BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038H02

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004252814.1|  PREDICTED: tubulin alpha-2 chain-like              358   4e-122   Solanum lycopersicum
emb|CAJ38386.1|  alpha tubulin                                          359   1e-121   Plantago major [cart-track plant]
gb|AHM93474.1|  alpha-tubulin                                           360   2e-121   Camellia chekiangoleosa
gb|EYU34085.1|  hypothetical protein MIMGU_mgv1a0196712mg               356   3e-121   Erythranthe guttata [common monkey flower]
gb|AFR42020.1|  alpha-tubulin                                           355   3e-121   Populus trichocarpa [western balsam poplar]
gb|AFR42026.1|  alpha-tubulin                                           355   3e-121   Populus trichocarpa [western balsam poplar]
gb|KJB58759.1|  hypothetical protein B456_009G224800                    360   4e-121   Gossypium raimondii
gb|AFR42049.1|  alpha-tubulin                                           355   4e-121   Populus fremontii
gb|AFR42035.1|  alpha-tubulin                                           355   4e-121   Populus alba [abele]
gb|AFR42036.1|  alpha-tubulin                                           355   5e-121   Populus alba [abele]
gb|AFR42054.1|  alpha-tubulin                                           354   5e-121   Populus fremontii
gb|AFR42042.1|  alpha-tubulin                                           354   6e-121   Populus fremontii
gb|AFR42047.1|  alpha-tubulin                                           354   6e-121   Populus fremontii
ref|XP_006433708.1|  hypothetical protein CICLE_v100015522mg            354   1e-120   
gb|AAW57305.1|  alpha-tubulin                                           357   2e-120   Ceratopteris richardii
gb|KJB32211.1|  hypothetical protein B456_005G229600                    359   2e-120   Gossypium raimondii
gb|AHZ58481.1|  alpha-tubulin                                           353   3e-120   Syntrichia caninervis
gb|AAW57310.1|  alpha-tubulin                                           355   3e-120   Ceratopteris richardii
gb|AAW57309.1|  alpha-tubulin                                           355   3e-120   Ceratopteris richardii
emb|CAB76917.1|  alpha-tubulin 4                                        355   6e-120   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS62716.1|  alpha-tubulin                                           359   6e-120   Genlisea aurea
gb|AHJ80819.1|  Tua1                                                    353   1e-119   Eragrostis tef [tef]
gb|KIY91712.1|  Tubulin alpha chain                                     353   1e-119   Monoraphidium neglectum
gb|KJB58756.1|  hypothetical protein B456_009G224800                    359   1e-119   Gossypium raimondii
gb|ABB02631.1|  unknown                                                 360   1e-119   Solanum tuberosum [potatoes]
gb|KDO81349.1|  hypothetical protein CISIN_1g013037mg                   357   2e-119   Citrus sinensis [apfelsine]
gb|KGN48654.1|  hypothetical protein Csa_6G497050                       359   2e-119   
dbj|BAH19954.1|  AT1G50010                                              352   2e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009605705.1|  PREDICTED: tubulin alpha-2 chain-like              360   2e-119   Nicotiana tomentosiformis
ref|XP_004244533.1|  PREDICTED: tubulin alpha-3 chain-like              360   2e-119   Solanum lycopersicum
ref|XP_006362511.1|  PREDICTED: tubulin alpha-1 chain-like              360   2e-119   
emb|CAD13176.1|  alpha-tubulin                                          360   2e-119   Nicotiana tabacum [American tobacco]
gb|ACH68563.1|  alpha-tubulin                                           360   2e-119   Solanum tuberosum [potatoes]
ref|XP_009790136.1|  PREDICTED: tubulin alpha chain                     360   2e-119   Nicotiana sylvestris
ref|XP_009620798.1|  PREDICTED: tubulin alpha chain                     360   2e-119   Nicotiana tomentosiformis
ref|XP_006356798.1|  PREDICTED: tubulin alpha chain-like                360   2e-119   Solanum tuberosum [potatoes]
ref|XP_004238046.1|  PREDICTED: tubulin alpha chain                     360   2e-119   
ref|NP_001275271.1|  alpha-tubulin-like protein                         360   2e-119   Solanum tuberosum [potatoes]
ref|XP_009614122.1|  PREDICTED: tubulin alpha-3 chain                   360   2e-119   Nicotiana tomentosiformis
dbj|BAF01952.1|  putative tubulin alpha-2/alpha-4 chain                 350   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|ABP65320.1|  alpha tubulin                                           359   3e-119   Capsicum annuum
gb|ABC59068.2|  alpha tubulin 1                                         359   3e-119   Camellia sinensis [black tea]
ref|WP_039310890.1|  hypothetical protein                               358   6e-119   
emb|CAA52158.1|  alpha tubulin                                          351   7e-119   Zea mays [maize]
gb|EYU34660.1|  hypothetical protein MIMGU_mgv1a006269mg                358   7e-119   Erythranthe guttata [common monkey flower]
gb|AAW57306.1|  alpha-tubulin                                           351   9e-119   Ceratopteris richardii
dbj|BAB19779.1|  alpha tubulin                                          358   9e-119   Nicotiana tabacum [American tobacco]
gb|ADW83724.1|  alpha-tubulin                                           357   9e-119   Musa acuminata AAA Group [Cavendish banana]
emb|CDP02221.1|  unnamed protein product                                358   1e-118   Coffea canephora [robusta coffee]
ref|XP_011098608.1|  PREDICTED: tubulin alpha chain                     358   1e-118   Sesamum indicum [beniseed]
gb|EYU37544.1|  hypothetical protein MIMGU_mgv1a007145mg                357   1e-118   Erythranthe guttata [common monkey flower]
ref|NP_001291325.1|  tubulin alpha chain-like                           358   1e-118   Sesamum indicum [beniseed]
gb|KDO49533.1|  hypothetical protein CISIN_1g013062mg                   357   1e-118   Citrus sinensis [apfelsine]
emb|CAN62392.1|  hypothetical protein VITISV_016172                     357   1e-118   Vitis vinifera
ref|NP_001289660.1|  tubulin alpha chain-like                           358   1e-118   Eucalyptus grandis [rose gum]
ref|XP_003608582.1|  Tubulin alpha-5 chain                              358   1e-118   Medicago truncatula
ref|XP_001764722.1|  predicted protein                                  357   2e-118   
ref|XP_010242419.1|  PREDICTED: tubulin alpha-1 chain                   357   2e-118   Nelumbo nucifera [Indian lotus]
ref|XP_007032501.1|  Tubulin alpha-2 chain                              357   2e-118   
ref|XP_007018369.1|  Tubulin alpha-2 chain                              357   2e-118   Theobroma cacao [chocolate]
ref|XP_006426173.1|  hypothetical protein CICLE_v10025588mg             357   2e-118   Citrus clementina [clementine]
ref|XP_008804464.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Phoenix dactylifera
gb|ACN40181.1|  unknown                                                 357   2e-118   Picea sitchensis
ref|XP_002283198.1|  PREDICTED: tubulin alpha chain                     357   2e-118   Vitis vinifera
ref|XP_002981542.1|  hypothetical protein SELMODRAFT_178975             357   2e-118   Selaginella moellendorffii
ref|XP_002510010.1|  tubulin alpha chain, putative                      357   2e-118   Ricinus communis
ref|XP_011457777.1|  PREDICTED: tubulin alpha chain                     357   2e-118   Fragaria vesca subsp. vesca
gb|KHG18997.1|  Tubulin alpha chain                                     357   2e-118   Gossypium arboreum [tree cotton]
ref|XP_009335354.1|  PREDICTED: tubulin alpha chain                     357   2e-118   Pyrus x bretschneideri [bai li]
ref|XP_010093625.1|  Tubulin alpha chain                                357   2e-118   Morus notabilis
gb|ABX57816.1|  alpha tubulin                                           357   2e-118   Picea wilsonii
gb|AAV92352.1|  alpha tubulin 1                                         357   2e-118   Pseudotsuga menziesii var. menziesii
ref|XP_010099392.1|  Tubulin alpha chain                                358   2e-118   
ref|XP_004288297.1|  PREDICTED: tubulin alpha-3 chain                   357   2e-118   Fragaria vesca subsp. vesca
ref|XP_007205183.1|  hypothetical protein PRUPE_ppa005613mg             357   2e-118   Prunus persica
ref|XP_008372961.1|  PREDICTED: tubulin alpha chain isoform X1          357   2e-118   Malus domestica [apple tree]
gb|KDP32140.1|  hypothetical protein JCGZ_12601                         357   2e-118   Jatropha curcas
ref|XP_010065856.1|  PREDICTED: tubulin alpha chain                     357   2e-118   Eucalyptus grandis [rose gum]
ref|XP_006422747.1|  hypothetical protein CICLE_v10028426mg             357   2e-118   Citrus clementina [clementine]
ref|XP_010266793.1|  PREDICTED: tubulin alpha chain                     357   2e-118   Nelumbo nucifera [Indian lotus]
ref|XP_010526692.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Tarenaya hassleriana [spider flower]
gb|AID52921.1|  tubulin alpha chain                                     357   2e-118   Carthamus tinctorius
gb|ABO47740.1|  alpha-tubulin                                           357   2e-118   Gossypium hirsutum [American cotton]
ref|XP_006466394.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    357   2e-118   Citrus sinensis [apfelsine]
ref|XP_002522104.1|  tubulin alpha chain, putative                      357   2e-118   Ricinus communis
sp|P46259.1|TBA1_PEA  RecName: Full=Tubulin alpha-1 chain               357   2e-118   Pisum sativum [garden pea]
ref|XP_010943272.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Elaeis guineensis
ref|XP_008787237.1|  PREDICTED: tubulin alpha chain                     357   2e-118   Phoenix dactylifera
gb|AIX10966.1|  tubulin                                                 357   2e-118   Ornithogalum longebracteatum [sea-onion]
sp|P33629.1|TBA_PRUDU  RecName: Full=Tubulin alpha chain                357   2e-118   Prunus dulcis [sweet almond]
gb|ABO47739.1|  alpha-tubulin                                           357   2e-118   Gossypium hirsutum [American cotton]
ref|XP_010245599.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Nelumbo nucifera [Indian lotus]
ref|XP_008455054.1|  PREDICTED: tubulin alpha-4 chain isoform X1        357   2e-118   Cucumis melo [Oriental melon]
gb|KDP44552.1|  hypothetical protein JCGZ_16385                         357   2e-118   Jatropha curcas
gb|ACJ60905.1|  alpha tubulin                                           357   2e-118   Betula pendula [white birch]
ref|XP_003635553.2|  PREDICTED: tubulin alpha chain-like                357   2e-118   Vitis vinifera
ref|XP_007199840.1|  hypothetical protein PRUPE_ppa005633mg             357   2e-118   Prunus persica
ref|XP_004136930.1|  PREDICTED: tubulin alpha-4 chain-like              357   2e-118   Cucumis sativus [cucumbers]
gb|ABO47736.1|  alpha-tubulin                                           357   2e-118   Gossypium hirsutum [American cotton]
ref|XP_010555432.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Tarenaya hassleriana [spider flower]
sp|Q6VAF9.1|TBA4_GOSHI  RecName: Full=Tubulin alpha-4 chain; AltN...    357   2e-118   Gossypium hirsutum [American cotton]
gb|AGG37283.1|  alpha-tubulin 1                                         357   2e-118   Salix arbutifolia
ref|XP_003522731.1|  PREDICTED: tubulin alpha-4 chain isoform X1        357   2e-118   Glycine max [soybeans]
ref|XP_003603670.1|  Tubulin alpha-7 chain                              357   2e-118   Medicago truncatula
ref|XP_004232226.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Solanum lycopersicum
ref|XP_010531321.1|  PREDICTED: tubulin alpha chain isoform X1          357   2e-118   Tarenaya hassleriana [spider flower]
ref|XP_004501073.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Cicer arietinum [garbanzo]
ref|XP_010256937.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Nelumbo nucifera [Indian lotus]
ref|XP_010939312.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Elaeis guineensis
ref|XP_007137281.1|  hypothetical protein PHAVU_009G114100g             357   2e-118   Phaseolus vulgaris [French bean]
ref|XP_009335355.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Pyrus x bretschneideri [bai li]
ref|XP_008440459.1|  PREDICTED: tubulin alpha chain-like isoform X1     357   2e-118   Cucumis melo [Oriental melon]
ref|XP_004143417.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Cucumis sativus [cucumbers]
ref|XP_010936237.1|  PREDICTED: tubulin alpha chain-like                357   2e-118   Elaeis guineensis
