phaseolus vulgaris]
Length=394

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFFARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+H LQ+L  TK IDDP+IKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSHTLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_008464212.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=454

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP++PFTAR LEEKRARLGLVECVNHDLLQP+PVLHEKPGD VAHIK
Sbjct  315  KASRFIFSEISQKFPILPFTARALEEKRARLGLVECVNHDLLQPFPVLHEKPGDYVAHIK  374

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK ID+PEIKAWLAL
Sbjct  375  FTVLLMPNGSDRITSHALQELQPTKTIDNPEIKAWLAL  412



>ref|XP_010253797.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 1/136 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSDRIT+H LQ+L  TK I DDPEIKAWLAL TKTKKKGGGKKKKGKKG+K 
Sbjct  318  FTVLLMPNGSDRITSHALQELQPTKTIDDDPEIKAWLALGTKTKKKGGGKKKKGKKGDKI  377

Query  380  eEAPQTEPTDEATNKS  333
            EE+ + EP D ++N +
Sbjct  378  EESAEAEPMDVSSNGA  393



>ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycine max]
 gb|ACU23134.1| unknown [Glycine max]
Length=390

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 90/98 (92%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  257  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T+H LQ+L  TK IDDPEIKA LAL
Sbjct  317  FTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKACLAL  354



>ref|XP_010907413.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Elaeis guineensis]
Length=344

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEK GDLVAHIK
Sbjct  207  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKLGDLVAHIK  266

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ L  TK ID DPEIKAWLAL
Sbjct  267  FTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLAL  305



>ref|XP_002440927.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
 gb|EES19357.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
Length=392

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            FTVLLMPNGSD+IT+HPLQ+L  TK I D+ EIKAWLAL
Sbjct  319  FTVLLMPNGSDKITSHPLQELKPTKSIEDNAEIKAWLAL  357



>ref|XP_004489059.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Cicer arietinum]
Length=394

 Score =   177 bits (448),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFIY EI+Q FP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEK GD VAHIK
Sbjct  257  KASRFIYSEITQNFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKAGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT H LQ+L  TK +DDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITTHSLQELQPTKTVDDPEIKAWLAL  354



>ref|XP_010907411.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907412.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
Length=394

 Score =   176 bits (447),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 91/99 (92%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            K+SRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEK GDLVAHIK
Sbjct  257  KSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKLGDLVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ L  TK ID DPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLAL  355



>ref|XP_004962368.1| PREDICTED: proliferation-associated protein 2G4-like [Setaria 
italica]
Length=401

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 96/144 (67%), Positives = 112/144 (78%), Gaps = 7/144 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkkgggkkkkgkkgekt  381
            FTVLLMPNGSD++T+H LQ+L  TK I D+ EIKAWLAL          KKK G K +K 
Sbjct  319  FTVLLMPNGSDKVTSHQLQELQPTKSIEDNAEIKAWLALG------TKSKKKGGGKKKKG  372

Query  380  eEAPQTEPTDEATNKSKS*RNASY  309
            ++    EP +EATN + S  N+ +
Sbjct  373  KKGDAAEPMEEATNGAPSQNNSDF  396



>ref|XP_010920806.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010920807.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
Length=406

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  233  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  292

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLA  447
            FTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWL+
Sbjct  293  FTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLS  330



>gb|AEY75257.1| putative DNA binding protein [Atriplex canescens]
Length=396

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECV+HDL+QPYPVL+EKPGD VAHIK
Sbjct  257  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVSHDLVQPYPVLYEKPGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDR+T++PLQ+L  TK +D PEIKAWLAL
Sbjct  317  FTVLLMPNGSDRVTSYPLQELQPTKTVDHPEIKAWLAL  354



>ref|XP_004489058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFIY EI+Q FP+MPF+AR LEEKRARLGLVEC+NH+LLQPYPVLHEK GD VAHIK
Sbjct  257  KASRFIYSEITQNFPIMPFSARALEEKRARLGLVECMNHELLQPYPVLHEKAGDYVAHIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT H LQ+L  TK +DDPEIKAWLAL
Sbjct  317  FTVLLMPNGSDRITTHSLQELQPTKTVDDPEIKAWLAL  354



>ref|XP_010920804.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920805.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
Length=431

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 92/98 (94%), Gaps = 1/98 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIK
Sbjct  258  KASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLA  447
            FTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWL+
Sbjct  318  FTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLS  355



>gb|ADK78215.1| methionine aminopeptiase [Hordeum vulgare]
Length=394

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEK GDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKQGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            FTVLLMPNGSD+IT+HPLQ L  +K I DD EIKAWLAL
Sbjct  319  FTVLLMPNGSDKITSHPLQQLEPSKSIEDDAEIKAWLAL  357



>ref|XP_003568643.1| PREDICTED: proliferation-associated protein 2G4 [Brachypodium 
distachyon]
Length=394

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARVLEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            FTVLLMPNGSDR+T+H LQ+L  +K I D+ EIK WLAL
Sbjct  319  FTVLLMPNGSDRVTSHSLQELQPSKSIEDNAEIKGWLAL  357



>gb|AFG29445.1| Erb3 binding protein [Nervilia fordii]
Length=395

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQK+P+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIK
Sbjct  258  KASRFIFSEISQKYPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            FTVLLMPNGSDRIT+HP+Q L  +  I +DPEIKAWLAL
Sbjct  318  FTVLLMPNGSDRITSHPVQQLLPSISIENDPEIKAWLAL  356



>ref|XP_010553237.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=389

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+Q +P  PF+AR LEEKRARLGLVECVNHDLL+PYPVLHEKPGD VAHIK
Sbjct  258  KASRFIFSEINQNYPHFPFSARVLEEKRARLGLVECVNHDLLEPYPVLHEKPGDFVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  444
            FTVLLMPNGSDRIT+HPLQ+L  TK IDD PEIKAWLAL
Sbjct  318  FTVLLMPNGSDRITSHPLQELQPTKTIDDAPEIKAWLAL  356



>gb|KFK34423.1| hypothetical protein AALP_AA5G142900 [Arabis alpina]
Length=393

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI+Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEINQNFPYMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQELQTTKTVDDPEIKGWLAL  355



>ref|XP_001779761.1| predicted protein [Physcomitrella patens]
 gb|EDQ55445.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+ KFP+MPFTAR LEEKRARLG+VECVNH+LLQPYPVLHEKPGD VAHIK
Sbjct  258  KASRFIFSEINTKFPIMPFTARALEEKRARLGIVECVNHELLQPYPVLHEKPGDCVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSD+IT  PLQ+   TK  +DPEIKAWLAL
Sbjct  318  FTVLLMPNGSDKITGLPLQECQSTKVPEDPEIKAWLAL  355



>gb|EMT31637.1| Proliferation-associated protein 2G4 [Aegilops tauschii]
Length=482

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEK GDLVAHIK
Sbjct  327  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKQGDLVAHIK  386

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  444
            FTVLLMPNGSD+IT+HPLQ L  +K I+ D EIKAWLAL
Sbjct  387  FTVLLMPNGSDKITSHPLQQLEPSKSIEGDAEIKAWLAL  425



>gb|EAY97646.1| hypothetical protein OsI_19569 [Oryza sativa Indica Group]
Length=393

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            FTVLL+P+GS R+T+H LQ+L  TK I D+ EIKAWLAL
Sbjct  319  FTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLAL  357



>ref|NP_001055274.1| Os05g0350500 [Oryza sativa Japonica Group]
 gb|AAV44069.1| putative DNA-binding protein GBP16 [Oryza sativa Japonica Group]
 dbj|BAF17188.1| Os05g0350500 [Oryza sativa Japonica Group]
 dbj|BAG88060.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95770.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   169 bits (429),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            FTVLL+P+GS R+T+H LQ+L  TK I D+ EIKAWLAL
Sbjct  319  FTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLAL  357



>ref|XP_009115883.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Brassica rapa]
Length=390

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009115882.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Brassica rapa]
Length=391

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK IDDPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009799003.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Nicotiana sylvestris]
Length=361

