BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038F04

Length=182
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO38779.1|  hypothetical protein CISIN_1g033174mg                 48.1    2e-05   Citrus sinensis [apfelsine]
emb|CDP00656.1|  unnamed protein product                              45.8    8e-05   Coffea canephora [robusta coffee]
ref|XP_008351008.1|  PREDICTED: probable protein phosphatase 2C 15    47.4    1e-04   
gb|KJB31458.1|  hypothetical protein B456_005G192600                  47.8    2e-04   Gossypium raimondii
ref|XP_007044253.1|  Phosphatase 2C family protein                    47.8    2e-04   
gb|KHG10433.1|  hypothetical protein F383_12376                       47.8    2e-04   Gossypium arboreum [tree cotton]
ref|XP_002312412.1|  phosphatase 2C family protein                    47.8    2e-04   
ref|XP_011022405.1|  PREDICTED: probable protein phosphatase 2C 15    47.8    2e-04   Populus euphratica
gb|KDP29451.1|  hypothetical protein JCGZ_18372                       47.8    2e-04   Jatropha curcas
gb|KJB31457.1|  hypothetical protein B456_005G192600                  47.8    2e-04   Gossypium raimondii
ref|XP_009588474.1|  PREDICTED: probable protein phosphatase 2C 3...  47.4    2e-04   
ref|XP_006448420.1|  hypothetical protein CICLE_v10018331mg           47.4    2e-04   
ref|XP_009588467.1|  PREDICTED: probable protein phosphatase 2C 1...  47.8    2e-04   Nicotiana tomentosiformis
ref|XP_009588473.1|  PREDICTED: probable protein phosphatase 2C 3...  47.4    2e-04   Nicotiana tomentosiformis
ref|XP_006448418.1|  hypothetical protein CICLE_v10015330mg           47.8    2e-04   Citrus clementina [clementine]
ref|XP_009767028.1|  PREDICTED: probable protein phosphatase 2C 3...  47.4    2e-04   Nicotiana sylvestris
ref|XP_009767020.1|  PREDICTED: probable protein phosphatase 2C 1...  47.8    2e-04   Nicotiana sylvestris
ref|XP_006378470.1|  hypothetical protein POPTR_0010s13130g           47.8    2e-04   
ref|XP_009767026.1|  PREDICTED: probable protein phosphatase 2C 3...  47.4    2e-04   Nicotiana sylvestris
ref|XP_008339644.1|  PREDICTED: probable protein phosphatase 2C 15    47.4    2e-04   Malus domestica [apple tree]
ref|XP_002527010.1|  protein phosphatase, putative                    47.4    2e-04   Ricinus communis
ref|XP_009357108.1|  PREDICTED: probable protein phosphatase 2C 15    47.4    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_008389261.1|  PREDICTED: probable protein phosphatase 2C 15    47.4    2e-04   
ref|XP_009356234.1|  PREDICTED: probable protein phosphatase 2C 15    47.4    2e-04   Pyrus x bretschneideri [bai li]
ref|XP_004135083.1|  PREDICTED: probable protein phosphatase 2C 1...  47.4    2e-04   Cucumis sativus [cucumbers]
ref|XP_008446622.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  47.4    2e-04   Cucumis melo [Oriental melon]
ref|XP_004497062.1|  PREDICTED: probable protein phosphatase 2C 1...  46.6    5e-04   Cicer arietinum [garbanzo]
ref|XP_007142943.1|  hypothetical protein PHAVU_007G030400g           46.6    5e-04   Phaseolus vulgaris [French bean]
ref|XP_010279327.1|  PREDICTED: probable protein phosphatase 2C 15    46.2    7e-04   Nelumbo nucifera [Indian lotus]
emb|CDP00657.1|  unnamed protein product                              45.8    7e-04   Coffea canephora [robusta coffee]
ref|XP_010264732.1|  PREDICTED: probable protein phosphatase 2C 15    45.8    8e-04   Nelumbo nucifera [Indian lotus]
emb|CDX81511.1|  BnaC02g18150D                                        45.8    8e-04   
ref|XP_009127629.1|  PREDICTED: probable protein phosphatase 2C 15    45.8    8e-04   Brassica rapa
ref|XP_010470790.1|  PREDICTED: probable protein phosphatase 2C 15    45.8    9e-04   Camelina sativa [gold-of-pleasure]
ref|NP_177008.1|  putative protein phosphatase 2C 15                  45.8    9e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006302270.1|  hypothetical protein CARUB_v10020313mg           45.8    9e-04   Capsella rubella
emb|CDY44900.1|  BnaA02g13820D                                        45.8    9e-04   Brassica napus [oilseed rape]
ref|XP_004299042.1|  PREDICTED: probable protein phosphatase 2C 15    45.8    9e-04   Fragaria vesca subsp. vesca
ref|XP_010415460.1|  PREDICTED: probable protein phosphatase 2C 15    45.8    0.001   Camelina sativa [gold-of-pleasure]
ref|XP_002888662.1|  hypothetical protein ARALYDRAFT_894606           45.8    0.001   Arabidopsis lyrata subsp. lyrata
ref|XP_011076402.1|  PREDICTED: probable protein phosphatase 2C 1...  45.8    0.001   Sesamum indicum [beniseed]
dbj|BAH20040.1|  AT1G68410                                            45.8    0.001   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511830.1|  PREDICTED: probable protein phosphatase 2C 15    45.4    0.001   Camelina sativa [gold-of-pleasure]