ref|XP_002301128.1|  hypothetical protein POPTR_0002s11250g             357   3e-118   Populus trichocarpa [western balsam poplar]
ref|XP_002275973.1|  PREDICTED: tubulin alpha chain                     357   3e-118   Vitis vinifera
ref|XP_009626810.1|  PREDICTED: tubulin alpha chain-like                357   3e-118   Nicotiana tomentosiformis
gb|KDP41548.1|  hypothetical protein JCGZ_15955                         357   3e-118   Jatropha curcas
ref|XP_007042689.1|  Tubulin alpha-2 chain                              357   3e-118   Theobroma cacao [chocolate]
gb|AIX10773.1|  alpha tubulin                                           357   3e-118   Panax notoginseng [san-qi]
gb|AEQ75493.1|  alpha-tubulin                                           356   3e-118   Rosa multiflora [Japanese rose]
gb|AGG37289.1|  alpha-tubulin 7                                         357   3e-118   Salix arbutifolia
gb|KHN08201.1|  Tubulin alpha chain                                     357   4e-118   Glycine soja [wild soybean]
ref|XP_011008936.1|  PREDICTED: tubulin alpha chain                     357   4e-118   Populus euphratica
sp|P33623.1|TBA1_ANEPH  RecName: Full=Tubulin alpha-1 chain             357   4e-118   Anemia phyllitidis
gb|ACK76232.1|  alpha-tubulin                                           356   4e-118   Dimocarpus longan [longan]
ref|XP_007215369.1|  hypothetical protein PRUPE_ppa005626mg             356   4e-118   Prunus persica
ref|XP_004304311.1|  PREDICTED: tubulin alpha-2 chain-like              356   4e-118   Fragaria vesca subsp. vesca
ref|XP_008787760.1|  PREDICTED: tubulin alpha chain-like                356   5e-118   Phoenix dactylifera
ref|XP_006404742.1|  hypothetical protein EUTSA_v10000161mg             356   5e-118   Eutrema salsugineum [saltwater cress]
ref|XP_002324047.2|  hypothetical protein POPTR_0017s11740g             356   5e-118   
ref|XP_002959708.1|  alpha tubulin                                      349   5e-118   Volvox carteri f. nagariensis
ref|XP_002517492.1|  tubulin alpha chain, putative                      356   5e-118   Ricinus communis
ref|XP_008379344.1|  PREDICTED: tubulin alpha-2 chain                   356   5e-118   Malus domestica [apple tree]
gb|ABR25378.1|  tubulin alpha 3 chain                                   347   5e-118   Oryza sativa Indica Group [Indian rice]
gb|ABK92520.1|  unknown                                                 356   5e-118   Populus trichocarpa [western balsam poplar]
ref|XP_006581474.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    356   5e-118   
ref|XP_011030289.1|  PREDICTED: tubulin alpha-4 chain                   356   5e-118   Populus euphratica
ref|XP_004299843.1|  PREDICTED: tubulin alpha chain-like                356   5e-118   Fragaria vesca subsp. vesca
ref|XP_008621874.1|  tubulin alpha                                      350   5e-118   Saprolegnia diclina VS20
gb|ABQ59633.1|  alpha-tubulin 3                                         356   5e-118   Populus tremuloides
gb|AFW67749.1|  alpha tubulin4                                          351   6e-118   
gb|KEH43997.1|  tubulin beta-1 chain                                    356   6e-118   Medicago truncatula
ref|XP_004496862.1|  PREDICTED: tubulin alpha chain-like                356   6e-118   Cicer arietinum [garbanzo]
gb|AGG37285.1|  alpha-tubulin 3                                         356   6e-118   Salix arbutifolia
ref|XP_009409992.1|  PREDICTED: tubulin alpha chain-like                356   6e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002298794.2|  TUBULIN ALPHA CHAIN family protein                 356   6e-118   Populus trichocarpa [western balsam poplar]
ref|XP_007223365.1|  hypothetical protein PRUPE_ppa005617mg             356   6e-118   Prunus persica
gb|AAX96763.1|  Tubulin/FtsZ family, GTPase domain, putative            352   6e-118   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009388502.1|  PREDICTED: tubulin alpha-2 chain isoform X1        356   7e-118   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003536570.1|  PREDICTED: tubulin alpha chain-like isoform X1     356   7e-118   Glycine max [soybeans]
ref|XP_003556001.1|  PREDICTED: tubulin alpha-4 chain-like isofor...    356   7e-118   Glycine max [soybeans]
gb|KDO81348.1|  hypothetical protein CISIN_1g013037mg                   355   7e-118   Citrus sinensis [apfelsine]
ref|XP_006472372.1|  PREDICTED: tubulin alpha chain isoform X1          356   7e-118   Citrus sinensis [apfelsine]
gb|AAB36609.1|  alpha-tubulin                                           353   7e-118   Eucalyptus globulus subsp. bicostata
gb|KIZ01406.1|  Tubulin alpha-1 chain                                   356   7e-118   Monoraphidium neglectum
ref|XP_009402887.1|  PREDICTED: tubulin alpha chain                     356   7e-118   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW67748.1|  alpha tubulin4                                          353   8e-118   
gb|AAO73546.1|  alpha-tubulin                                           355   8e-118   Ceratopteris richardii
ref|XP_011014531.1|  PREDICTED: tubulin alpha-4 chain-like              356   8e-118   Populus euphratica
sp|Q6VAG0.1|TBA2_GOSHI  RecName: Full=Tubulin alpha-2 chain; AltN...    355   8e-118   Gossypium hirsutum [American cotton]
gb|KDO81347.1|  hypothetical protein CISIN_1g013037mg                   355   8e-118   Citrus sinensis [apfelsine]
ref|XP_010104543.1|  Tubulin alpha chain                                355   8e-118   
ref|XP_007143142.1|  hypothetical protein PHAVU_007G047300g             355   9e-118   Phaseolus vulgaris [French bean]
ref|XP_003539228.1|  PREDICTED: tubulin alpha-2 chain-like              355   9e-118   Glycine max [soybeans]
ref|XP_007156677.1|  hypothetical protein PHAVU_002G007900g             355   9e-118   Phaseolus vulgaris [French bean]
gb|KHN42598.1|  Tubulin alpha-2 chain                                   355   9e-118   Glycine soja [wild soybean]
ref|XP_002962630.1|  hypothetical protein SELMODRAFT_230143             355   1e-117   
sp|Q6VAG1.1|TBA1_GOSHI  RecName: Full=Tubulin alpha-1 chain; AltN...    355   1e-117   Gossypium hirsutum [American cotton]
ref|XP_004150268.1|  PREDICTED: tubulin alpha chain-like                355   1e-117   Cucumis sativus [cucumbers]
ref|XP_003517369.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    355   1e-117   Glycine max [soybeans]
emb|CAD20821.1|  alpha tubulin                                          349   1e-117   Zea mays [maize]
ref|XP_002964078.1|  hypothetical protein SELMODRAFT_405729             355   1e-117   Selaginella moellendorffii
ref|XP_007515802.1|  alpha-tubulin                                      354   1e-117   Bathycoccus prasinos
ref|XP_003558668.1|  PREDICTED: tubulin alpha-2 chain-like              355   1e-117   Brachypodium distachyon [annual false brome]
dbj|BAJ06364.1|  alpha-tubulin                                          355   2e-117   Alopecurus aequalis
ref|XP_011088040.1|  PREDICTED: tubulin alpha chain                     355   2e-117   Sesamum indicum [beniseed]
gb|AAO46127.1|  alpha-tubulin                                           347   2e-117   Streblomastix strix
emb|CAB66336.1|  alpha-tubulin                                          355   2e-117   Betula pendula [white birch]
gb|ABD92937.1|  alpha tubulin-4A                                        355   2e-117   Triticum aestivum [Canadian hard winter wheat]
gb|ABD92936.1|  alpha tubulin-4D                                        355   2e-117   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010664458.1|  PREDICTED: tubulin alpha-4 chain                   355   2e-117   Vitis vinifera
dbj|BAC24800.1|  alpha tubulin                                          355   2e-117   Physcomitrella patens
gb|ABR25510.1|  tubulin alpha-1 chain                                   347   2e-117   Oryza sativa Indica Group [Indian rice]
ref|XP_006307493.1|  hypothetical protein CARUB_v10009117mg             354   2e-117   Capsella rubella
emb|CDY29334.1|  BnaA05g16010D                                          353   3e-117   Brassica napus [oilseed rape]
gb|ABQ59634.1|  alpha-tubulin 5                                         354   3e-117   Populus tremuloides
gb|AHJ80823.1|  Tua1                                                    354   3e-117   Eragrostis tef [tef]
gb|ABL61201.1|  alpha-tubulin                                           349   3e-117   Oxymonadida environmental sample
ref|XP_009407690.1|  PREDICTED: tubulin alpha chain-like                354   3e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007047652.1|  Tubulin alpha-2 chain                              356   3e-117   
ref|XP_010060142.1|  PREDICTED: tubulin alpha chain-like                354   3e-117   Eucalyptus grandis [rose gum]
ref|XP_010096739.1|  Tubulin alpha chain                                354   3e-117   
gb|AHJ80815.1|  Tua1                                                    354   3e-117   Eragrostis tef [tef]
gb|KHG20487.1|  Tubulin alpha chain                                     354   3e-117   Gossypium arboreum [tree cotton]
emb|CAA06619.1|  alpha-tubulin 1                                        354   3e-117   Eleusine indica [crabgrass]
sp|O22347.1|TBA1_ELEIN  RecName: Full=Tubulin alpha-1 chain; AltN...    354   3e-117   Eleusine indica [crabgrass]
gb|AFC88832.1|  putative tubulin alpha-3 chain                          354   3e-117   Miscanthus sinensis
ref|XP_004981922.1|  PREDICTED: tubulin alpha-1 chain-like              354   3e-117   Setaria italica
dbj|BAP59012.1|  alpha tubulin                                          354   3e-117   Taxus cuspidata [ichii]
ref|XP_008665337.1|  PREDICTED: tubulin alpha-1 chain-like              354   3e-117   
ref|XP_008665339.1|  PREDICTED: tubulin alpha-2 chain                   354   3e-117   Zea mays [maize]
gb|AGG37287.1|  alpha-tubulin 5                                         354   3e-117   Salix arbutifolia
ref|XP_011398411.1|  Tubulin alpha chain                                352   3e-117   Auxenochlorella protothecoides
gb|AEW46684.1|  beta-tubulin                                            354   4e-117   Ulva linza
gb|AHJ80817.1|  Tua1                                                    354   4e-117   Eragrostis tef [tef]
gb|ABO47742.1|  alpha-tubulin                                           354   4e-117   Gossypium hirsutum [American cotton]
dbj|BAJ06362.1|  alpha-tubulin                                          354   4e-117   Alopecurus aequalis
ref|NP_001167663.1|  tubulin alpha-3 chain                              354   4e-117   Zea mays [maize]
ref|XP_003560377.1|  PREDICTED: tubulin alpha-1 chain                   354   4e-117   Brachypodium distachyon [annual false brome]
sp|Q9ZRR5.1|TBA3_HORVU  RecName: Full=Tubulin alpha-3 chain             354   4e-117   Hordeum vulgare [barley]
ref|XP_002313194.1|  hypothetical protein POPTR_0009s08850g             354   4e-117   Populus trichocarpa [western balsam poplar]
emb|CDO97305.1|  unnamed protein product                                354   4e-117   Coffea canephora [robusta coffee]
emb|CAD20820.1|  alpha tubulin                                          345   4e-117   Zea mays [maize]
tpg|DAA51109.1|  TPA: alpha tubulin                                     354   4e-117   
ref|XP_011002356.1|  PREDICTED: tubulin alpha chain-like                354   4e-117   Populus euphratica
ref|XP_002466535.1|  hypothetical protein SORBIDRAFT_01g009570          354   4e-117   
ref|XP_001777110.1|  predicted protein                                  350   5e-117   
emb|CAL35827.1|  alpha-2 tubulin                                        347   5e-117   Plantago major [cart-track plant]
emb|CDY66630.1|  BnaCnng51680D                                          353   5e-117   Brassica napus [oilseed rape]
ref|XP_006662856.1|  PREDICTED: tubulin alpha-3 chain-like              353   5e-117   Oryza brachyantha
gb|ABV55999.1|  alpha-tubulin 7                                         353   5e-117   Populus tremuloides
gb|KFK32793.1|  hypothetical protein AALP_AA6G289100                    353   5e-117   Arabis alpina [alpine rockcress]
ref|XP_006650518.1|  PREDICTED: tubulin alpha-1 chain-like              353   6e-117   Oryza brachyantha
gb|ABL61216.1|  alpha-tubulin                                           348   6e-117   Oxymonadida environmental sample
ref|XP_010680774.1|  PREDICTED: tubulin alpha-2 chain                   353   6e-117   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006650524.1|  PREDICTED: tubulin alpha-1 chain-like              353   6e-117   Oryza brachyantha