 Score =   167 bits (424),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/100 (80%), Positives = 88/100 (88%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASR I+ EISQK P+MPFTARDLEEKRAR+GLVECV H+LLQPYPVLHEKPGDLVAHIK
Sbjct  225  KASRVIFREISQKVPIMPFTARDLEEKRARVGLVECVKHELLQPYPVLHEKPGDLVAHIK  284

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALP  441
            FTVLLMPNG DRIT+H +Q+L   K ID+ PEIK WLALP
Sbjct  285  FTVLLMPNGPDRITSHAIQELTPAKTIDNEPEIKTWLALP  324



>gb|EMS60472.1| Proliferation-associated protein 2G4 [Triticum urartu]
Length=520

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/99 (83%), Positives = 90/99 (91%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEK GDLVAHIK
Sbjct  298  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKQGDLVAHIK  357

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  444
            FTVLLMPNGSD+IT+HPLQ L  +K I+ D EIKAWLAL
Sbjct  358  FTVLLMPNGSDKITSHPLQQLEPSKSIEGDAEIKAWLAL  396



>ref|XP_001769950.1| predicted protein [Physcomitrella patens]
 gb|EDQ65310.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   168 bits (426),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 80/98 (82%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+ KFP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGD VAHI+
Sbjct  258  KASRFIFSEINTKFPIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDFVAHIQ  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSD+IT  PLQ L  TK  +DPEIKAWLAL
Sbjct  318  FTVLLMPNGSDKITGLPLQALEPTKVPEDPEIKAWLAL  355



>emb|CDX73690.1| BnaC08g23130D [Brassica napus]
Length=391

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ++  TK IDDPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQEIQPTKTIDDPEIKGWLAL  355



>gb|AAB80919.1| DNA-binding protein GBP16 [Oryza sativa Japonica Group]
Length=393

 Score =   167 bits (424),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/99 (81%), Positives = 89/99 (90%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  444
            FTVLL+P+GS R+T+H LQ L  TK I+D  EIKAWLAL
Sbjct  319  FTVLLLPSGSQRVTSHSLQVLQPTKSIEDHAEIKAWLAL  357



>emb|CDX78041.1| BnaA09g32360D [Brassica napus]
Length=436

 Score =   168 bits (426),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/98 (81%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI +KFP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  303  KASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  362

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  363  FTVLLMPNGSDRITSHALQELQPTKTVDDPEIKGWLAL  400



>ref|XP_010529897.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=394

 Score =   167 bits (422),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/99 (82%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI+Q F   PFTAR LEEKRARLGLVECVNHDLL+PYPVLHEKPGD VAHIK
Sbjct  258  KASRFIFSEINQNFQHFPFTARVLEEKRARLGLVECVNHDLLEPYPVLHEKPGDFVAHIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK I DD EIKAWLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQELQPTKTIADDSEIKAWLAL  356



>ref|XP_006654286.1| PREDICTED: proliferation-associated protein 2G4-like [Oryza brachyantha]
Length=392

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 87/98 (89%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIK
Sbjct  259  KASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIK  318

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLL+P+GS R+T+HPLQ+       D+ EIKAWLAL
Sbjct  319  FTVLLLPSGSQRVTSHPLQEFQPKSIEDNAEIKAWLAL  356



>ref|XP_010515611.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Camelina sativa]
 ref|XP_010515612.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Camelina sativa]
Length=393

 Score =   166 bits (420),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK GD VA IK
Sbjct  258  KASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKSGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL  K KK GG KKK  K GEK E
Sbjct  318  FTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLALGIKKKKGGGKKKKAKKAGEKGE  377

Query  377  EAPQTEPTDEATN  339
             + + EP D  +N
Sbjct  378  SSTEAEPMDATSN  390



>ref|XP_006403880.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
 gb|ESQ45333.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
Length=393

 Score =   166 bits (420),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 84/98 (86%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI + FP MPFTAR LEEKRARLGLVEC+NH LLQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKENFPHMPFTARSLEEKRARLGLVECLNHGLLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WL+L
Sbjct  318  FTVLLMPNGSDRITSHSLQELQPTKTIEDPEIKGWLSL  355



>ref|XP_010426749.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK GD VA IK
Sbjct  258  KASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKSGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL  K KK GG KKK  K GEK E
Sbjct  318  FTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLALGIKKKKGGGKKKKAKKAGEKGE  377

Query  377  EAPQTEPTDEATN  339
             + + EP D  +N
Sbjct  378  ASTEAEPMDATSN  390



>ref|XP_010503881.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   165 bits (417),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 102/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK GD VA IK
Sbjct  258  KASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKSGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL  K KK GG KKK  K GEK E
Sbjct  318  FTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLALGIKKKKGGGKKKKAKKAGEKGE  377

Query  377  EAPQTEPTDEATN  339
             + + EP D  +N
Sbjct  378  ASTEAEPMDATSN  390



>emb|CDY16291.1| BnaC01g23260D [Brassica napus]
Length=393

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI + FP MPFTAR LEEKRARLGLVECVNH  L PYPVL+EKPGD VA IK
Sbjct  258  KASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>ref|XP_009123761.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=393

 Score =   164 bits (416),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI + FP MPFTAR LEEKRARLGLVECVNH  L PYPVL+EKPGD VA IK
Sbjct  258  KASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>emb|CDY33263.1| BnaA01g19300D [Brassica napus]
Length=393

 Score =   164 bits (415),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI+ EI + FP MPFTAR LEEKRARLGLVECVNH  L PYPVL+EKPGD VA IK
Sbjct  258  KASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>gb|AGV54689.1| proliferation-associated protein 2G4-like protein [Phaseolus 
vulgaris]
Length=394

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 86/98 (88%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KA RFI+ +ISQKFP+MPF AR LEEKRA LGLVECVNH+LLQPYPVLHEKPGD VA IK
Sbjct  257  KAFRFIFSDISQKFPIMPFFARALEEKRACLGLVECVNHELLQPYPVLHEKPGDYVAPIK  316

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            F VLLMPNGSDR+T HPLQ+L  TK IDDP++KAWLAL
Sbjct  317  FPVLLMPNGSDRVTFHPLQELQPTKAIDDPDVKAWLAL  354



>ref|XP_006291296.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24194.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=282

 Score =   160 bits (404),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRF   EI++ FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK GD VA IK
Sbjct  160  KASRFTISEITKNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKSGDFVAQIK  219

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL
Sbjct  220  FTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  257



>ref|XP_006291295.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24193.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=381

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 103/133 (77%), Gaps = 0/133 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRF   EI++ FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK GD VA IK
Sbjct  246  KASRFTISEITKNFPHMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKSGDFVAQIK  305

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL  K KK GG KKK  K GEK E
Sbjct  306  FTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLALGIKKKKGGGKKKKAKKAGEKGE  365

Query  377  EAPQTEPTDEATN  339
             + + EP D ++N
Sbjct  366  ASTEAEPMDASSN  378



>ref|NP_190748.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AAM46648.1|AF422841_1 cell cycle-related nuclear binding protein [Arabidopsis thaliana]
 gb|AAB18127.1| G2p [Arabidopsis thaliana]
 gb|AAC14407.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAL25197.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAL25198.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAN13085.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AEE78844.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL  K KK GG KKK  K GEK E
Sbjct  318  FTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLALGIKKKKGGGKKKKAQKAGEKGE  376

Query  377  EAPQTEPTDEATN  339
             + + EP D ++N
Sbjct  377  ASTEAEPMDASSN  389



>gb|AAK25936.1|AF360226_1 putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAK64125.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   162 bits (409),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 103/133 (77%), Gaps = 1/133 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekte  378
            FTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL  K KK GG KKK  K GEK E
Sbjct  318  FTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLALGIKKKKGGGKKKKAQKAGEKGE  376

Query  377  EAPQTEPTDEATN  339
             + + EP D ++N
Sbjct  377  ASTEAEPMDASSN  389



>ref|NP_001190060.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78846.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=385

 Score =   160 bits (406),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLAL  354



>dbj|BAH19507.1| AT3G51800 [Arabidopsis thaliana]
Length=362

 Score =   160 bits (405),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLAL  354



>ref|XP_002877825.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54084.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score =   160 bits (405),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 77/98 (79%), Positives = 82/98 (84%), Gaps = 1/98 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSDRIT+H LQ+L  TK  +DPEI+ WLAL
Sbjct  318  FTVLLMPNGSDRITSHTLQELG-TKISEDPEIQGWLAL  354