>gb|KDO38779.1| hypothetical protein CISIN_1g033174mg [Citrus sinensis]
Length=125

 Score = 48.1 bits (113),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  88   GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  125



>emb|CDP00656.1| unnamed protein product [Coffea canephora]
Length=56

 Score = 45.8 bits (107),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  19   GSIISTSSKPWQGPFLGSGCRNKKDAMEGKRPSGVKV  55



>ref|XP_008351008.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=248

 Score = 47.4 bits (111),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  211  GSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  248



>gb|KJB31458.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=427

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  390  GSIFSTSSKPWQGPFLCAACRNKKDAMEGKRPSGVKVA  427



>ref|XP_007044253.1| Phosphatase 2C family protein [Theobroma cacao]
 gb|EOY00085.1| Phosphatase 2C family protein [Theobroma cacao]
Length=428

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSTKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>gb|KHG10433.1| hypothetical protein F383_12376 [Gossypium arboreum]
Length=426

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  389  GSIFSTSSKPWQGPFLCAACRNKKDAMEGKRPSGVKVA  426



>ref|XP_002312412.1| phosphatase 2C family protein [Populus trichocarpa]
 gb|EEE89779.1| phosphatase 2C family protein [Populus trichocarpa]
Length=428

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>ref|XP_011022405.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022414.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022422.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022430.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022439.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
 ref|XP_011022447.1| PREDICTED: probable protein phosphatase 2C 15 [Populus euphratica]
Length=428

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>gb|KDP29451.1| hypothetical protein JCGZ_18372 [Jatropha curcas]
Length=432

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  395  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  432



>gb|KJB31457.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31459.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
 gb|KJB31460.1| hypothetical protein B456_005G192600 [Gossypium raimondii]
Length=428

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCAACRNKKDAMEGKRPSGVKVA  428



>ref|XP_009588474.1| PREDICTED: probable protein phosphatase 2C 3 isoform X3 [Nicotiana 
tomentosiformis]
Length=369

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  332  GSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  369



>ref|XP_006448420.1| hypothetical protein CICLE_v10018331mg [Citrus clementina]
 gb|ESR61660.1| hypothetical protein CICLE_v10018331mg [Citrus clementina]
Length=352

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  315  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  352



>ref|XP_009588467.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588468.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588469.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588470.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588471.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009588472.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
tomentosiformis]
Length=429

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  392  GSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  429



>ref|XP_009588473.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=377

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  340  GSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  377