gb|ABF98641.1|  Tubulin alpha-1 chain, putative, expressed              352   6e-117   Oryza sativa Japonica Group [Japonica rice]
dbj|BAG99724.1|  unnamed protein product                                352   6e-117   Oryza sativa Japonica Group [Japonica rice]
gb|ABL61224.1|  alpha-tubulin                                           348   7e-117   Oxymonadida environmental sample
ref|XP_010500555.1|  PREDICTED: tubulin alpha-6 chain isoform X1        353   7e-117   Camelina sativa [gold-of-pleasure]
dbj|BAE99023.1|  tubulin alpha-2/alpha-4 chain                          353   7e-117   Arabidopsis thaliana [mouse-ear cress]
gb|ADJ00012.1|  tubulin alpha chain                                     345   7e-117   Chromera velia
ref|NP_171974.1|  tubulin alpha-4 chain                                 353   7e-117   Arabidopsis thaliana [mouse-ear cress]
gb|ABL61215.1|  alpha-tubulin                                           348   7e-117   Oxymonadida environmental sample
ref|XP_010507910.1|  PREDICTED: tubulin alpha-2 chain-like              353   7e-117   Camelina sativa [gold-of-pleasure]
gb|AAL16174.1|AF428406_1  AT4g14960/dl3520c                             353   7e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009147859.1|  PREDICTED: tubulin alpha-6 chain                   353   7e-117   Brassica rapa
ref|NP_193232.1|  tubulin alpha-6 chain                                 353   7e-117   Arabidopsis thaliana [mouse-ear cress]
gb|ABL61212.1|  alpha-tubulin                                           348   7e-117   Oxymonadida environmental sample
ref|XP_005851144.1|  alpha-tubulin                                      353   8e-117   Chlorella variabilis
gb|ACU19580.1|  unknown                                                 353   9e-117   Glycine max [soybeans]
gb|AAO46130.1|  alpha-tubulin                                           346   9e-117   Streblomastix strix
ref|XP_008341563.1|  PREDICTED: tubulin alpha-2 chain-like              353   1e-116   
ref|XP_009124556.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    353   1e-116   Brassica rapa
gb|ABD92930.1|  alpha tubulin-2A                                        353   1e-116   Triticum aestivum [Canadian hard winter wheat]
gb|KIZ03400.1|  Tubulin alpha chain                                     353   1e-116   Monoraphidium neglectum
gb|AAB08791.1|  alpha tubulin                                           353   1e-116   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|Q9ZRB7.1|TBA_WHEAT  RecName: Full=Tubulin alpha chain                353   1e-116   Triticum aestivum [Canadian hard winter wheat]
sp|Q96460.1|TBA2_HORVU  RecName: Full=Tubulin alpha-2 chain             353   1e-116   Hordeum vulgare [barley]
gb|AFK33477.1|  unknown                                                 349   1e-116   Lotus japonicus
gb|KDD76276.1|  tubulin/FtsZ GTPase                                     352   1e-116   Helicosporidium sp. ATCC 50920
gb|KJB29387.1|  hypothetical protein B456_005G097800                    352   1e-116   Gossypium raimondii
gb|AAO46128.1|  alpha-tubulin                                           345   2e-116   Streblomastix strix
ref|XP_010557535.1|  PREDICTED: tubulin alpha-2 chain-like isofor...    352   2e-116   Tarenaya hassleriana [spider flower]
ref|XP_002508010.1|  alpha tubulin 2                                    352   2e-116   Micromonas commoda
gb|ABL61219.1|  alpha-tubulin                                           347   2e-116   Oxymonadida environmental sample
gb|ABL61202.1|  alpha-tubulin                                           347   2e-116   Oxymonadida environmental sample
gb|ETM52928.1|  tubulin alpha chain                                     350   3e-116   Phytophthora parasitica
gb|ABL61204.1|  alpha-tubulin                                           346   3e-116   Oxymonadida environmental sample
gb|ABK92552.1|  unknown                                                 352   3e-116   Populus trichocarpa [western balsam poplar]
ref|XP_008384431.1|  PREDICTED: tubulin alpha-3 chain-like              345   3e-116   
gb|ACU20294.1|  unknown                                                 348   3e-116   Glycine max [soybeans]
ref|XP_005651460.1|  tubulin alpha chain                                352   3e-116   Coccomyxa subellipsoidea C-169
ref|XP_001770881.1|  predicted protein                                  352   3e-116   
ref|XP_003058621.1|  alpha tubulin                                      352   3e-116   Micromonas pusilla CCMP1545
gb|ABL61203.1|  alpha-tubulin                                           346   3e-116   Oxymonadida environmental sample
ref|XP_005643073.1|  tubulin alpha chain                                352   3e-116   Coccomyxa subellipsoidea C-169
gb|ABL61213.1|  alpha-tubulin                                           347   3e-116   Oxymonadida environmental sample
gb|ABL61217.1|  alpha-tubulin                                           347   4e-116   Oxymonadida environmental sample
gb|ABL61227.1|  alpha-tubulin                                           347   4e-116   Oxymonadida environmental sample
emb|CAA62916.1|  alpha-tubulin                                          351   4e-116   Oryza sativa Japonica Group [Japonica rice]
sp|P28287.1|TBA_OXYGR  RecName: Full=Tubulin alpha chain                351   4e-116   Oxytricha granulifera
gb|EJY81124.1|  Alpha tubulin,putative                                  351   4e-116   Oxytricha trifallax
emb|CDW82295.1|  alpha tubulin                                          351   4e-116   Stylonychia lemnae
emb|CEG01594.1|  Tubulin/FtsZ, 2-layer sandwich domain                  351   5e-116   Ostreococcus tauri
ref|NP_001051132.1|  Os03g0726100                                       351   5e-116   
gb|ABL61214.1|  alpha-tubulin                                           346   5e-116   Oxymonadida environmental sample
gb|AAT09063.1|  alpha tubulin 1                                         351   6e-116   Bigelowiella natans
ref|XP_003080933.1|  TBA_CHLVU Tubulin alpha chain (ISS)                352   6e-116   
gb|AAD11425.1|  alpha tubulin                                           348   6e-116   
ref|XP_010461854.1|  PREDICTED: tubulin alpha-6 chain-like              351   6e-116   
emb|CDP12358.1|  unnamed protein product                                351   7e-116   
ref|XP_001419217.1|  predicted protein                                  350   8e-116   
gb|KJB83378.1|  hypothetical protein B456_013G244600                    349   9e-116   
tpg|DAA41189.1|  TPA: alpha tubulin5                                    346   9e-116   
tpg|DAA63280.1|  TPA: alpha tubulin6                                    346   9e-116   
ref|XP_002782100.1|  Tubulin alpha chain, putative                      346   1e-115   
dbj|BAH20267.1|  AT5G19780                                              344   1e-115   
gb|ETW27380.1|  tubulin alpha chain                                     345   1e-115   
ref|XP_002980240.1|  hypothetical protein SELMODRAFT_419896             349   1e-115   
gb|AAO46126.1|  alpha-tubulin                                           343   1e-115   
emb|CDJ60085.1|  tubulin alpha chain, putative                          349   1e-115   
gb|AAQ81585.1|  putative tubulin alpha-2/alpha-4 chain                  350   1e-115   
gb|AHJ80821.1|  Tua3                                                    348   1e-115   
gb|AIA82433.1|  alpha-tubulin-like protein 01                           350   1e-115   
gb|AIA82435.1|  alpha-tubulin-like protein 03                           350   1e-115   
gb|ABR26150.1|  tubulin alpha-3 chain                                   340   1e-115   
gb|ABL61226.1|  alpha-tubulin                                           345   1e-115   
gb|ABU93324.1|  tubulin alpha subunit                                   350   1e-115   
ref|XP_002951007.1|  alpha tubulin                                      350   1e-115   
ref|XP_006431130.1|  hypothetical protein CICLE_v10011709mg             350   1e-115   
ref|XP_007512064.1|  alpha-tubulin                                      350   1e-115   
gb|KCW87067.1|  hypothetical protein EUGRSUZ_B03604                     347   2e-115   
gb|ABU93323.1|  tubulin alpha subunit                                   350   2e-115   
gb|ABL61218.1|  alpha-tubulin                                           345   2e-115   
gb|EPR58771.1|  alpha tubulin TUBA1                                     349   2e-115   
sp|Q9FT36.1|TBA_DAUCA  RecName: Full=Tubulin alpha chain                350   2e-115   
gb|ABO47737.1|  alpha-tubulin                                           350   2e-115   
ref|XP_008804327.1|  PREDICTED: tubulin alpha-1 chain-like              350   2e-115   
gb|ABG78593.1|  alpha-tubulin                                           350   2e-115   
gb|ETM53018.1|  tubulin alpha chain                                     342   2e-115   
gb|AEG74028.1|  alpha-tubulin                                           349   2e-115   
gb|EKF29047.1|  epsilon tubulin, putative                               342   2e-115   
gb|EWC76931.1|  tubulin alpha chain                                     345   2e-115   
gb|ACN40824.1|  unknown                                                 349   2e-115   
gb|KJB34154.1|  hypothetical protein B456_006G050600                    341   2e-115   
ref|XP_002677064.1|  alpha-tubulin                                      340   2e-115   
gb|EKF28172.1|  epsilon tubulin, putative                               342   2e-115   
ref|XP_009537046.1|  hypothetical protein PHYSODRAFT_340566             345   2e-115   
ref|XP_001777081.1|  predicted protein                                  349   3e-115   
gb|ADD84794.1|  tubulin-like protein                                    340   3e-115   
ref|NP_001067613.1|  Os11g0247300                                       349   3e-115   
gb|ABL61086.1|  alpha-tubulin                                           344   3e-115   
emb|CCD11782.1|  unnamed protein product                                342   3e-115   
ref|XP_009406530.1|  PREDICTED: tubulin alpha-3 chain-like              349   3e-115   
emb|CDP17586.1|  unnamed protein product                                349   3e-115   
ref|XP_002972670.1|  hypothetical protein SELMODRAFT_231979             349   3e-115   
gb|AEF79970.1|  alpha-tubulin protein                                   349   3e-115   
ref|XP_009400845.1|  PREDICTED: tubulin alpha-3 chain                   349   3e-115   
gb|AHJ80820.1|  Tua3                                                    347   3e-115   
gb|ETM30643.1|  tubulin alpha chain                                     349   3e-115   
sp|Q25563.1|TBA13_NAEGR  RecName: Full=Tubulin alpha-13 chain           349   3e-115   
ref|XP_006858944.1|  hypothetical protein AMTR_s00068p00090790          349   3e-115   
ref|XP_002285721.1|  PREDICTED: tubulin alpha-3 chain                   349   3e-115   
emb|CDJ53173.1|  tubulin alpha chain, putative                          349   3e-115   
ref|XP_002675196.1|  alpha-tubulin                                      349   3e-115   
gb|AIA82436.1|  alpha-tubulin-like protein 04                           350   3e-115   
emb|CBH08958.1|  alpha tubulin, (fragment)                              343   4e-115   
ref|XP_006445597.1|  hypothetical protein CICLE_v10015224mg             349   4e-115   
ref|XP_002989731.1|  hypothetical protein SELMODRAFT_130285             349   4e-115   
gb|AAT09064.1|  alpha tubulin 2                                         349   4e-115   
ref|XP_002364807.1|  tubulin alpha chain                                349   4e-115   
ref|XP_002976230.1|  hypothetical protein SELMODRAFT_105136             349   4e-115   
ref|XP_001782790.1|  predicted protein                                  348   4e-115   
ref|XP_008872990.1|  tubulin alpha chain                                349   4e-115   
ref|XP_009408459.1|  PREDICTED: tubulin alpha-3 chain-like              348   4e-115   
emb|CDI81818.1|  tubulin alpha chain, putative                          348   4e-115   
gb|ABP65323.1|  alpha tubulin                                           348   5e-115   
gb|EYU23006.1|  hypothetical protein MIMGU_mgv1a006283mg                348   5e-115   
ref|XP_001691876.1|  alpha tubulin 1                                    348   5e-115   
ref|XP_010673470.1|  PREDICTED: tubulin alpha-3 chain                   348   5e-115   
emb|CDJ42547.1|  tubulin alpha chain, putative                          348   5e-115   
ref|XP_002904195.1|  alpha-tubulin, putative                            348   5e-115   
gb|AAG28536.1|AF199019_1  alpha tubulin                                 339   5e-115   
gb|ABL61228.1|  alpha-tubulin                                           343   5e-115   