>emb|CDY29047.1| BnaC07g32530D [Brassica napus]
Length=390

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 83/98 (85%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASR +  E+ ++FP MPFT+R LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRSLISEVKERFPHMPFTSRSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSD+IT+H LQ+L  TK IDDPEIK WLAL
Sbjct  318  FTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>emb|CDX90633.1| BnaA03g41480D [Brassica napus]
Length=390

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASR +  E+ + FP MPFT+R LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRSLISEVKENFPHMPFTSRSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSD+IT+H LQ+L  TK IDDPEIK WLAL
Sbjct  318  FTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009136636.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=390

 Score =   159 bits (402),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 82/98 (84%), Gaps = 0/98 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASR +  E+ + FP MPFT+R LEEKRARLGLVECVNH  LQPYPVL+EKPGD VA IK
Sbjct  258  KASRSLISEVKENFPHMPFTSRSLEEKRARLGLVECVNHGHLQPYPVLYEKPGDFVAQIK  317

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
            FTVLLMPNGSD+IT+H LQ+L  TK IDDPEIK WLAL
Sbjct  318  FTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|NP_850679.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78845.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=401

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 103/142 (73%), Gaps = 10/142 (7%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEK---------  585
            KASRFI  EI Q FP MPFTAR LEEKRARLGLVECVNH  LQPYPVL+EK         
Sbjct  258  KASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPYPVLYEKPGSCRFGFL  317

Query  584  PGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkk  405
            PGD VA IKFTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL  K KK GG KKK
Sbjct  318  PGDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLALGIKKKKGGGKKKK  376

Query  404  kgkkgekteEAPQTEPTDEATN  339
              K GEK E + + EP D ++N
Sbjct  377  AQKAGEKGEASTEAEPMDASSN  398



>ref|XP_001765994.1| predicted protein [Physcomitrella patens]
 gb|EDQ69315.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   153 bits (386),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 83/111 (75%), Gaps = 13/111 (12%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKP--------  582
            KAS+FI  EI+ +FPLMPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEK         
Sbjct  251  KASKFIRSEINSRFPLMPFTARSLEEKRARLGLVECVNHELLQPYPVLHEKSGITIFHQL  310

Query  581  -----GDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  444
                 GD VA IKFTVLLMPNGSD+IT  PLQ+   TK  DDPEIKAWL +
Sbjct  311  SLILTGDFVARIKFTVLLMPNGSDKITGVPLQEYQQTKVPDDPEIKAWLGM  361



>gb|KCW45224.1| hypothetical protein EUGRSUZ_L01138, partial [Eucalyptus grandis]
Length=208

 Score =   135 bits (340),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/112 (68%), Positives = 85/112 (76%), Gaps = 3/112 (3%)
 Frame = -2

Query  662  EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTK  483
            +KRARLGLVECVNH+LLQPYPVLHEK GD  AHIKFTVLLMPNGSDRIT+H LQ+L  TK
Sbjct  100  KKRARLGLVECVNHELLQPYPVLHEKLGDYAAHIKFTVLLMPNGSDRITSHSLQELQPTK  159

Query  482  PIDDPEIKAWLALPtktkkkgggkkkkgkkgekteEAPQTEPTDEATNKSKS  327
             IDDPEIKAWLAL     K       K KKG+K  E+ +TEP D  TN ++S
Sbjct  160  TIDDPEIKAWLALG---TKTKKKGGGKKKKGKKDTESAETEPMDATTNGTES  208



>gb|EEE63363.1| hypothetical protein OsJ_18175 [Oryza sativa Japonica Group]
Length=368

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = -2

Query  704  QKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSD  525
            Q F L    +R LEEKRARLGLVEC+NH+LLQPYPVLHEKPGDLVAHIKFTVLL+P+GS 
Sbjct  245  QNFHLKMKASRALEEKRARLGLVECMNHELLQPYPVLHEKPGDLVAHIKFTVLLLPSGSQ  304

Query  524  RITAHPLQDLNVTKPI-DDPEIKAWLAL  444
            R+T+H LQ+L  TK I D+ EIKAWLAL
Sbjct  305  RVTSHSLQELQPTKSIEDNAEIKAWLAL  332



>ref|XP_005650680.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26136.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=402

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/97 (60%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASR I+ EI++K P MPFT R L+ K++RLG++EC+NH LL PYPVLHEK G++VA  K
Sbjct  261  KASRSIFSEINKKHPTMPFTTRGLDSKQSRLGILECLNHGLLHPYPVLHEKNGEVVAQFK  320

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  447
             TVLLMPNGSDRITA PLQ ++  K +++ ++K  LA
Sbjct  321  ATVLLMPNGSDRITAAPLQKVDSDKKVENEDLKKLLA  357



>gb|KIZ00762.1| hypothetical protein MNEG_7198 [Monoraphidium neglectum]
Length=383

 Score =   114 bits (284),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 69/102 (68%), Gaps = 10/102 (10%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEE----------KRARLGLVECVNHDLLQPYPVLHE  588
            KASR +   IS+KFP++PFT R L E          K+ RLGLVEC+ H LL PYPVLHE
Sbjct  255  KASRLVLGAISKKFPMLPFTLRALSEGEGEDVSELKKQLRLGLVECLTHGLLHPYPVLHE  314

Query  587  KPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEI  462
            K G+LVA IK TVLLMPNGSD+IT  P Q +   K ++D E+
Sbjct  315  KGGELVAQIKGTVLLMPNGSDKITVAPQQPVETEKKVEDAEL  356



>gb|KHN18039.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=186

 Score =   106 bits (264),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/53 (89%), Positives = 51/53 (96%), Gaps = 0/53 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPG  579
            KASRFI+ EISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPVLHEKPG
Sbjct  109  KASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPVLHEKPG  161



>ref|XP_003062941.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=374

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 71/100 (71%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKR-ARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            +ASR ++ EIS+KFP MPFT R + + R A+LGL EC+ H+LL  YPVL+EKPGD VAH+
Sbjct  265  QASRAVFSEISKKFPTMPFTMRAMGDVRGAKLGLSECMKHELLHEYPVLYEKPGDAVAHV  324

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALP  441
            K TVL+M NG+DR+T    Q     K + D ++KA +A P
Sbjct  325  KCTVLVMQNGNDRVTTFAPQVTKSEKELMDEDLKALIAEP  364



>gb|KFM70392.1| Proliferation-associated protein 2G4, partial [Stegodyphus mimosarum]
Length=217

 Score =   105 bits (262),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 73/100 (73%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  + E+ ++F  MPFT R  E EK+AR+G+VECVNH L++P+ VL+EK G+ VA  
Sbjct  75   KASRAFFSEVDKRFGNMPFTLRSFEDEKKARMGVVECVNHKLVEPFTVLYEKEGEYVAQF  134

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  450
            KFTVLLMP+GS +IT+ P+ DL++ +    +DD  +KA L
Sbjct  135  KFTVLLMPSGSHKITSGPI-DLDLYETELVVDDDSLKALL  173



>ref|XP_003084394.1| putative DNA-binding protein GBP16 (ISS) [Ostreococcus tauri]
Length=367

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -2

Query  731  SRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFT  552
            SR ++ EIS++FP MPFTAR L+EKR   GLVEC NH LL  YPVL+EK G  VAHIK T
Sbjct  260  SRAVFSEISKRFPTMPFTARALQEKRVNFGLVECCNHGLLHSYPVLYEKDGSAVAHIKST  319

Query  551  VLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  447
             L++ NG+DRIT    Q +   K + D  +   +A
Sbjct  320  FLVLKNGNDRITTFAPQAVESDKKLSDTALYDLIA  354



>emb|CEG00817.1| Peptidase M24, methionine aminopeptidase [Ostreococcus tauri]
Length=385

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = -2

Query  731  SRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFT  552
            SR ++ EIS++FP MPFTAR L+EKR   GLVEC NH LL  YPVL+EK G  VAHIK T
Sbjct  278  SRAVFSEISKRFPTMPFTARALQEKRVNFGLVECCNHGLLHSYPVLYEKDGSAVAHIKST  337

Query  551  VLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  447
             L++ NG+DRIT    Q +   K + D  +   +A
Sbjct  338  FLVLKNGNDRITTFAPQAVESDKKLSDTALYDLIA  372



>ref|XP_001699126.1| hypothetical protein CHLREDRAFT_139416 [Chlamydomonas reinhardtii]
 gb|EDO98981.1| predicted protein [Chlamydomonas reinhardtii]
Length=387

 Score =   107 bits (266),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTAR-----------DLEEKRARLGLVECVNHDLLQPYPVLH  591
            +ASR ++  ++  F  MPFT R           +L+  + +LGLVEC+NH LL PYPVLH
Sbjct  256  QASRAVFSLVNSAFATMPFTLRALLDEAAAQKTELKASQLKLGLVECLNHGLLHPYPVLH  315

Query  590  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALP  441
            EKPG++VA IK TVLLMPNGS  IT+ P Q +   K ++D EI   LA P
Sbjct  316  EKPGEVVAQIKGTVLLMPNGSSIITSAPRQTVTTEKKVEDKEILDLLATP  365



>ref|XP_001422365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00682.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=379

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 64/97 (66%), Gaps = 0/97 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            + SR ++ EIS++FP MPFTAR LEEKR   GLVEC NH LL  YPVL+EK G  VAH+K
Sbjct  270  QGSRAVFSEISKRFPTMPFTARALEEKRVNFGLVECCNHGLLHAYPVLYEKDGAAVAHVK  329

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  447
             T L++  G+DRIT    Q++   K + D  +   +A
Sbjct  330  STFLVLKKGNDRITTFEPQEVQSDKSLSDNALVELIA  366



>gb|KDO19442.1| DNA-binding protein [Saprolegnia parasitica CBS 223.65]
Length=393

 Score =   106 bits (265),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR+++ EI+ KFP +PFT R  E E ++R+G+VECV HDLL P+P+L  + GD +AH+
Sbjct  268  KASRYVFSEINSKFPTLPFTIRAFEDESQSRMGVVECVKHDLLTPFPILEGREGDHIAHL  327

Query  560  KFTVLLMPNGSDRIT--AHPLQDLNVTKPIDDPEIKAWL  450
            K TVLLMPNG+ +IT  + PL+ +N  K +  PEI A L
Sbjct  328  KATVLLMPNGTTKITGLSLPLERINSEKTV-TPEIAAIL  365



>ref|XP_008619458.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
 gb|EQC27064.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
Length=393

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 72/99 (73%), Gaps = 4/99 (4%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR+++ EI+ KFP +PFT R  E E ++R+G+VECV HDLL P+P+L  + GD +AH+
Sbjct  268  KASRYVFSEINSKFPTLPFTIRAFEDESQSRMGVVECVKHDLLTPFPILEGREGDHIAHL  327

Query  560  KFTVLLMPNGSDRIT--AHPLQDLNVTKPIDDPEIKAWL  450
            K TVLLMPNG+ +IT  + PL+ +N  K +  PEI A L
Sbjct  328  KATVLLMPNGTTKITGLSLPLERINSDKTV-TPEIAAIL  365



>ref|XP_002508417.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69675.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score =   106 bits (264),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 51/100 (51%), Positives = 67/100 (67%), Gaps = 1/100 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEE-KRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            +ASR ++ EI ++FP MPF+ R +E  K A+LGLVEC  H+LL  YPVL+EKPGD VAH 
Sbjct  266  QASRAVFSEIQKRFPTMPFSMRAMEGIKGAKLGLVECCTHELLHKYPVLYEKPGDAVAHF  325

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALP  441
            K TVL+M NG+DRIT    Q +     + D E+K  +  P
Sbjct  326  KATVLVMQNGNDRITTWTCQPVESALELTDEELKELITQP  365



>ref|XP_010156890.1| PREDICTED: proliferation-associated protein 2G4, partial [Eurypyga 
helias]
Length=138

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  25   KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  84

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  85   KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  123



>ref|XP_002900555.1| proliferation-associated protein, metalloprotease family M24X, 
putative [Phytophthora infestans T30-4]
 gb|EEY59870.1| proliferation-associated protein, metalloprotease family M24X, 
putative [Phytophthora infestans T30-4]
Length=393

 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  + GD VAH 
Sbjct  279  KASRYVFKEINTKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGRAGDKVAHF  338

Query  560  KFTVLLMPNGSDRITAHPL--QDLNVTKPIDDPEIK  459
            K TVLL+PNG+ +IT  P   + ++  K +DD   K
Sbjct  339  KVTVLLLPNGTTKITGLPFPSEKVHSEKTVDDETAK  374



>gb|ETL29090.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETP05241.1| DNA-binding protein, 42 kDa [Phytophthora parasitica CJ01A1]
Length=393

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  + GD VAH 
Sbjct  279  KASRYVFKEINNKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGREGDKVAHF  338

Query  560  KFTVLLMPNGSDRITAHPL--QDLNVTKPIDDPEIK  459
            K TVLL+PNG+ +IT  P     ++  K +DD   K
Sbjct  339  KVTVLLLPNGTTKITGLPFPSDKVHSEKTVDDETAK  374



>ref|XP_008912890.1| DNA-binding protein, 42 kDa [Phytophthora parasitica INRA-310]
 gb|ETI35422.1| DNA-binding protein, 42 kDa [Phytophthora parasitica P1569]
 gb|ETK75660.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETL82327.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETM35541.1| DNA-binding protein, 42 kDa [Phytophthora parasitica]
 gb|ETN01811.1| DNA-binding protein, 42 kDa [Phytophthora parasitica INRA-310]
 gb|ETP33377.1| DNA-binding protein, 42 kDa [Phytophthora parasitica P10297]
Length=393

 Score =   104 bits (260),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 66/96 (69%), Gaps = 3/96 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  + GD VAH 
Sbjct  279  KASRYVFKEINNKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGREGDKVAHF  338

Query  560  KFTVLLMPNGSDRITAHPL--QDLNVTKPIDDPEIK  459
            K TVLL+PNG+ +IT  P     ++  K +DD   K
Sbjct  339  KVTVLLLPNGTTKITGLPFPSDKVHSEKTVDDETAK  374



>ref|XP_002947167.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
 gb|EFJ51757.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
Length=382

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRA-----------RLGLVECVNHDLLQPYPVLH  591
            +ASR ++  I+  F  MPFT R L ++ A           +LGLVEC+NH LL PYPVLH
Sbjct  259  QASRIVFSLINSSFATMPFTLRALLDEAANQKTELKVGQLKLGLVECLNHGLLHPYPVLH  318

Query  590  EKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALP  441
            EK G+LVA IK TVLLMPNGS  +T+   Q +N  K ++D EI   LA P
Sbjct  319  EKGGELVAQIKGTVLLMPNGSSIVTSASRQPVNSEKKVEDKEILDLLATP  368



>ref|XP_006843644.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
 gb|ERN05319.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
Length=318

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGD  576
            K+SRFI+ EI+Q+FP+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPG+
Sbjct  258  KSSRFIFSEINQRFPIMPFTARVLEEKRARLGLVECVNHELLQPYPVLHEKPGE  311



>ref|XP_005876787.1| PREDICTED: proliferation-associated protein 2G4 [Myotis brandtii]
 ref|XP_006093721.1| PREDICTED: proliferation-associated protein 2G4 [Myotis lucifugus]
 ref|XP_006777912.1| PREDICTED: proliferation-associated protein 2G4 [Myotis davidii]
 ref|XP_008146840.1| PREDICTED: proliferation-associated protein 2G4 [Eptesicus fuscus]
 gb|EPQ14237.1| Proliferation-associated protein 2G4 [Myotis brandtii]
Length=394

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVT-KPIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  + K + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSDKEVQDAELKALL  358



>ref|XP_005655696.1| PREDICTED: proliferation-associated protein 2G4-like [Sus scrofa]
Length=235

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  101  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  160

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  161  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  199



>gb|KFV57642.1| Proliferation-associated protein 2G4, partial [Tyto alba]
Length=183

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  68   KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  127

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  128  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  166