gb|ETO82054.1|  tubulin alpha chain                                     348   5e-115   
gb|ADP08782.1|  alpha tubulin                                           348   5e-115   
emb|CCI41153.1|  unnamed protein product                                348   5e-115   
ref|XP_008900864.1|  tubulin alpha chain                                348   5e-115   
ref|XP_002963093.1|  hypothetical protein SELMODRAFT_404672             348   5e-115   
gb|ETM52951.1|  tubulin alpha chain                                     348   6e-115   
sp|P33625.1|TBA_EUGGR  RecName: Full=Tubulin alpha chain                348   6e-115   
ref|XP_002962209.1|  hypothetical protein SELMODRAFT_230058             348   6e-115   
gb|ABL61206.1|  alpha-tubulin                                           348   6e-115   
ref|XP_008813089.1|  PREDICTED: tubulin alpha-3 chain                   348   6e-115   
ref|XP_003524707.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    348   6e-115   
emb|CBH08953.1|  alpha tubulin, (fragment)                              339   6e-115   
gb|AAK37831.1|AF182309_1  alpha-tubulin                                 348   6e-115   
ref|XP_002904194.1|  alpha-tubulin                                      348   6e-115   
ref|XP_009413318.1|  PREDICTED: tubulin alpha-3 chain-like              348   6e-115   
gb|ETP23198.1|  tubulin alpha chain                                     345   6e-115   
ref|XP_009842456.1|  tubulin alpha chain                                348   6e-115   
gb|KHN01709.1|  Tubulin alpha chain                                     348   6e-115   
gb|ABB16994.1|  unknown                                                 349   6e-115   
gb|ABL61205.1|  alpha-tubulin                                           347   6e-115   
gb|KHG14074.1|  Tubulin alpha-2 chain                                   346   7e-115   
ref|XP_008877307.1|  tubulin alpha chain                                345   7e-115   
gb|ABL61209.1|  alpha-tubulin                                           347   7e-115   
ref|XP_010257632.1|  PREDICTED: tubulin alpha-3 chain                   348   7e-115   
gb|KHG06160.1|  Tubulin alpha-3/alpha-5 chain -like protein             348   8e-115   
ref|XP_007155784.1|  hypothetical protein PHAVU_003G231500g             348   8e-115   
emb|CAD26891.1|  alpha-tubulin                                          348   8e-115   
gb|ABL61208.1|  alpha-tubulin                                           347   9e-115   
gb|AAU10519.1|  alpha tubulin                                           340   9e-115   
ref|XP_010923361.1|  PREDICTED: tubulin alpha-3 chain                   348   9e-115   
ref|XP_002303998.1|  alpha-tubulin 2 family protein                     348   9e-115   
ref|XP_004958110.1|  PREDICTED: tubulin alpha-3 chain-like              348   9e-115   
emb|CAD26886.1|  alpha-tubulin                                          348   1e-114   
ref|XP_011025144.1|  PREDICTED: tubulin alpha-3 chain                   348   1e-114   
ref|XP_002989721.1|  hypothetical protein SELMODRAFT_235864             348   1e-114   
ref|NP_001060075.1|  Os07g0574800                                       348   1e-114   
ref|XP_002904167.1|  cleavage induced tubulin alpha chain               343   1e-114   
dbj|BAJ06363.1|  alpha-tubulin                                          348   1e-114   
gb|AGY80453.1|  tubulin                                                 348   1e-114   
ref|XP_003562846.1|  PREDICTED: tubulin alpha-1 chain                   348   1e-114   
gb|ABL61210.1|  alpha-tubulin                                           347   1e-114   
ref|NP_001105588.1|  tubulin alpha-6 chain                              348   1e-114   
ref|XP_010044940.1|  PREDICTED: tubulin alpha-3 chain                   347   1e-114   
sp|O22349.1|TBA3_ELEIN  RecName: Full=Tubulin alpha-3 chain; AltN...    347   1e-114   
sp|Q43473.1|TBA1_HORVU  RecName: Full=Tubulin alpha-1 chain             347   1e-114   
gb|ABD92942.1|  alpha tubulin-1D                                        347   1e-114   
ref|NP_001105324.1|  tubulin alpha-5 chain                              347   1e-114   
gb|AGD80034.1|  alpha-tubulin 1                                         347   1e-114   
gb|KJB83375.1|  hypothetical protein B456_013G244600                    347   1e-114   
gb|EPY33355.1|  tubulin alpha                                           343   1e-114   
ref|XP_007205189.1|  hypothetical protein PRUPE_ppa005642mg             347   1e-114   
ref|XP_008223650.1|  PREDICTED: tubulin alpha-3 chain-like              347   1e-114   
ref|XP_004981594.1|  PREDICTED: tubulin alpha-3 chain-like              347   1e-114   
emb|CAD24765.1|  alpha-tubulin                                          347   1e-114   
gb|ABC97356.1|  alpha tubulin                                           347   1e-114   
ref|XP_010934670.1|  PREDICTED: tubulin alpha-3 chain-like              347   1e-114   
ref|XP_006657877.1|  PREDICTED: tubulin alpha-3 chain-like              347   1e-114   
ref|XP_010112637.1|  Tubulin alpha-3 chain                              347   1e-114   
gb|AAZ23863.1|  alpha-tubulin                                           347   1e-114   
ref|XP_002532068.1|  tubulin alpha chain, putative                      347   1e-114   
gb|KCW87065.1|  hypothetical protein EUGRSUZ_B03604                     348   1e-114   
gb|ABO47741.1|  alpha-tubulin                                           347   1e-114   
emb|CAE52514.1|  alpha tubulin                                          347   1e-114   
ref|XP_002963092.1|  hypothetical protein SELMODRAFT_78469              347   1e-114   
gb|AGG37284.1|  alpha-tubulin 2                                         347   1e-114   
gb|ABU93321.1|  tubulin alpha subunit                                   347   2e-114   
ref|XP_010695478.1|  PREDICTED: tubulin alpha-2 chain-like              347   2e-114   
gb|AAX63396.1|  alpha-tubulin                                           347   2e-114   
emb|CAA62917.1|  alfa-tubulin                                           347   2e-114   
emb|CAD24768.1|  alpha-tubulin                                          347   2e-114   
gb|ABO47735.1|  alpha-tubulin                                           347   2e-114   
ref|XP_009389058.1|  PREDICTED: tubulin alpha-3 chain-like              347   2e-114   
gb|KHG06861.1|  Tubulin alpha-6 chain                                   347   2e-114   
ref|XP_009622332.1|  PREDICTED: tubulin alpha-3 chain                   347   2e-114   
gb|AAB86648.1|  alpha-tubulin                                           347   2e-114   
gb|EPY40479.1|  tubulin alpha                                           340   2e-114   
gb|ETW61813.1|  tubulin alpha chain                                     345   2e-114   
gb|AAB86649.1|  alpha-tubulin                                           347   2e-114   
emb|CDP00974.1|  unnamed protein product                                347   2e-114   
gb|AHJ80816.1|  Tua1                                                    347   2e-114   
emb|CCI45804.1|  unnamed protein product                                347   3e-114   
gb|EPY39349.1|  tubulin alpha                                           342   3e-114   
gb|AAL73386.1|AF408404_1  alpha-tubulin                                 346   3e-114   
emb|CAL80740.1|  alpha-tubulin                                          347   3e-114   
emb|CAA61255.1|  alpha tubulin                                          347   3e-114   
emb|CCA20146.1|  alpha tubulin 1 putative                               346   4e-114   
ref|XP_011089722.1|  PREDICTED: tubulin alpha-3 chain                   346   4e-114   
ref|XP_010276368.1|  PREDICTED: tubulin alpha-3 chain-like              346   4e-114   
ref|XP_002779172.1|  Tubulin alpha chain, putative                      345   4e-114   
ref|XP_008449885.1|  PREDICTED: tubulin alpha-3 chain isoform X1        346   4e-114   
ref|XP_004149645.1|  PREDICTED: tubulin alpha-3 chain-like              346   4e-114   
sp|P33624.1|TBA2_ANEPH  RecName: Full=Tubulin alpha-2 chain             343   4e-114   
gb|EUR72656.1|  hypothetical protein PFBG_02365                         345   4e-114   
gb|ETW20218.1|  tubulin alpha chain                                     345   4e-114   
gb|AGG37286.1|  alpha-tubulin 4                                         346   5e-114   
dbj|BAJ98211.1|  predicted protein                                      346   5e-114   
ref|XP_011048194.1|  PREDICTED: tubulin alpha-6 chain-like              346   5e-114   
gb|EUT86396.1|  tubulin alpha chain                                     344   5e-114   
gb|ABR67425.1|  alpha-tubulin 4                                         346   6e-114   
ref|XP_002297631.1|  alpha-tubulin 2 family protein                     346   6e-114   
gb|ETW45898.1|  tubulin alpha chain                                     345   6e-114   
ref|XP_002980239.1|  hypothetical protein SELMODRAFT_233509             346   6e-114   
ref|XP_008464962.1|  PREDICTED: tubulin alpha-3 chain-like              346   6e-114   
ref|XP_004141134.1|  PREDICTED: tubulin alpha-3 chain-like              346   6e-114   
sp|Q08114.1|TBA_EUPOC  RecName: Full=Tubulin alpha chain                345   6e-114   
ref|XP_009353129.1|  PREDICTED: tubulin alpha-3 chain-like              345   7e-114   
ref|XP_004295008.1|  PREDICTED: tubulin alpha-3 chain isoform X1        345   7e-114   
ref|XP_001427643.1|  hypothetical protein                               338   8e-114   
gb|AAO23139.1|  alpha tubulin                                           345   9e-114   
ref|XP_009375870.1|  PREDICTED: tubulin alpha-3 chain                   345   9e-114   
ref|XP_006286664.1|  hypothetical protein CARUB_v10002583mg             345   9e-114   
ref|XP_008349406.1|  PREDICTED: tubulin alpha-3 chain                   345   9e-114   
gb|ETW56906.1|  tubulin alpha chain                                     344   9e-114   
emb|CAD26887.1|  alpha-tubulin                                          345   9e-114   
gb|EYU31677.1|  hypothetical protein MIMGU_mgv1a006281mg                345   1e-113   
ref|XP_008351479.1|  PREDICTED: tubulin alpha-3 chain                   345   1e-113   
gb|ETW57405.1|  tubulin alpha chain                                     344   1e-113   
ref|XP_001420620.1|  predicted protein                                  345   1e-113   
gb|KHN06388.1|  Tubulin alpha-3 chain                                   344   1e-113   
pir||A54506  tubulin alpha-1 chain - Plasmodium yoelii (fragment)       335   1e-113   
ref|XP_007014666.1|  Tubulin alpha-5                                    345   1e-113   
ref|XP_006650667.1|  PREDICTED: tubulin alpha-2 chain-like              345   2e-113   
gb|AAO63773.2|  alpha-tubulin 2                                         345   2e-113   
ref|XP_005839726.1|  hypothetical protein GUITHDRAFT_150645             345   2e-113   
emb|CCW60849.1|  unnamed protein product                                342   2e-113   
gb|ETW30983.1|  tubulin alpha chain                                     347   2e-113   
ref|XP_002788269.1|  Tubulin alpha chain, putative                      345   2e-113   
emb|CEF99848.1|  Tubulin/FtsZ, 2-layer sandwich domain                  344   2e-113   
ref|XP_002973792.1|  hypothetical protein SELMODRAFT_100162             345   2e-113   
ref|XP_003082284.1|  TBA_CHLVU Tubulin alpha chain (ISS)                345   2e-113   
ref|XP_002904166.1|  alpha-tubulin, putative                            344   2e-113   
ref|XP_011075054.1|  PREDICTED: tubulin alpha-3 chain-like              344   2e-113   
gb|KDP39691.1|  hypothetical protein JCGZ_02711                         344   2e-113   
gb|ETW38327.1|  tubulin alpha chain                                     344   2e-113   
gb|AIC33057.1|  tubulin alpha-1 chain                                   344   2e-113   
ref|XP_008818311.1|  tubulin alpha chain                                344   2e-113   
emb|CDX88875.1|  BnaA03g07740D                                          344   2e-113   
ref|NP_197478.1|  tubulin alpha-3                                       344   2e-113   
gb|ABO47738.1|  alpha-tubulin                                           344   2e-113   
ref|XP_010531152.1|  PREDICTED: tubulin alpha-3 chain                   344   3e-113   
emb|CDY42294.1|  BnaC02g09000D                                          344   3e-113   
ref|XP_010535933.1|  PREDICTED: tubulin alpha-3 chain-like isofor...    344   3e-113   
ref|XP_008900811.1|  tubulin alpha chain                                344   3e-113   
ref|XP_008625823.1|  tubulin alpha chain                                344   3e-113   



>ref|XP_004252814.1| PREDICTED: tubulin alpha-2 chain-like [Solanum lycopersicum]
Length=227

 Score =   358 bits (920),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 168/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  39   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  98

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQ+AVCMISNST
Sbjct  99   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQKAVCMISNST  158

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  159  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  208



>emb|CAJ38386.1| alpha tubulin [Plantago major]
Length=270

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  83   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  142

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  143  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  202

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  203  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>gb|AHM93474.1| alpha-tubulin, partial [Camellia chekiangoleosa]
Length=327

 Score =   360 bits (925),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 168/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  140  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGD  199

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  200  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  259

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  260  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  309



>gb|EYU34085.1| hypothetical protein MIMGU_mgv1a0196712mg, partial [Erythranthe 
guttata]
Length=217

 Score =   356 bits (913),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  30   PRIHFMLSSYAPVISAEKAYHEQLSVSEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  89

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  90   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  149

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AFR42020.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42021.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42022.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42023.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42024.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42025.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42027.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42028.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42029.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42030.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42031.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42032.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42033.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42034.1| alpha-tubulin, partial [Populus trichocarpa]
 gb|AFR42037.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42038.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42039.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42041.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42045.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42046.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42048.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42056.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42057.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42058.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42059.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42060.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42061.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42062.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42063.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42064.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42065.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42066.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42067.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42068.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42069.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42070.1| alpha-tubulin, partial [Populus nigra]
 gb|AFR42071.1| alpha-tubulin, partial [Populus nigra]
Length=197

 Score =   355 bits (911),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  24   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  83

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  84   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  143

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  144  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42026.1| alpha-tubulin, partial [Populus trichocarpa]
Length=196

 Score =   355 bits (911),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  24   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  83

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  84   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  143

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  144  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|KJB58759.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=340

 Score =   360 bits (924),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  153  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  212

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  213  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  272

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  273  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  322



>gb|AFR42049.1| alpha-tubulin, partial [Populus fremontii]
Length=197

 Score =   355 bits (910),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  24   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  83

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  84   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  143

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  144  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  193



>gb|AFR42035.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42040.1| alpha-tubulin, partial [Populus alba]
 gb|AFR42044.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42052.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   355 bits (910),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  23   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  82

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  83   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  142

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  143  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42036.1| alpha-tubulin, partial [Populus alba]
Length=195

 Score =   355 bits (910),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  22   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  81

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  82   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  141

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  142  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  191



>gb|AFR42054.1| alpha-tubulin, partial [Populus fremontii]
Length=196

 Score =   354 bits (909),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  23   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  82

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  83   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  142

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  143  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  192



>gb|AFR42042.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42043.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42050.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42051.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42053.1| alpha-tubulin, partial [Populus fremontii]
 gb|AFR42055.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   354 bits (909),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  21   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  80

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  81   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  140

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>gb|AFR42047.1| alpha-tubulin, partial [Populus fremontii]
Length=194

 Score =   354 bits (908),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  21   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  80

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  81   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  140

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  141  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  190



>ref|XP_006433708.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
 gb|ESR46948.1| hypothetical protein CICLE_v100015522mg, partial [Citrus clementina]
Length=218

 Score =   354 bits (909),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  30   PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  89

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  90   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  149

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  150  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  199



>gb|AAW57305.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=306

 Score =   357 bits (916),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  119  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  178

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMISNST
Sbjct  179  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNST  238

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  239  SVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  288



>gb|KJB32211.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=361

 Score =   359 bits (921),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  174  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  233

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  234  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  293

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  294  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  343



>gb|AHZ58481.1| alpha-tubulin, partial [Syntrichia caninervis]
Length=200

 Score =   353 bits (905),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  14   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  73

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T
Sbjct  74   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNT  133

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  134  AVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  183



>gb|AAW57310.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57311.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57313.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=267

 Score =   355 bits (912),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  79   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  138

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  139  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  198

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  199  SVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  248



>gb|AAW57309.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=266

 Score =   355 bits (911),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  78   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  137

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  138  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  197

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  198  SVAEVFSRIDYKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  247



>emb|CAB76917.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=289

 Score =   355 bits (911),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  101  PRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  160

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  161  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  220

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  221  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  270



>gb|EPS62716.1| alpha-tubulin, partial [Genlisea aurea]
Length=404

 Score =   359 bits (922),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  217  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  276

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  277  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  336

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  337  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  386



>gb|AHJ80819.1| Tua1, partial [Eragrostis tef]
Length=243

 Score =   353 bits (905),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  55   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  114

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  115  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  174

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  175  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  224



>gb|KIY91712.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=249

 Score =   353 bits (905),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  61   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  120

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  121  VVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  180

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  181  AVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>gb|KJB58756.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=415

 Score =   359 bits (921),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  228  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  287

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  288  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  347

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  348  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|ABB02631.1| unknown [Solanum tuberosum]
Length=450

 Score =   360 bits (924),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81349.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=355

 Score =   357 bits (915),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  167  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  226

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  227  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  286

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  287  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  336



>gb|KGN48654.1| hypothetical protein Csa_6G497050 [Cucumis sativus]
Length=415

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  228  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  287

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  288  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  347

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  348  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>dbj|BAH19954.1| AT1G50010 [Arabidopsis thaliana]
Length=248

 Score =   352 bits (904),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  61   PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  120

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  121  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  180

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  181  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  230



>ref|XP_009605705.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana tomentosiformis]
 ref|XP_009761158.1| PREDICTED: tubulin alpha-2 chain-like [Nicotiana sylvestris]
 emb|CAD13178.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   360 bits (924),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004244533.1| PREDICTED: tubulin alpha-3 chain-like [Solanum lycopersicum]
Length=451

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006362511.1| PREDICTED: tubulin alpha-1 chain-like [Solanum tuberosum]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD13176.1| alpha-tubulin [Nicotiana tabacum]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACH68563.1| alpha-tubulin [Solanum tuberosum]
Length=449

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  262  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  321

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  322  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  381

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  382  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  431



>ref|XP_009790136.1| PREDICTED: tubulin alpha chain [Nicotiana sylvestris]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009620798.1| PREDICTED: tubulin alpha chain [Nicotiana tomentosiformis]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006356798.1| PREDICTED: tubulin alpha chain-like [Solanum tuberosum]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004238046.1| PREDICTED: tubulin alpha chain [Solanum lycopersicum]
Length=450

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001275271.1| alpha-tubulin-like protein [Solanum tuberosum]
 gb|ABB72803.1| alpha-tubulin-like protein [Solanum tuberosum]
Length=452

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  264  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  323

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  324  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  383

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  384  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_009614122.1| PREDICTED: tubulin alpha-3 chain [Nicotiana tomentosiformis]
 ref|XP_009787472.1| PREDICTED: tubulin alpha-3 chain [Nicotiana sylvestris]
 emb|CAD13177.1| alpha-tubulin [Nicotiana tabacum]
Length=451

 Score =   360 bits (923),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAF01952.1| putative tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=202

 Score =   350 bits (899),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  15   PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  74

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  75   VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  134

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  135  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  184



>gb|ABP65320.1| alpha tubulin [Capsicum annuum]
Length=450

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 169/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABC59068.2| alpha tubulin 1 [Camellia sinensis]
Length=450

 Score =   359 bits (922),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 168/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|WP_039310890.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91192.1| hypothetical protein QW71_36085, partial [Paenibacillus sp. IHB 
B 3415]
Length=453

 Score =   358 bits (920),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 168/170 (99%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  267  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGD  326

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  327  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  386

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  387  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  436



>emb|CAA52158.1| alpha tubulin [Zea mays]
Length=256

 Score =   351 bits (901),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  68   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  127

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  128  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  187

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDL ALEKDY
Sbjct  188  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLRALEKDY  237



>gb|EYU34660.1| hypothetical protein MIMGU_mgv1a006269mg [Erythranthe guttata]
Length=450

 Score =   358 bits (919),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAW57306.1| alpha-tubulin, partial [Ceratopteris richardii]
 gb|AAW57308.1| alpha-tubulin, partial [Ceratopteris richardii]
Length=257

 Score =   351 bits (901),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 161/170 (95%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACC+M+RGD
Sbjct  69   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCMMYRGD  128

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  129  VVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  188

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            S+AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  189  SIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  238



>dbj|BAB19779.1| alpha tubulin [Nicotiana tabacum]
Length=450

 Score =   358 bits (919),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 168/170 (99%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRA VHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRALVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ADW83724.1| alpha-tubulin [Musa acuminata AAA Group]
Length=423

 Score =   357 bits (916),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  235  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  294

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  295  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  354

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  355  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  404



>emb|CDP02221.1| unnamed protein product [Coffea canephora]
Length=449

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011098608.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|EYU37544.1| hypothetical protein MIMGU_mgv1a007145mg [Erythranthe guttata]
Length=417

 Score =   357 bits (915),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  229  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  288

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  289  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  348

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  349  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  398



>ref|NP_001291325.1| tubulin alpha chain-like [Sesamum indicum]
 gb|AFJ42573.1| alpha-tubulin [Sesamum indicum]
Length=450

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO49533.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=431

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  244  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  303

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  304  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  363

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  364  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>emb|CAN62392.1| hypothetical protein VITISV_016172 [Vitis vinifera]
Length=435

 Score =   357 bits (916),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  248  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  307

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  308  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  367

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  368  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  417



>ref|NP_001289660.1| tubulin alpha chain-like [Eucalyptus grandis]
 gb|ABS50670.1| alpha-tubulin [Eucalyptus grandis]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003608582.1| Tubulin alpha-5 chain [Medicago truncatula]
 gb|AES90779.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_001764722.1| predicted protein [Physcomitrella patens]
 gb|EDQ70421.1| predicted protein [Physcomitrella patens]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010242419.1| PREDICTED: tubulin alpha-1 chain [Nelumbo nucifera]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007032501.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY03427.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007018369.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOY15594.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006426173.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
 gb|ESR39413.1| hypothetical protein CICLE_v10025588mg [Citrus clementina]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008804464.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACN40181.1| unknown [Picea sitchensis]
 gb|ACN40840.1| unknown [Picea sitchensis]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002283198.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
 ref|XP_006827169.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
 ref|XP_010939541.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
 gb|ERM94406.1| hypothetical protein AMTR_s00010p00254750 [Amborella trichopoda]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002981542.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
 gb|EFJ17357.1| hypothetical protein SELMODRAFT_178975 [Selaginella moellendorffii]
Length=449

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002510010.1| tubulin alpha chain, putative [Ricinus communis]
 ref|XP_006852746.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
 gb|EEF52197.1| tubulin alpha chain, putative [Ricinus communis]
 gb|ERN14213.1| hypothetical protein AMTR_s00033p00112490 [Amborella trichopoda]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011457777.1| PREDICTED: tubulin alpha chain [Fragaria vesca subsp. vesca]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG18997.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB32210.1| hypothetical protein B456_005G229600 [Gossypium raimondii]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335354.1| PREDICTED: tubulin alpha chain [Pyrus x bretschneideri]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010093625.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB54386.1| Tubulin alpha chain [Morus notabilis]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABX57816.1| alpha tubulin [Picea wilsonii]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAV92352.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92353.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92354.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92355.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92356.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92357.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92358.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92359.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92360.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92361.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92362.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92363.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92364.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92365.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92366.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92367.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92368.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92369.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92370.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92371.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92372.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92373.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92374.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92375.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92376.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92377.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92378.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|AAV92379.1| alpha tubulin 1 [Pseudotsuga menziesii var. menziesii]
 gb|ACN40661.1| unknown [Picea sitchensis]
 gb|ACN40854.1| unknown [Picea sitchensis]
 gb|ACN40972.1| unknown [Picea sitchensis]
 gb|ACN41102.1| unknown [Picea sitchensis]
 gb|AIZ74331.1| alpha-tubulin [Pinus massoniana]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010099392.1| Tubulin alpha chain [Morus notabilis]
 ref|XP_010105098.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB78237.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC03883.1| Tubulin alpha chain [Morus notabilis]
Length=467