>ref|XP_008003570.1| PREDICTED: proliferation-associated protein 2G4 [Chlorocebus 
sabaeus]
Length=313

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  179  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  238

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  239  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  277



>ref|XP_009970305.1| PREDICTED: proliferation-associated protein 2G4, partial [Tyto 
alba]
Length=202

 Score =   101 bits (251),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  68   KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  127

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  128  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  166



>ref|XP_003391218.2| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Amphimedon queenslandica]
Length=153

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEK-RARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K+SR  + E+  KF +MPF+ R  EE+ +AR+G+VEC NH+LL+P+ VL+EK G+ VA  
Sbjct  23   KSSRAFFSEVCSKFDVMPFSLRSFEEEGKARMGVVECTNHNLLEPFHVLYEKEGEFVAQF  82

Query  560  KFTVLLMPNGSDRITAHPLQD---LNVTKPIDDPEIKAWLA  447
            KFTVLLMPNG  +IT + L D   +  T  ++D E+K  LA
Sbjct  83   KFTVLLMPNGPLKIT-NTLFDPSVIESTNKLEDAELKTLLA  122



>ref|XP_010174926.1| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Caprimulgus carolinensis]
Length=119

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  24   KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  83

Query  560  KFTVLLMPNGSDRITAHPLQ  501
            KFTVLLMPNG  RIT+ P +
Sbjct  84   KFTVLLMPNGPMRITSGPFE  103



>ref|XP_009533169.1| methionine aminopeptidase, merops subfamily M24 [Phytophthora 
sojae]
 gb|EGZ10424.1| methionine aminopeptidase, merops subfamily M24 [Phytophthora 
sojae]
Length=393

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 67/96 (70%), Gaps = 3/96 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR+++ EI+ KFP +PFT R  E E +AR+G+VECV HDLLQ YP+L  +PGD VAH 
Sbjct  279  KASRYVFKEINNKFPTLPFTIRAFEDESQARMGVVECVKHDLLQAYPILEGRPGDKVAHF  338

Query  560  KFTVLLMPNGSDRITA--HPLQDLNVTKPIDDPEIK  459
            K TVLL+P+G+ +IT    P   ++  K +D+   K
Sbjct  339  KVTVLLLPSGTTKITGLTFPGDRVHSEKTVDEETAK  374



>ref|XP_011173347.1| PREDICTED: proliferation-associated protein 2G4 [Solenopsis invicta]
Length=387

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E+S K  LMPF  R  E EK+A++ +VECVNH L++P+ VL+EKP +  A  
Sbjct  258  KASRMFYSEVSHKHGLMPFNLRTFEDEKKAKMAVVECVNHRLIEPFQVLYEKPNEYAAQF  317

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  450
            KFTVLLMPNG  RIT  P  DL++ +    +DDPE+K  L
Sbjct  318  KFTVLLMPNGPHRITGIPF-DLDMYQSDCVVDDPELKNLL  356



>ref|XP_011340977.1| PREDICTED: proliferation-associated protein 2G4 [Cerapachys biroi]
 gb|EZA53116.1| Proliferation-associated protein 2G4 [Cerapachys biroi]
Length=387

 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E+S K  LMPF  R  E EK+A++ +VECVNH L++P+ VL+EKP +  A  
Sbjct  258  KASRMFYSEVSHKHGLMPFNLRTFEDEKKAKMAVVECVNHRLIEPFQVLYEKPNEYAAQF  317

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  450
            KFTVLLMPNG  +IT  P  DL+V +    +DDPE+K  L
Sbjct  318  KFTVLLMPNGPHKITGIPF-DLDVYQSDCVVDDPELKNLL  356



>gb|EFZ09337.1| hypothetical protein SINV_15911 [Solenopsis invicta]
Length=424

 Score =   103 bits (256),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E+S K  LMPF  R  E EK+A++ +VECVNH L++P+ VL+EKP +  A  
Sbjct  295  KASRMFYSEVSHKHGLMPFNLRTFEDEKKAKMAVVECVNHRLIEPFQVLYEKPNEYAAQF  354

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  450
            KFTVLLMPNG  RIT  P  DL++ +    +DDPE+K  L
Sbjct  355  KFTVLLMPNGPHRITGIPF-DLDMYQSDCVVDDPELKNLL  393



>ref|XP_008318205.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=391

 Score =   102 bits (255),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 67/100 (67%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E E +ARLG+VEC  H+LLQP+ VL EK G+ VA  
Sbjct  258  KTSRSFFSEVERRFSAMPFTLRAFEDEAKARLGVVECAKHELLQPFSVLQEKEGEFVAQF  317

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  450
            KFTVLLM NG  RIT+ PL DL + K    + DPE++A L
Sbjct  318  KFTVLLMANGPHRITSGPL-DLELYKSEHEVQDPELRALL  356



>emb|CAA59260.1| p38-2G4 [Mus musculus]
Length=340

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  206  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  265

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  266  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  304



>dbj|BAF84485.1| unnamed protein product [Homo sapiens]
Length=367

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|AAH32111.1| PA2G4 protein, partial [Homo sapiens]
 gb|AAH72007.1| PA2G4 protein, partial [Homo sapiens]
Length=373

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_011263181.1| PREDICTED: proliferation-associated protein 2G4 [Camponotus floridanus]
 gb|EFN63603.1| Proliferation-associated protein 2G4 [Camponotus floridanus]
Length=386

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E+S K  LMPF  R  E EK+A++ +VECVNH L++P+ VL+EKP +  A  
Sbjct  258  KASRMFYSEVSHKHGLMPFNLRTFEDEKKAKMAVVECVNHRLIEPFQVLYEKPNEYAAQF  317

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  450
            KFTVLLMPNG  +IT  P  DL++ +    +DDPE+K  L
Sbjct  318  KFTVLLMPNGPHKITGIPF-DLDIYQSDCVVDDPELKNLL  356



>gb|AAH03777.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH05593.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH28926.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH37623.1| Pa2g4 protein, partial [Mus musculus]
Length=372

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|ELR50756.1| Proliferation-associated protein 2G4, partial [Bos mutus]
Length=395

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  261  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  320

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  321  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  359



>dbj|BAE25986.1| unnamed protein product [Mus musculus]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_006908945.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus alecto]
 ref|XP_011374000.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus vampyrus]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|NP_035249.1| proliferation-associated protein 2G4 [Mus musculus]
 sp|P50580.3|PA2G4_MOUSE RecName: Full=Proliferation-associated protein 2G4; AltName: 
Full=IRES-specific cellular trans-acting factor 45 kDa; Short=ITAF45; 
AltName: Full=Mpp1; AltName: Full=Proliferation-associated 
protein 1; AltName: Full=Protein p38-2G4 [Mus musculus]
 gb|AAB60513.1| proliferation-associated protein 1 [Mus musculus]
 gb|AAH46532.1| Proliferation-associated 2G4 [Mus musculus]
 dbj|BAE39129.1| unnamed protein product [Mus musculus]
 dbj|BAE40451.1| unnamed protein product [Mus musculus]
 gb|EDL24585.1| proliferation-associated 2G4 [Mus musculus]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|NP_001029871.1| proliferation-associated protein 2G4 [Bos taurus]
 ref|NP_001277540.1| proliferation-associated 2G4, 38kDa [Panthera tigris altaica]
 ref|XP_531629.2| PREDICTED: proliferation-associated protein 2G4 [Canis lupus 
familiaris]
 ref|XP_003988925.1| PREDICTED: proliferation-associated protein 2G4 [Felis catus]
 ref|XP_004401711.1| PREDICTED: proliferation-associated protein 2G4 [Odobenus rosmarus 
divergens]
 ref|XP_004773144.1| PREDICTED: proliferation-associated protein 2G4 [Mustela putorius 
furo]
 ref|XP_004800650.1| PREDICTED: proliferation-associated protein 2G4 [Mustela putorius 
furo]
 ref|XP_005680428.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Capra 
hircus]
 ref|XP_005903484.1| PREDICTED: proliferation-associated protein 2G4 [Bos mutus]
 ref|XP_005975566.1| PREDICTED: proliferation-associated protein 2G4 [Pantholops hodgsonii]
 ref|XP_006728833.1| PREDICTED: proliferation-associated protein 2G4 [Leptonychotes 
weddellii]
 ref|XP_006075113.1| PREDICTED: proliferation-associated protein 2G4 [Bubalus bubalis]
 ref|XP_008710451.1| PREDICTED: proliferation-associated protein 2G4 [Ursus maritimus]
 ref|XP_010837513.1| PREDICTED: proliferation-associated protein 2G4 [Bison bison 
bison]
 ref|XP_011219007.1| PREDICTED: proliferation-associated protein 2G4 [Ailuropoda melanoleuca]
 gb|AAI03293.1| Proliferation-associated 2G4, 38kDa [Bos taurus]
 gb|EFB28840.1| hypothetical protein PANDA_004075 [Ailuropoda melanoleuca]
 tpg|DAA29554.1| TPA: ErbB3-binding protein 1 [Bos taurus]
 gb|AHJ25867.1| proliferation-associated 2G4 [Panthera tigris altaica]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|ADT71645.1| proliferation associated 2G4 [Mesocricetus auratus]
Length=388