 Score =   358 bits (918),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  279  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  338

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  339  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  398

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  399  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  448



>ref|XP_004288297.1| PREDICTED: tubulin alpha-3 chain [Fragaria vesca subsp. vesca]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007205183.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
 ref|XP_008236958.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 gb|EMJ06382.1| hypothetical protein PRUPE_ppa005613mg [Prunus persica]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008372961.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP32140.1| hypothetical protein JCGZ_12601 [Jatropha curcas]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010065856.1| PREDICTED: tubulin alpha chain [Eucalyptus grandis]
 gb|KCW63554.1| hypothetical protein EUGRSUZ_G01186 [Eucalyptus grandis]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006422747.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 ref|XP_006486878.1| PREDICTED: tubulin alpha chain-like isoform X1 [Citrus sinensis]
 gb|ESR35987.1| hypothetical protein CICLE_v10028426mg [Citrus clementina]
 gb|KDO49534.1| hypothetical protein CISIN_1g013062mg [Citrus sinensis]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010266793.1| PREDICTED: tubulin alpha chain [Nelumbo nucifera]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010526692.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AID52921.1| tubulin alpha chain [Carthamus tinctorius]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47740.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89777.1| alpha-tubulin 10 [Gossypium hirsutum]
 gb|KHG24734.1| Tubulin alpha chain [Gossypium arboreum]
 gb|KJB58758.1| hypothetical protein B456_009G224800 [Gossypium raimondii]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006466394.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Citrus sinensis]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002522104.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF40304.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P46259.1|TBA1_PEA RecName: Full=Tubulin alpha-1 chain [Pisum sativum]
 gb|AAA79910.1| alpha-tubulin [Pisum sativum]
Length=452

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010943272.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787237.1| PREDICTED: tubulin alpha chain [Phoenix dactylifera]
 ref|XP_010941981.1| PREDICTED: tubulin alpha chain [Elaeis guineensis]
Length=451

 Score =   357 bits (917),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10966.1| tubulin [Ornithogalum saundersiae]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P33629.1|TBA_PRUDU RecName: Full=Tubulin alpha chain [Prunus dulcis]
 emb|CAA47635.1| alpha-tubulin [Prunus dulcis]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47739.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG18532.1| Tubulin alpha-2 chain [Gossypium arboreum]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010245599.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008455054.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Cucumis melo]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP44552.1| hypothetical protein JCGZ_16385 [Jatropha curcas]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACJ60905.1| alpha tubulin [Betula pendula]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003635553.2| PREDICTED: tubulin alpha chain-like [Vitis vinifera]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007199840.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
 ref|XP_008236252.1| PREDICTED: tubulin alpha chain isoform X1 [Prunus mume]
 gb|EMJ01039.1| hypothetical protein PRUPE_ppa005633mg [Prunus persica]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004136930.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 ref|XP_004155416.1| PREDICTED: tubulin alpha-4 chain-like [Cucumis sativus]
 gb|KGN43837.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47736.1| alpha-tubulin [Gossypium hirsutum]
 gb|ACM89778.1| alpha-tubulin 6 [Gossypium hirsutum]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010555432.1| PREDICTED: tubulin alpha chain-like [Tarenaya hassleriana]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAF9.1|TBA4_GOSHI RecName: Full=Tubulin alpha-4 chain; AltName: Full=Alpha-4-tubulin 
[Gossypium hirsutum]
 gb|AAQ92663.1| alpha-tubulin 4 [Gossypium hirsutum]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYTKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37283.1| alpha-tubulin 1 [Salix arbutifolia]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003522731.1| PREDICTED: tubulin alpha-4 chain isoform X1 [Glycine max]
Length=452

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003603670.1| Tubulin alpha-7 chain [Medicago truncatula]
 gb|AES73921.1| tubulin beta-1 chain [Medicago truncatula]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004232226.1| PREDICTED: tubulin alpha chain-like [Solanum lycopersicum]
 ref|XP_006338460.1| PREDICTED: tubulin alpha-3 chain-like isoform X1 [Solanum tuberosum]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010531321.1| PREDICTED: tubulin alpha chain isoform X1 [Tarenaya hassleriana]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004501073.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010256937.1| PREDICTED: tubulin alpha chain-like [Nelumbo nucifera]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010939312.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007137281.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
 gb|ESW09275.1| hypothetical protein PHAVU_009G114100g [Phaseolus vulgaris]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009335355.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008440459.1| PREDICTED: tubulin alpha chain-like isoform X1 [Cucumis melo]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004143417.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004160931.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
Length=450

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010936237.1| PREDICTED: tubulin alpha chain-like [Elaeis guineensis]
Length=451

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002301128.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
 ref|XP_011017025.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017026.1| PREDICTED: tubulin alpha chain-like isoform X1 [Populus euphratica]
 ref|XP_011017027.1| PREDICTED: tubulin alpha chain-like isoform X2 [Populus euphratica]
 gb|AAO63781.1| alpha-tubulin 1 [Populus tremuloides]
 gb|ABK96001.1| unknown [Populus trichocarpa]
 gb|EEE80401.1| hypothetical protein POPTR_0002s11250g [Populus trichocarpa]
Length=451

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002275973.1| PREDICTED: tubulin alpha chain [Vitis vinifera]
Length=450

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009626810.1| PREDICTED: tubulin alpha chain-like [Nicotiana tomentosiformis]
 ref|XP_009785294.1| PREDICTED: tubulin alpha chain-like [Nicotiana sylvestris]
Length=450

 Score =   357 bits (916),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDP41548.1| hypothetical protein JCGZ_15955 [Jatropha curcas]
Length=451

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007042689.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX98520.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=450

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AIX10773.1| alpha tubulin [Panax notoginseng]
Length=451

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AEQ75493.1| alpha-tubulin [Rosa multiflora]
Length=440

 Score =   356 bits (914),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  252  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  311

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  312  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  371

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  372  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  421



>gb|AGG37289.1| alpha-tubulin 7 [Salix arbutifolia]
Length=450

 Score =   357 bits (915),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN08201.1| Tubulin alpha chain [Glycine soja]
Length=457

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  268  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  327

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  328  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  387

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  388  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  437



>ref|XP_011008936.1| PREDICTED: tubulin alpha chain [Populus euphratica]
Length=451

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|P33623.1|TBA1_ANEPH RecName: Full=Tubulin alpha-1 chain [Anemia phyllitidis]
 emb|CAA48927.1| alpha tubulin [Anemia phyllitidis]
Length=451

 Score =   357 bits (915),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACK76232.1| alpha-tubulin [Dimocarpus longan]
Length=450

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007215369.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
 ref|XP_008230754.1| PREDICTED: tubulin alpha chain-like [Prunus mume]
 gb|EMJ16568.1| hypothetical protein PRUPE_ppa005626mg [Prunus persica]
Length=450

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004304311.1| PREDICTED: tubulin alpha-2 chain-like [Fragaria vesca subsp. 
vesca]
Length=450

 Score =   356 bits (914),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008787760.1| PREDICTED: tubulin alpha chain-like [Phoenix dactylifera]
Length=451

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006404742.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
 gb|ESQ46195.1| hypothetical protein EUTSA_v10000161mg [Eutrema salsugineum]
Length=451

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002324047.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
 gb|EEF04180.2| hypothetical protein POPTR_0017s11740g [Populus trichocarpa]
Length=454

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  266  PRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  325

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  326  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  385

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  386  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  435



>ref|XP_002959708.1| alpha tubulin [Volvox carteri f. nagariensis]
 gb|EFJ39226.1| alpha tubulin [Volvox carteri f. nagariensis]
Length=255

 Score =   349 bits (896),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAP+ISAEKAYHEQLSVAEITN+AFEP+SMMVKCDPRHGKYMACCLM+RGD
Sbjct  67   PRIHFMLSSYAPIISAEKAYHEQLSVAEITNAAFEPASMMVKCDPRHGKYMACCLMYRGD  126

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  127  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  186

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++ E+FSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKD+
Sbjct  187  AIGEIFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDF  236



>ref|XP_002517492.1| tubulin alpha chain, putative [Ricinus communis]
 gb|EEF45034.1| tubulin alpha chain, putative [Ricinus communis]
Length=450

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008379344.1| PREDICTED: tubulin alpha-2 chain [Malus domestica]
Length=450

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR25378.1| tubulin alpha 3 chain [Oryza sativa Indica Group]
Length=207

 Score =   347 bits (891),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  19   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  78

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  79   VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  138

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  139  SVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  188



>gb|ABK92520.1| unknown [Populus trichocarpa]
Length=451

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006581474.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
Length=452

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011030289.1| PREDICTED: tubulin alpha-4 chain [Populus euphratica]
Length=451

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004299843.1| PREDICTED: tubulin alpha chain-like [Fragaria vesca subsp. vesca]
 gb|AAK81858.1|AF394915_1 alpha tubulin subunit [Rosa hybrid cultivar]
Length=451

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008621874.1| tubulin alpha, partial [Saprolegnia diclina VS20]
 gb|EQC24696.1| tubulin alpha, partial [Saprolegnia diclina VS20]
Length=273

 Score =   350 bits (897),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMA CLM+RGD
Sbjct  83   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMAACLMYRGD  142

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISN++
Sbjct  143  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNTS  202

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  203  AIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  252



>gb|ABQ59633.1| alpha-tubulin 3 [Populus tremuloides]
Length=451

 Score =   356 bits (914),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFW67749.1| alpha tubulin4 [Zea mays]
Length=321

 Score =   351 bits (901),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  133  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  192

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  193  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  252

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  253  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  302



>gb|KEH43997.1| tubulin beta-1 chain [Medicago truncatula]
Length=450

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004496862.1| PREDICTED: tubulin alpha chain-like [Cicer arietinum]
Length=450

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37285.1| alpha-tubulin 3 [Salix arbutifolia]
Length=451

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009409992.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=451

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVA+VFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVADVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002298794.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
 gb|EEE83599.2| TUBULIN ALPHA CHAIN family protein [Populus trichocarpa]
Length=451

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007223365.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
 ref|XP_008219156.1| PREDICTED: tubulin alpha chain-like isoform X1 [Prunus mume]
 ref|XP_008347836.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_008352750.1| PREDICTED: tubulin alpha chain isoform X1 [Malus domestica]
 ref|XP_009357230.1| PREDICTED: tubulin alpha chain-like isoform X1 [Pyrus x bretschneideri]
 ref|XP_009335481.1| PREDICTED: tubulin alpha chain-like [Pyrus x bretschneideri]
 gb|EMJ24564.1| hypothetical protein PRUPE_ppa005617mg [Prunus persica]
Length=451

 Score =   356 bits (913),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAX96763.1| Tubulin/FtsZ family, GTPase domain, putative [Oryza sativa Japonica 
Group]
 gb|ABA92354.1| Tubulin alpha-3 chain, putative, expressed [Oryza sativa Japonica 
Group]
Length=346

 Score =   352 bits (903),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  158  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  217

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  218  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  277

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  278  SVVEVFSRIDIKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>ref|XP_009388502.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=451

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003536570.1| PREDICTED: tubulin alpha chain-like isoform X1 [Glycine max]
 gb|KHN23177.1| Tubulin alpha chain [Glycine soja]
Length=449

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003556001.1| PREDICTED: tubulin alpha-4 chain-like isoform X1 [Glycine max]
 gb|KHN01573.1| Tubulin alpha-4 chain [Glycine soja]
Length=449

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81348.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=447

 Score =   355 bits (912),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  259  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  318

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  319  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  378

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  379  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  428



>ref|XP_006472372.1| PREDICTED: tubulin alpha chain isoform X1 [Citrus sinensis]
Length=451

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB36609.1| alpha-tubulin, partial [Eucalyptus globulus subsp. bicostata]
Length=380

 Score =   353 bits (906),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAE TNSAFEPSS+M KCDPRHGKYMACCLM+RGD
Sbjct  193  PRIHFMLSSYAPVISAEKAYHEQLSVAETTNSAFEPSSLMAKCDPRHGKYMACCLMYRGD  252

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  253  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  312

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
             +AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  313  RLAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  362



>gb|KIZ01406.1| Tubulin alpha-1 chain [Monoraphidium neglectum]
Length=451

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  AIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009402887.1| PREDICTED: tubulin alpha chain [Musa acuminata subsp. malaccensis]
Length=451

 Score =   356 bits (913),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFW67748.1| alpha tubulin4 [Zea mays]
Length=364

 Score =   353 bits (905),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  176  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  235

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  236  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  295

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  296  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  345



>gb|AAO73546.1| alpha-tubulin [Ceratopteris richardii]
 gb|AAW57307.1| alpha-tubulin [Ceratopteris richardii]
Length=450

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRA+CMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAICMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID KFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDFKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011014531.1| PREDICTED: tubulin alpha-4 chain-like [Populus euphratica]
Length=451

 Score =   356 bits (913),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q6VAG0.1|TBA2_GOSHI RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Gossypium hirsutum]
 gb|AAQ92662.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|ACM89776.1| alpha-tubulin 2 [Gossypium hirsutum]
 gb|KJB77616.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
 gb|KJB77617.1| hypothetical protein B456_012G147000 [Gossypium raimondii]
Length=450

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAF+HWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFIHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KDO81347.1| hypothetical protein CISIN_1g013037mg [Citrus sinensis]
Length=451

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010104543.1| Tubulin alpha chain [Morus notabilis]
 gb|EXC01144.1| Tubulin alpha chain [Morus notabilis]
Length=448

 Score =   355 bits (912),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSS+APVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  260  PRIHFMLSSFAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  319

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  320  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  379

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  429



>ref|XP_007143142.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
 gb|ESW15136.1| hypothetical protein PHAVU_007G047300g [Phaseolus vulgaris]
Length=449

 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003539228.1| PREDICTED: tubulin alpha-2 chain-like [Glycine max]
 gb|KHN13032.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007156677.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
 gb|ESW28671.1| hypothetical protein PHAVU_002G007900g [Phaseolus vulgaris]
Length=451

 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFV+WCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVEWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHN42598.1| Tubulin alpha-2 chain [Glycine soja]
Length=451

 Score =   355 bits (912),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002962630.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
 ref|XP_002980460.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ18720.1| hypothetical protein SELMODRAFT_233518 [Selaginella moellendorffii]
 gb|EFJ36093.1| hypothetical protein SELMODRAFT_230143 [Selaginella moellendorffii]
Length=452

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  265  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPASMMAKCDPRHGKYMACCLMYRGD  324

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  325  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  384

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  385  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  434



>sp|Q6VAG1.1|TBA1_GOSHI RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Gossypium hirsutum]
 gb|AAQ92661.1| alpha-tubulin 1 [Gossypium hirsutum]
Length=451

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQF DWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFADWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004150268.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_004156870.1| PREDICTED: tubulin alpha chain-like [Cucumis sativus]
 ref|XP_008454421.1| PREDICTED: tubulin alpha chain [Cucumis melo]
 gb|ADN33817.1| tubulin alpha chain [Cucumis melo subsp. melo]
 gb|KGN52737.1| Tubulin alpha chain [Cucumis sativus]
Length=450

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVC ISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCKISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003517369.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Glycine max]
Length=451

 Score =   355 bits (912),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVA IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVAIIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD20821.1| alpha tubulin [Zea mays]
Length=274

 Score =   349 bits (895),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  87   PRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGD  146

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T
Sbjct  147  VVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNT  206

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  207  AVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  256



>ref|XP_002964078.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
 ref|XP_002975442.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ23643.1| hypothetical protein SELMODRAFT_232506 [Selaginella moellendorffii]
 gb|EFJ34411.1| hypothetical protein SELMODRAFT_405729 [Selaginella moellendorffii]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITN+AFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNTAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007515802.1| alpha-tubulin [Bathycoccus prasinos]
 emb|CCO14681.1| alpha-tubulin [Bathycoccus prasinos]
Length=415

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  228  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  287

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVA+IKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  288  VVPKDVNAAVASIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  347

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  348  AIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>ref|XP_003558668.1| PREDICTED: tubulin alpha-2 chain-like [Brachypodium distachyon]
 emb|CAM58977.1| alpha-tubulin 4 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06364.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011088040.1| PREDICTED: tubulin alpha chain [Sesamum indicum]
Length=450

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAP ISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPAISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLA+VQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLARVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAO46127.1| alpha-tubulin [Streblomastix strix]
 gb|AAO46129.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   347 bits (891),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM KCDPRHGKYMACC+M+RGD
Sbjct  62   PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGD  121

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  122  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNST  181

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  182  AIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>emb|CAB66336.1| alpha-tubulin [Betula pendula]
 gb|AJA29683.1| tubulin alpha chain [Betula luminifera]
Length=451

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDNKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92937.1| alpha tubulin-4A [Triticum aestivum]
 gb|ABD92938.1| alpha tubulin-4B [Triticum aestivum]
 gb|EMS53764.1| Tubulin alpha chain [Triticum urartu]
Length=451

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92936.1| alpha tubulin-4D [Triticum aestivum]
Length=451

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV+EITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVSEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010664458.1| PREDICTED: tubulin alpha-4 chain [Vitis vinifera]
 emb|CAN77412.1| hypothetical protein VITISV_000470 [Vitis vinifera]
Length=451

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID+KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDNKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAC24800.1| alpha tubulin [Physcomitrella patens]
Length=451

 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKF LMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFGLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABR25510.1| tubulin alpha-1 chain [Oryza sativa Indica Group]
Length=255

 Score =   347 bits (891),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  68   PRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGD  127

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T
Sbjct  128  VVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNT  187

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  188  AVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  237



>ref|XP_006307493.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
 ref|XP_010418156.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 ref|XP_010430201.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Camelina sativa]
 ref|XP_010430202.1| PREDICTED: tubulin alpha-2 chain isoform X2 [Camelina sativa]
 ref|XP_010473400.1| PREDICTED: tubulin alpha-2 chain [Camelina sativa]
 gb|EOA40391.1| hypothetical protein CARUB_v10009117mg [Capsella rubella]
Length=450

 Score =   354 bits (909),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDY29334.1| BnaA05g16010D [Brassica napus]
Length=431

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  244  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  303

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  304  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  363

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  364  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  413



>gb|ABQ59634.1| alpha-tubulin 5 [Populus tremuloides]
Length=451

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80823.1| Tua1 [Eragrostis tef]
Length=451

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61201.1| alpha-tubulin [Oxymonadida environmental sample]
Length=299

 Score =   349 bits (895),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM KCDPRHGKYMACC+M+RGD
Sbjct  111  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGD  170

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  171  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  230

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  231  AIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  280



>ref|XP_009407690.1| PREDICTED: tubulin alpha chain-like [Musa acuminata subsp. malaccensis]
Length=452

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFE SSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFETSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_007047652.1| Tubulin alpha-2 chain [Theobroma cacao]
 gb|EOX91809.1| Tubulin alpha-2 chain [Theobroma cacao]
Length=501

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNS FEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  313  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSTFEPSSMMAKCDPRHGKYMACCLMYRGD  372

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  373  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  432

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  433  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  482



>ref|XP_010060142.1| PREDICTED: tubulin alpha chain-like [Eucalyptus grandis]
 gb|KCW66706.1| hypothetical protein EUGRSUZ_F00470 [Eucalyptus grandis]
Length=451

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAHHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_010096739.1| Tubulin alpha chain [Morus notabilis]
 gb|EXB65591.1| Tubulin alpha chain [Morus notabilis]
Length=449

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSS+APVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  260  PRIHFMLSSFAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  319

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  320  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  379

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  380  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  429



>gb|AHJ80815.1| Tua1 [Eragrostis tef]
Length=451

 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KHG20487.1| Tubulin alpha chain [Gossypium arboreum]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISA KAYHEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAAKAYHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAA06619.1| alpha-tubulin 1 [Eleusine indica]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|O22347.1|TBA1_ELEIN RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Eleusine indica]
 gb|AAC05717.1| alpha tubulin 1 [Eleusine indica]
 emb|CAA06618.1| alpha-tubulin 1 [Eleusine indica]
 gb|AFC88823.1| putative tubulin alpha-1 chain [Miscanthus sinensis]
 gb|AFC88833.1| tubulin alpha-1 chain [Miscanthus sinensis]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AFC88832.1| putative tubulin alpha-3 chain [Miscanthus sinensis]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_004981922.1| PREDICTED: tubulin alpha-1 chain-like [Setaria italica]
 emb|CAE52515.1| alpha tubulin [Setaria viridis]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAP59012.1| alpha tubulin [Taxus cuspidata]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665337.1| PREDICTED: tubulin alpha-1 chain-like [Zea mays]
 sp|P14640.1|TBA1_MAIZE RecName: Full=Tubulin alpha-1 chain; AltName: Full=Alpha-1-tubulin 
[Zea mays]
 emb|CAA33734.1| alpha1-tubulin [Zea mays]
 tpg|DAA51112.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51113.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51114.1| TPA: tubulin alpha-1 chain [Zea mays]
 tpg|DAA51117.1| TPA: tubulin alpha-1 chain [Zea mays]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_008665339.1| PREDICTED: tubulin alpha-2 chain [Zea mays]
 sp|P14641.1|TBA2_MAIZE RecName: Full=Tubulin alpha-2 chain; AltName: Full=Alpha-2-tubulin 
[Zea mays]
 emb|CAA33733.1| alpha2-tubulin [Zea mays]
 tpg|DAA51111.1| TPA: tubulin alpha-2 chain [Zea mays]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AGG37287.1| alpha-tubulin 5 [Salix arbutifolia]
Length=451

 Score =   354 bits (908),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDTKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_011398411.1| Tubulin alpha chain [Auxenochlorella protothecoides]
 gb|KFM25515.1| Tubulin alpha chain [Auxenochlorella protothecoides]
Length=394

 Score =   352 bits (903),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/170 (95%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  207  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  266

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVAT+KTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  267  VVPKDVNAAVATVKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  326

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  327  AIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  376



>gb|AEW46684.1| beta-tubulin [Ulva linza]
Length=452

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  AIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AHJ80817.1| Tua1 [Eragrostis tef]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABO47742.1| alpha-tubulin [Gossypium hirsutum]
 gb|KHG08879.1| Tubulin alpha-1 chain [Gossypium arboreum]
 gb|KJB11380.1| hypothetical protein B456_001G255600 [Gossypium raimondii]
Length=450

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEIT+SAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITSSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAJ06362.1| alpha-tubulin [Alopecurus aequalis]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_001167663.1| tubulin alpha-3 chain [Zea mays]
 gb|ACG26907.1| tubulin alpha-3 chain [Zea mays]
 gb|AFW67746.1| alpha tubulin4 isoform 1 [Zea mays]
 gb|AFW67747.1| alpha tubulin4 isoform 2 [Zea mays]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_003560377.1| PREDICTED: tubulin alpha-1 chain [Brachypodium distachyon]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRR5.1|TBA3_HORVU RecName: Full=Tubulin alpha-3 chain [Hordeum vulgare]
 emb|CAA10663.1| alpha-tubulin 3 [Hordeum vulgare subsp. vulgare]
 gb|ABD92933.1| alpha tubulin-3B [Triticum aestivum]
 gb|ABD92934.1| alpha tubulin-3A [Triticum aestivum]
 gb|ABD92935.1| alpha tubulin-3D [Triticum aestivum]
 dbj|BAJ87680.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS48260.1| Tubulin alpha-3 chain [Triticum urartu]
 gb|EMT18537.1| Tubulin alpha-3 chain [Aegilops tauschii]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002313194.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
 gb|EEE87149.1| hypothetical protein POPTR_0009s08850g [Populus trichocarpa]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDSKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CDO97305.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDL+ VQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLSGVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>emb|CAD20820.1| alpha tubulin [Zea mays]
Length=200

 Score =   345 bits (884),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  13   PRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGD  72

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISN+T
Sbjct  73   VVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNNT  132

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  133  AVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  182



>tpg|DAA51109.1| TPA: alpha tubulin [Zea mays]
Length=452

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  264  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  323

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  324  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  383

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  384  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_011002356.1| PREDICTED: tubulin alpha chain-like [Populus euphratica]
Length=451

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 166/170 (98%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDTKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_002466535.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|EER93533.1| hypothetical protein SORBIDRAFT_01g009570 [Sorghum bicolor]
 gb|ACX70682.1| tubulin alpha-2-like protein [Sorghum bicolor]
Length=452

 Score =   354 bits (908),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  264  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  323