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  255  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  314

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  315  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  353



>ref|XP_006179892.1| PREDICTED: proliferation-associated protein 2G4 [Camelus ferus]
 ref|XP_006218628.1| PREDICTED: proliferation-associated protein 2G4 [Vicugna pacos]
 ref|XP_010962177.1| PREDICTED: proliferation-associated protein 2G4 [Camelus bactrianus]
 ref|XP_010975183.1| PREDICTED: proliferation-associated protein 2G4 [Camelus dromedarius]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|XP_002752647.1| PREDICTED: proliferation-associated protein 2G4 [Callithrix jacchus]
Length=390

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_002711114.1| PREDICTED: proliferation-associated protein 2G4 [Oryctolagus 
cuniculus]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|XP_004093117.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Nomascus leucogenys]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|AAD00646.1| erbB3 binding protein EBP1 [Homo sapiens]
Length=340

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  206  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  265

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  266  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  304



>ref|XP_001504854.1| PREDICTED: proliferation-associated protein 2G4 isoform 1 [Equus 
caballus]
 ref|XP_004429287.1| PREDICTED: proliferation-associated protein 2G4 [Ceratotherium 
simum simum]
 ref|XP_008528370.1| PREDICTED: proliferation-associated protein 2G4 [Equus przewalskii]
Length=394

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_008846918.1| PREDICTED: proliferation-associated protein 2G4 [Nannospalax 
galili]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|XP_005335677.1| PREDICTED: proliferation-associated protein 2G4 [Ictidomys tridecemlineatus]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|NP_001271715.1| uncharacterized protein LOC101867185 [Macaca fascicularis]
 ref|XP_004650027.1| PREDICTED: proliferation-associated protein 2G4 [Jaculus jaculus]
 ref|XP_010376117.1| PREDICTED: proliferation-associated protein 2G4 [Rhinopithecus 
roxellana]
 dbj|BAE91123.1| unnamed protein product [Macaca fascicularis]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_010348255.1| PREDICTED: proliferation-associated protein 2G4 [Saimiri boliviensis 
boliviensis]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|NP_006182.2| proliferation-associated protein 2G4 [Homo sapiens]
 ref|NP_001233412.1| proliferation-associated protein 2G4 [Pan troglodytes]
 ref|XP_008575383.1| PREDICTED: proliferation-associated protein 2G4 [Galeopterus 
variegatus]
 ref|XP_008976873.1| PREDICTED: proliferation-associated protein 2G4 [Pan paniscus]
 ref|XP_009246137.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pongo 
abelii]
 sp|Q9UQ80.3|PA2G4_HUMAN RecName: Full=Proliferation-associated protein 2G4; AltName: 
Full=Cell cycle protein p38-2G4 homolog; Short=hG4-1; AltName: 
Full=ErbB3-binding protein 1 [Homo sapiens]
 pdb|3J2I|A Chain A, Structure Of Late Pre-60s Ribosomal Subunits With Nuclear 
Export Factor Arx1 Bound At The Peptide Exit Tunnel
 gb|AAD05561.1| cell cycle protein [Homo sapiens]
 gb|AAH01951.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|AAH07561.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|AAH69786.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|EAW96884.1| proliferation-associated 2G4, 38kDa, isoform CRA_a [Homo sapiens]
 gb|EAW96885.1| proliferation-associated 2G4, 38kDa, isoform CRA_a [Homo sapiens]
 gb|ABM84372.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 gb|ABM87750.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 dbj|BAG73585.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 dbj|BAK63634.1| proliferation-associated protein 2G4 [Pan troglodytes]
 gb|AIC49332.1| PA2G4, partial [synthetic construct]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|NP_001004206.1| proliferation-associated protein 2G4 [Rattus norvegicus]
 sp|Q6AYD3.1|PA2G4_RAT RecName: Full=Proliferation-associated protein 2G4 [Rattus norvegicus]
 gb|AAH79095.1| Proliferation-associated 2G4 [Rattus norvegicus]
 gb|EDL84836.1| proliferation-associated 2G4, isoform CRA_a [Rattus norvegicus]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_004274221.1| PREDICTED: proliferation-associated protein 2G4 [Orcinus orca]
 ref|XP_004312046.1| PREDICTED: proliferation-associated protein 2G4 [Tursiops truncatus]
 ref|XP_007129410.1| PREDICTED: proliferation-associated protein 2G4 [Physeter catodon]
 ref|XP_007179621.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007179622.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007467801.1| PREDICTED: proliferation-associated protein 2G4 [Lipotes vexillifer]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_005799891.1| PREDICTED: proliferation-associated protein 2G4-like [Xiphophorus 
maculatus]
Length=391

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 64/99 (65%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E E +ARLG+VEC  H+LLQP+ VLHEK G+ VA  
Sbjct  258  KTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECAKHELLQPFSVLHEKEGEFVAQF  317

Query  560  KFTVLLMPNGSDRITAHPL--QDLNVTKPIDDPEIKAWL  450
            KFTVLLM NG+ RIT  P   +       + DPE+KA L
Sbjct  318  KFTVLLMANGAHRITNGPFDPELYQSEHEVQDPELKALL  356



>ref|XP_004692692.1| PREDICTED: proliferation-associated protein 2G4 [Condylura cristata]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_006165654.1| PREDICTED: proliferation-associated protein 2G4 [Tupaia chinensis]
 gb|ELV12037.1| Proliferation-associated protein 2G4 [Tupaia chinensis]
Length=394

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_011059200.1| PREDICTED: proliferation-associated protein 2G4 [Acromyrmex echinatior]
 gb|EGI62683.1| Proliferation-associated protein 2G4 [Acromyrmex echinatior]
Length=386

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 68/100 (68%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E+S K  LMPF  R  E EK+A++ +VECVNH L++P+ VL+EKP +  A  
Sbjct  257  KASRMFYSEVSHKHGLMPFNLRTFEDEKKAKMAVVECVNHRLIEPFQVLYEKPNEYAAQF  316

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  450
            KFTVLLMPNG  +IT  P  DL++ +    +DDPE+K  L
Sbjct  317  KFTVLLMPNGPHKITGIPF-DLDMYQSDCVVDDPELKTLL  355



>pdb|2Q8K|A Chain A, The Crystal Structure Of Ebp1
Length=401

 Score =   102 bits (254),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  267  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  326

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  327  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  365



>ref|XP_010643016.1| PREDICTED: proliferation-associated protein 2G4 [Fukomys damarensis]
Length=394

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|AAB91536.1| cell cycle protein p38-2G4 homolog [Homo sapiens]
Length=394

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_004589712.1| PREDICTED: proliferation-associated protein 2G4 [Ochotona princeps]
Length=394

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|XP_009179195.1| PREDICTED: proliferation-associated protein 2G4 [Papio anubis]
Length=384

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|NP_001085830.1| ErbB3-binding protein 1 [Xenopus laevis]
 gb|AAH73401.1| MGC80858 protein [Xenopus laevis]
Length=390

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDSELKALL  358



>ref|XP_004379999.1| PREDICTED: proliferation-associated protein 2G4 [Trichechus manatus 
latirostris]
Length=394

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_003476243.1| PREDICTED: proliferation-associated protein 2G4 [Cavia porcellus]
Length=394