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  324  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  383

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  384  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  433



>ref|XP_001777110.1| predicted protein [Physcomitrella patens]
 gb|EDQ58103.1| predicted protein [Physcomitrella patens]
Length=344

 Score =   350 bits (898),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/170 (95%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSV EITN+ FEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  158  PRIHFMLSSYAPVISAEKAYHEQLSVPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGD  217

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T
Sbjct  218  VVPKDVNAAVATIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNT  277

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  278  AVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  327



>emb|CAL35827.1| alpha-2 tubulin [Plantago major]
Length=249

 Score =   347 bits (889),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 165/170 (97%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLS+ EITN+ FEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  62   PRIHFMLSSYAPVISAEKAYHEQLSIPEITNAVFEPSSMMAKCDPRHGKYMACCLMYRGD  121

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRT+QFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISN+T
Sbjct  122  VVPKDVNAAVGTIKTKRTVQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNNT  181

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  182  AVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>emb|CDY66630.1| BnaCnng51680D [Brassica napus]
Length=435

 Score =   353 bits (906),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006662856.1| PREDICTED: tubulin alpha-3 chain-like [Oryza brachyantha]
Length=451

 Score =   353 bits (907),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABV55999.1| alpha-tubulin 7 [Populus tremuloides]
Length=451

 Score =   353 bits (907),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAE+TNSAFEPSSMM KCDPR GKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEVTNSAFEPSSMMAKCDPRRGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KFK32793.1| hypothetical protein AALP_AA6G289100 [Arabis alpina]
Length=450

 Score =   353 bits (907),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650518.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   353 bits (907),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP++VPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSIVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61216.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   348 bits (894),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM KCDPRHGKYMACC+M+RGD
Sbjct  126  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGD  185

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  186  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  245

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  246  AIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_010680774.1| PREDICTED: tubulin alpha-2 chain [Beta vulgaris subsp. vulgaris]
Length=451

 Score =   353 bits (907),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEIT SAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITTSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_006650524.1| PREDICTED: tubulin alpha-1 chain-like [Oryza brachyantha]
Length=451

 Score =   353 bits (907),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP++VPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSIVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABF98641.1| Tubulin alpha-1 chain, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAG95437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99628.1| unnamed protein product [Oryza sativa Japonica Group]
Length=416

 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  228  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  287

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISNST
Sbjct  288  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNST  347

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  348  SVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>dbj|BAG99724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=417

 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  228  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  287

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP+VVP GDLAKVQRAVCMISNST
Sbjct  288  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPSVVPSGDLAKVQRAVCMISNST  347

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  348  SVVEVFSRIDHKFDLMYSKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  397



>gb|ABL61224.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   348 bits (894),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM KCDPRHGKYMACC+M+RGD
Sbjct  126  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGD  185

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  186  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  245

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  246  AIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_010500555.1| PREDICTED: tubulin alpha-6 chain isoform X1 [Camelina sativa]
 ref|XP_010479400.1| PREDICTED: tubulin alpha-6 chain [Camelina sativa]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>dbj|BAE99023.1| tubulin alpha-2/alpha-4 chain [Arabidopsis thaliana]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ADJ00012.1| tubulin alpha chain [Chromera velia]
Length=234

 Score =   345 bits (886),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 158/170 (93%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAP+ISAEKAYHEQLSVAEITNSAFEP++MM KCDPRHGKYMACCLM+RGD
Sbjct  65   PRIHFMLSSYAPIISAEKAYHEQLSVAEITNSAFEPANMMAKCDPRHGKYMACCLMYRGD  124

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAA+ATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKV RA CMISNST
Sbjct  125  VVPKDVNAAIATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVMRACCMISNST  184

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  185  AIAEVFSRMDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  234



>ref|NP_171974.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 ref|NP_175423.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 ref|XP_002863595.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002891551.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 ref|XP_006279139.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 ref|XP_006393188.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 ref|XP_006406473.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 ref|XP_009107244.1| PREDICTED: tubulin alpha-2 chain isoform X1 [Brassica rapa]
 sp|B9DGT7.2|TBA2_ARATH RecName: Full=Tubulin alpha-2 chain [Arabidopsis thaliana]
 sp|Q0WV25.2|TBA4_ARATH RecName: Full=Tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AAF40454.1|AC004809_12 Identical to the alpha-4 tubulin (TUA4) gene from A. thaliana 
gb|M84697. ESTs gb|T46564. gb|T04381, gb|T76028, gb|T21602, 
gb|H37154 gb|H37663 and gb|T21719 come from this gene [Arabidopsis 
thaliana]
 gb|AAF76449.1|AC015445_16 Identical to Tubulin Alpha-6 Chain from Arabidopsis thaliana 
gi|267070 and contains a Tubulin PF|00091 domain. ESTs gb|N37387, 
gb|N37805, gb|R90497, gb|T44684, gb|H36144, gb|N38686, 
gb|AI994844, gb|R90689, gb|T04725, gb|H36928, gb|N96479, gb|H36922, 
gb|R90670, gb|Z17980, gb|T4428, gb|H36248, gb|N65408, 
gb|T46222 come from this gene [Arabidopsis thaliana]
 gb|AAK95316.1|AF410330_1 At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|AAA32889.1| apha-2 tubulin [Arabidopsis thaliana]
 gb|AAA32890.1| alpha-4 tubulin [Arabidopsis thaliana]
 gb|AAL25612.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAL38293.1| Tubulin Alpha-6 Chain [Arabidopsis thaliana]
 gb|AAM98269.1| At1g04820/F13M7_26 [Arabidopsis thaliana]
 gb|AAN31076.1| At1g50010/F2J10_12 [Arabidopsis thaliana]
 gb|ABQ01730.1| TUA2 [Eutrema halophilum]
 gb|ABQ01731.1| TUA2-2 [Eutrema halophilum]
 gb|EFH39854.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67810.1| tubulin alpha-2/alpha-4 chain [Arabidopsis lyrata subsp. lyrata]
 gb|AEE27747.1| tubulin alpha-4 chain [Arabidopsis thaliana]
 gb|AEE32507.1| tubulin alpha-2 chain [Arabidopsis thaliana]
 gb|EOA12037.1| hypothetical protein CARUB_v10008014mg [Capsella rubella]
 gb|ESQ30474.1| hypothetical protein EUTSA_v10011471mg [Eutrema salsugineum]
 gb|ESQ47926.1| hypothetical protein EUTSA_v10020718mg [Eutrema salsugineum]
 gb|KFK35954.1| hypothetical protein AALP_AA4G059800 [Arabis alpina]
 gb|KFK39296.1| alpha tubulin 1 [Arabis alpina]
 emb|CDY45043.1| BnaA08g02320D [Brassica napus]
 emb|CDY03583.1| BnaC03g68420D [Brassica napus]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61215.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   348 bits (894),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM KCDPRHGKYMACC+M+RGD
Sbjct  126  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGD  185

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  186  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  245

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  246  AIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_010507910.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
 ref|XP_010466126.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Camelina sativa]
 ref|XP_010487911.1| PREDICTED: tubulin alpha-2 chain-like [Camelina sativa]
Length=451

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITN+AFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNTAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAL16174.1|AF428406_1 AT4g14960/dl3520c [Arabidopsis thaliana]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009147859.1| PREDICTED: tubulin alpha-6 chain [Brassica rapa]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|NP_193232.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 sp|P29511.1|TBA6_ARATH RecName: Full=Tubulin alpha-6 chain [Arabidopsis thaliana]
 gb|AAA32892.1| TUA6 [Arabidopsis thaliana]
 emb|CAB10275.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 emb|CAB78538.1| tubulin alpha-6 chain (TUA6) [Arabidopsis thaliana]
 gb|AAL24246.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAL38788.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|AAL79586.1| AT4g14960/dl3520c [Arabidopsis thaliana]
 gb|AAM51249.1| putative tubulin alpha-6 chain TUA6 [Arabidopsis thaliana]
 gb|ABD75335.1| tubulin alpha-1 chain [Brassica rapa subsp. oleifera]
 gb|AEE83530.1| tubulin alpha-6 chain [Arabidopsis thaliana]
 emb|CDY50974.1| BnaA06g37700D [Brassica napus]
 emb|CDY28123.1| BnaC06g03040D [Brassica napus]
Length=450

 Score =   353 bits (906),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABL61212.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61220.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61221.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61222.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61223.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61225.1| alpha-tubulin [Oxymonadida environmental sample]
 gb|ABL61229.1| alpha-tubulin [Oxymonadida environmental sample]
Length=314

 Score =   348 bits (893),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 160/170 (94%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNS+FEP++MM KCDPRHGKYMACC+M+RGD
Sbjct  126  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGD  185

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  186  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  245

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRID KFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  246  AIAEVFSRIDRKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  295



>ref|XP_005851144.1| alpha-tubulin [Chlorella variabilis]
 gb|EFN59042.1| alpha-tubulin [Chlorella variabilis]
Length=450

 Score =   353 bits (906),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  AIAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ACU19580.1| unknown [Glycine max]
Length=449

 Score =   353 bits (905),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVF RIDHKFDLMY KRAFVHWYVGEGMEEGEF EAREDLAALEKDY
Sbjct  383  SVAEVFGRIDHKFDLMYAKRAFVHWYVGEGMEEGEFFEAREDLAALEKDY  432



>gb|AAO46130.1| alpha-tubulin [Streblomastix strix]
Length=249

 Score =   346 bits (887),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 159/170 (94%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSY PVISAEKAYHEQLSVAEITNS+FEP++MM KCDPRHGKYMACC+M+RGD
Sbjct  62   PRIHFMLSSYTPVISAEKAYHEQLSVAEITNSSFEPANMMAKCDPRHGKYMACCMMYRGD  121

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFK GINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  122  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKVGINYQPPTVVPGGDLAKVQRAVCMISNST  181

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            ++AEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  182  AIAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  231



>ref|XP_008341563.1| PREDICTED: tubulin alpha-2 chain-like [Malus domestica]
Length=450

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPR GKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRXGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>ref|XP_009124556.1| PREDICTED: tubulin alpha-2 chain-like isoform X1 [Brassica rapa]
Length=450

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 164/170 (96%), Positives = 167/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKA+HEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAFHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAV TIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVGTIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SVAEVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVAEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|ABD92930.1| alpha tubulin-2A [Triticum aestivum]
 gb|ABD92931.1| alpha tubulin-2D [Triticum aestivum]
 gb|ABD92932.1| alpha tubulin-2B [Triticum aestivum]
 gb|EMS59370.1| Tubulin alpha chain [Triticum urartu]
 gb|EMT25007.1| Tubulin alpha chain [Aegilops tauschii]
Length=451

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|KIZ03400.1| Tubulin alpha chain [Monoraphidium neglectum]
Length=451

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 163/170 (96%), Positives = 168/170 (99%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEP+SMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPASMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNA+VATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNASVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            +VAEVFSR+DHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  AVAEVFSRLDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>gb|AAB08791.1| alpha tubulin [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q9ZRB7.1|TBA_WHEAT RecName: Full=Tubulin alpha chain [Triticum aestivum]
 gb|AAD10486.1| alpha-tubulin [Triticum aestivum]
Length=451

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



>sp|Q96460.1|TBA2_HORVU RecName: Full=Tubulin alpha-2 chain [Hordeum vulgare]
 emb|CAA69724.1| alpha-tubulin 2 [Hordeum vulgare subsp. vulgare]
Length=451

 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/170 (97%), Positives = 166/170 (98%), Gaps = 0/170 (0%)
 Frame = -3

Query  703  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMVKCDPRHGKYMACCLMFRGD  524
            PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMM KCDPRHGKYMACCLM+RGD
Sbjct  263  PRIHFMLSSYAPVISAEKAYHEQLSVAEITNSAFEPSSMMAKCDPRHGKYMACCLMYRGD  322

Query  523  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPTVVPGGDLAKVQRAVCMISNST  344
            VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPP VVPGGDLAKVQRAVCMISNST
Sbjct  323  VVPKDVNAAVATIKTKRTIQFVDWCPTGFKCGINYQPPGVVPGGDLAKVQRAVCMISNST  382

Query  343  SVAEVFSRIDHKFDLMYCKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  194
            SV EVFSRIDHKFDLMY KRAFVHWYVGEGMEEGEFSEAREDLAALEKDY
Sbjct  383  SVVEVFSRIDHKFDLMYAKRAFVHWYVGEGMEEGEFSEAREDLAALEKDY  432



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1206563851350