 Score =   102 bits (254),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_003405168.1| PREDICTED: proliferation-associated protein 2G4 [Loxodonta africana]
Length=394

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_008939686.1| PREDICTED: proliferation-associated protein 2G4, partial [Merops 
nubicus]
Length=232

 Score =   100 bits (249),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  98   KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  157

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  158  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  196



>ref|NP_001008439.1| ErbB3-binding protein 1 [Xenopus (Silurana) tropicalis]
 gb|AAH80337.1| MGC79578 protein [Xenopus (Silurana) tropicalis]
Length=390

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + D+  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDMYKSELEVQDSELKALL  358



>emb|CAJ82581.1| proliferation-associated 2G4 [Xenopus (Silurana) tropicalis]
Length=367

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + D+  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDMYKSELEVQDSELKALL  358



>gb|EHB06549.1| Proliferation-associated protein 2G4, partial [Heterocephalus 
glaber]
Length=349

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  236  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  295

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  296  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  334



>ref|XP_005397344.1| PREDICTED: proliferation-associated protein 2G4 [Chinchilla lanigera]
Length=394

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFKPDLYKSEMEVQDAELKALL  358



>ref|XP_005371237.1| PREDICTED: proliferation-associated protein 2G4 [Microtus ochrogaster]
Length=394

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEYVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_004649070.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated 2G4, 
38kDa [Octodon degus]
Length=394

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFKPDLYKSEMEVQDAELKALL  358



>ref|XP_004890349.1| PREDICTED: proliferation-associated protein 2G4 [Heterocephalus 
glaber]
Length=390

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  256  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  315

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  316  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  354



>ref|XP_011409574.1| PREDICTED: proliferation-associated protein 2G4-like [Amphimedon 
queenslandica]
Length=279

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 70/101 (69%), Gaps = 5/101 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEK-RARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K+SR  + E+  KF +MPF+ R  EE+ +AR+G+VEC NH+LL+P+ VL+EK G+ VA  
Sbjct  149  KSSRAFFSEVCSKFDVMPFSLRSFEEEGKARMGVVECTNHNLLEPFHVLYEKEGEFVAQF  208

Query  560  KFTVLLMPNGSDRITAHPLQD---LNVTKPIDDPEIKAWLA  447
            KFTVLLMPNG  +IT + L D   +  T  +DD E+K  LA
Sbjct  209  KFTVLLMPNGPLKIT-NTLFDPSVIESTNKLDDAELKTLLA  248



>ref|XP_002605416.1| hypothetical protein BRAFLDRAFT_278505 [Branchiostoma floridae]
 gb|EEN61426.1| hypothetical protein BRAFLDRAFT_278505 [Branchiostoma floridae]
Length=378

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 73/101 (72%), Gaps = 5/101 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  + +++ +F  MPFT R ++ EK+AR+G+VECVNH+LL P+PVL+E+ G+ VA  
Sbjct  249  KASRAFFSDVANRFATMPFTLRLMDDEKKARMGVVECVNHELLTPFPVLYEREGEFVAQF  308

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWLA  447
            KFTVLLMPNG+ R+T  P  D ++ K    + D +IKA L+
Sbjct  309  KFTVLLMPNGNIRLTEGPF-DPDMIKSEHQVTDEKIKAVLS  348



>gb|KFQ91587.1| Proliferation-associated protein 2G4, partial [Nipponia nippon]
Length=344

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  229  KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  288

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  289  KFTVLLMPNGPMRITSGPFEPDLYKSEFEVQDGELKALL  327



>ref|XP_009468808.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Nipponia nippon]
Length=377

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  243  KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  302

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  303  KFTVLLMPNGPMRITSGPFEPDLYKSEFEVQDGELKALL  341



>ref|XP_004006644.1| PREDICTED: proliferation-associated protein 2G4 [Ovis aries]
Length=394

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDVELKALL  358



>ref|XP_002163189.2| PREDICTED: proliferation-associated protein 2G4-like [Hydra vulgaris]
Length=400

 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/101 (54%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E+  KF +MPFT R  E EK+ARLG+ EC NH+L+ PYPVL+EK G+ VA  
Sbjct  261  KASRNFYSEVCNKFTMMPFTLRAFEDEKKARLGVNECTNHELITPYPVLYEKDGEYVAQF  320

Query  560  KFTVLLMPNGSDRITAHPLQD---LNVTKPIDDPEIKAWLA  447
            KFTVLLMPNG  RIT H   D   +     I D E+K  L+
Sbjct  321  KFTVLLMPNGPLRIT-HGTWDPELVQSEYSIKDEELKKILS  360



>ref|XP_003506238.1| PREDICTED: proliferation-associated protein 2G4 [Cricetulus griseus]
 ref|XP_007633754.1| PREDICTED: proliferation-associated protein 2G4 [Cricetulus griseus]
 gb|EGW12518.1| Proliferation-associated protein 2G4 [Cricetulus griseus]
 gb|ERE91717.1| proliferation-associated protein 2G4-like protein [Cricetulus 
griseus]
Length=394

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  +   + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSDMEVQDAELKALL  358



>ref|XP_011400941.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
 gb|KFM27934.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
Length=353

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 65/97 (67%), Gaps = 12/97 (12%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIK  558
            KASR +  EI++KFP M +            GL+EC+NH+LLQP+PVL+EKP  LVAH K
Sbjct  248  KASREVLSEINKKFPTMMY------------GLLECINHNLLQPFPVLYEKPDALVAHFK  295

Query  557  FTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  447
             TVLL+P+G DRIT   LQ L   K I+D E+KA LA
Sbjct  296  GTVLLVPSGVDRITNSTLQALESDKSIEDAEVKALLA  332



>ref|XP_008641741.1| PREDICTED: proliferation-associated protein 2G4 [Corvus brachyrhynchos]
Length=340

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 11/103 (11%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+LVA  
Sbjct  206  KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGELVAQF  265

Query  560  KFTVLLMPNGSDRITAHPLQ------DLNVTKPIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P +      DL V     D E+KA L
Sbjct  266  KFTVLLMPNGPMRITSGPFEPELYKSDLEV----QDGELKALL  304



>ref|XP_006629280.1| PREDICTED: proliferation-associated protein 2G4-like [Lepisosteus 
oculatus]
Length=394

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E E +ARLG+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRVFFSEVERRFDGMPFTLRAFEDEGKARLGVVECAKHELLQPFNVLYEKEGENVAQF  319

Query  560  KFTVLLMPNGSDRITAHPL-QDLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P  Q+L  ++  + DPE+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFDQELYKSEHEVQDPELKALL  358



>ref|XP_005431428.1| PREDICTED: proliferation-associated protein 2G4-like [Geospiza 
fortis]
Length=340

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 11/103 (11%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R LE EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  206  KTSRAFFSEVERRFDTMPFTLRALEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  265

Query  560  KFTVLLMPNGSDRITAHPLQ------DLNVTKPIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P +      DL V     D E+KA L
Sbjct  266  KFTVLLMPNGPMRITSGPFEPELYKSDLEV----QDGELKALL  304



>ref|XP_004601656.1| PREDICTED: proliferation-associated protein 2G4 [Sorex araneus]
Length=394

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDVELKALL  358



>gb|AAH19222.1| PA2G4 protein, partial [Homo sapiens]
Length=406

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  290  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  349

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  350  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  388



>gb|KFQ30813.1| Proliferation-associated protein 2G4, partial [Merops nubicus]
Length=221

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  99   KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  158

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  159  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDGELKALL  197



>ref|XP_007953297.1| PREDICTED: proliferation-associated protein 2G4 [Orycteropus 
afer afer]
Length=394

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDVELKALL  358



>ref|NP_001083993.1| proliferation-associated 2G4, 38kD [Xenopus laevis]
 gb|AAH84760.1| Pa2g4 protein [Xenopus laevis]
Length=390

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEYVAQY  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDSELKALL  358



>ref|XP_004700624.1| PREDICTED: proliferation-associated protein 2G4 [Echinops telfairi]
Length=394

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + D+  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPDIYKSEMEVQDAELKALL  358



>ref|XP_005533908.1| PREDICTED: proliferation-associated protein 2G4 [Pseudopodoces 
humilis]
Length=401

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 11/103 (11%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R LE EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  267  KTSRAFFSEVERRFDTMPFTLRALEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  326

Query  560  KFTVLLMPNGSDRITAHPLQ------DLNVTKPIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P +      DL V     D E+KA L
Sbjct  327  KFTVLLMPNGPMRITSGPFEPELYKSDLEV----QDGELKALL  365



>gb|KDR23244.1| Proliferation-associated protein 2G4 [Zootermopsis nevadensis]
Length=395

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLEE-KRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E++ K   MPF  R  E+ K+A++ +VECVNH L++P+ VL+EK G+LVAH 
Sbjct  265  KASRMFYSEVTHKHGSMPFNLRSFEDAKKAKMAVVECVNHKLIEPFQVLYEKSGELVAHF  324

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  +IT  P + +L  ++  I DPE+K+ L
Sbjct  325  KFTVLLMPNGPHKITGLPFEPELCQSEYTIGDPELKSLL  363



>ref|XP_006987432.1| PREDICTED: proliferation-associated protein 2G4 [Peromyscus maniculatus 
bairdii]
Length=373

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  239  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  298

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  299  KFTVLLMPNGPMRITSGPFEPELYKSEMEVQDAELKALL  337



>gb|EWM29247.1| proliferation-associated protein 2g4 [Nannochloropsis gaditana]
Length=788

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 64/80 (80%), Gaps = 1/80 (1%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR+++ E++ +FP +PFT R LE EK+AR+G+VEC+ HDLL PYPVL E+PGD+V H 
Sbjct  278  KASRYVFNEMNHRFPTLPFTLRALEDEKQARMGVVECLKHDLLHPYPVLMERPGDIVVHF  337

Query  560  KFTVLLMPNGSDRITAHPLQ  501
            K T+LL+P+G+ ++T  P Q
Sbjct  338  KATILLLPSGTAKVTGLPHQ  357



>ref|XP_006815930.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Saccoglossus kowalevskii]
Length=343

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  + E+ ++F LMPFT R  E EK+AR+G+VECV H L+ P+PVL+EK G+ VA  
Sbjct  205  KASRMFFSEMERRFNLMPFTLRAFEDEKKARMGVVECVKHGLVDPFPVLYEKDGEFVAQF  264

Query  560  KFTVLLMPNGSDRITAHPL--QDLNVTKPIDDPEIKAWLA  447
            KFTVLLMPNG  +IT  P   +  +    I+D ++K  L 
Sbjct  265  KFTVLLMPNGPQKITDGPFDPEIYDTEYKIEDSQLKTLLT  304



>ref|XP_002734317.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Saccoglossus kowalevskii]
Length=396

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  + E+ ++F LMPFT R  E EK+AR+G+VECV H L+ P+PVL+EK G+ VA  
Sbjct  258  KASRMFFSEMERRFNLMPFTLRAFEDEKKARMGVVECVKHGLVDPFPVLYEKDGEFVAQF  317

Query  560  KFTVLLMPNGSDRITAHPL--QDLNVTKPIDDPEIKAWLA  447
            KFTVLLMPNG  +IT  P   +  +    I+D ++K  L 
Sbjct  318  KFTVLLMPNGPQKITDGPFDPEIYDTEYKIEDSQLKTLLT  357



>ref|XP_780193.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
1 [Strongylocentrotus purpuratus]
Length=402

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 72/100 (72%), Gaps = 5/100 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            + SR  + E++++F  MPF+ R  E E +AR+G+VEC+NH+L++PYPVL+EK G+ VA  
Sbjct  259  RTSRTFFSELTKRFTTMPFSLRSFEDEGKARMGIVECLNHNLVEPYPVLYEKDGEFVAQF  318

Query  560  KFTVLLMPNGSDRITAHPLQDLNV---TKPIDDPEIKAWL  450
            KFTVLLMPNG  +IT  P+ DL++    K ++D E+K  L
Sbjct  319  KFTVLLMPNGPLKITGLPV-DLSLYPSDKSVEDKELKELL  357



>gb|AAH44287.1| Pa2g4 protein, partial [Xenopus laevis]
Length=395

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  265  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEYVAQY  324

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  325  KFTVLLMPNGPMRITSGPFEPDLYKSELEVQDSELKALL  363



>ref|XP_004085494.1| PREDICTED: proliferation-associated protein 2G4-like [Oryzias 
latipes]
Length=391

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 62/99 (63%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R LE E +ARLG+VEC  H+LLQP+ VLHEK G+ VA  
Sbjct  258  KTSRTFFSEVERRFDAMPFTLRALEDEAKARLGVVECTKHELLQPFSVLHEKEGEFVAQF  317

Query  560  KFTVLLMPNGSDRITAHPLQD--LNVTKPIDDPEIKAWL  450
            KFTVLLM NG  RIT  P           + DPE+K  L
Sbjct  318  KFTVLLMANGPHRITNGPFDSEFYKSEHEVQDPELKTLL  356



>gb|ETE68956.1| Proliferation-associated protein 2G4 [Ophiophagus hannah]
Length=367

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R LE EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  233  KTSRAFFSEVERRFDAMPFTLRALEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  292

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D ++KA L
Sbjct  293  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDADLKALL  331



>ref|XP_007533407.1| PREDICTED: proliferation-associated protein 2G4 [Erinaceus europaeus]
Length=394

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPELYKSELEVQDAELKALL  358



>ref|XP_003223249.1| PREDICTED: proliferation-associated protein 2G4 [Anolis carolinensis]
Length=394

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDAELKALL  358



>ref|XP_001363571.1| PREDICTED: proliferation-associated protein 2G4 [Monodelphis 
domestica]
Length=394

 Score =   100 bits (250),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFEPELYKSELEVQDAELKALL  358



>ref|XP_003703942.1| PREDICTED: proliferation-associated protein 2G4-like [Megachile 
rotundata]
Length=387

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 67/101 (66%), Gaps = 5/101 (5%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            KASR  Y E++ K  LMPF  R  E EK+A++ +VECVNH L++P+ VL+EKP +  A  
Sbjct  258  KASRMFYSEVTHKHGLMPFNLRTFEDEKKAKMAVVECVNHRLIEPFQVLYEKPNEFAAQF  317

Query  560  KFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWLA  447
            KFTVLLMPNG  +IT  P  DL+V +    + DPE+K  L 
Sbjct  318  KFTVLLMPNGPHKITGIPF-DLDVYQSDCVVKDPELKTLLC  357



>gb|KGL81710.1| Proliferation-associated protein 2G4, partial [Tinamus guttatus]
Length=344

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  229  KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  288

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  289  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDAELKALL  327



>gb|KFP70431.1| Proliferation-associated protein 2G4, partial [Acanthisitta chloris]
Length=251

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  136  KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  195

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  +   + D E+KA L
Sbjct  196  KFTVLLMPNGPMRITSGPFEPELYKSDFEVQDGELKALL  234



>ref|XP_009073732.1| PREDICTED: proliferation-associated protein 2G4, partial [Acanthisitta 
chloris]
Length=263

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 68/99 (69%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  129  KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  188

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  +   + D E+KA L
Sbjct  189  KFTVLLMPNGPMRITSGPFEPELYKSDFEVQDGELKALL  227



>ref|XP_006859475.1| PREDICTED: proliferation-associated protein 2G4 [Chrysochloris 
asiatica]
Length=394

 Score =   100 bits (249),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDL-EEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R   +EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  260  KTSRAFFSEVERRFDAMPFTLRAFKDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  319

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  320  KFTVLLMPNGPMRITSGPFKPDLYKSEMEVQDAELKALL  358



>ref|XP_010219357.1| PREDICTED: proliferation-associated protein 2G4 [Tinamus guttatus]
Length=340

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 69/99 (70%), Gaps = 3/99 (3%)
 Frame = -2

Query  737  KASRFIYXEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHI  561
            K SR  + E+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQP+ VL+EK G+ VA  
Sbjct  206  KTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECAKHELLQPFNVLYEKEGEFVAQF  265

Query  560  KFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  450
            KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  266  KFTVLLMPNGPMRITSGPFEPELYKSEFEVQDAELKALL  304



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515