>ref|XP_006448418.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006448419.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 ref|XP_006468741.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Citrus sinensis]
 ref|XP_006468742.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Citrus sinensis]
 gb|ESR61658.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
 gb|ESR61659.1| hypothetical protein CICLE_v10015330mg [Citrus clementina]
Length=428

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKVA  428



>ref|XP_009767028.1| PREDICTED: probable protein phosphatase 2C 3 isoform X3 [Nicotiana 
sylvestris]
Length=369

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  332  GSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  369



>ref|XP_009767020.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767021.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767022.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767023.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767024.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009767025.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Nicotiana 
sylvestris]
Length=429

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  392  GSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  429



>ref|XP_006378470.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
 gb|ERP56267.1| hypothetical protein POPTR_0010s13130g [Populus trichocarpa]
Length=428

 Score = 47.8 bits (112),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVRVA  428



>ref|XP_009767026.1| PREDICTED: probable protein phosphatase 2C 3 isoform X2 [Nicotiana 
sylvestris]
Length=377

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  340  GSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  377



>ref|XP_008339644.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=428

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  428



>ref|XP_002527010.1| protein phosphatase, putative [Ricinus communis]
 gb|EEF35382.1| protein phosphatase, putative [Ricinus communis]
Length=428

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCADCRDKKDAMEGKRPSGVKVA  428



>ref|XP_009357108.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  428



>ref|XP_008389261.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
 ref|XP_008360042.1| PREDICTED: probable protein phosphatase 2C 15 [Malus domestica]
Length=427

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  390  GSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  427



>ref|XP_009356234.1| PREDICTED: probable protein phosphatase 2C 15 [Pyrus x bretschneideri]
Length=428

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  391  GSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRVA  428



>ref|XP_004135083.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus]
 ref|XP_004159290.1| PREDICTED: probable protein phosphatase 2C 15-like [Cucumis sativus]
 gb|KGN52100.1| hypothetical protein Csa_5G610350 [Cucumis sativus]
Length=433

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  396  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVRVA  433



>ref|XP_008446622.1| PREDICTED: LOW QUALITY PROTEIN: probable protein phosphatase 
2C 15 [Cucumis melo]
Length=434

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV VA
Sbjct  397  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVRVA  434



>ref|XP_004497062.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X1 
[Cicer arietinum]
 ref|XP_004497063.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X2 
[Cicer arietinum]
 ref|XP_004497064.1| PREDICTED: probable protein phosphatase 2C 15-like isoform X3 
[Cicer arietinum]
Length=429

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV V+
Sbjct  392  GSIFSTSSKPWQGPFLCSDCRDKKDAMEGKRPSGVKVS  429



>ref|XP_007142943.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
 gb|ESW14937.1| hypothetical protein PHAVU_007G030400g [Phaseolus vulgaris]
Length=431

 Score = 46.6 bits (109),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 24/38 (63%), Gaps = 0/38 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXVA  68
            G+I S S  PWQGPFL   CR  KD   GKR SGV V+
Sbjct  394  GSIFSTSSKPWQGPFLCSDCRDKKDAMEGKRPSGVKVS  431



>ref|XP_010279327.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279328.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279329.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010279330.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score = 46.2 bits (108),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  400  GSIFSTSTKPWQGPFLCADCRNKKDAMEGKRPSGVKV  436



>emb|CDP00657.1| unnamed protein product [Coffea canephora]
Length=399

 Score = 45.8 bits (107),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  362  GSIFSTSSKPWQGPFLCSDCRNKKDAMEGKRPSGVKV  398



>ref|XP_010264732.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
 ref|XP_010264741.1| PREDICTED: probable protein phosphatase 2C 15 [Nelumbo nucifera]
Length=437

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  400  GSIFSTSSKPWQGPFLCADCRNKKDAMEGKRPSGVKV  436



>emb|CDX81511.1| BnaC02g18150D [Brassica napus]
Length=438

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  401  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  437



>ref|XP_009127629.1| PREDICTED: probable protein phosphatase 2C 15 [Brassica rapa]
Length=426

 Score = 45.8 bits (107),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  389  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  425



>ref|XP_010470790.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470791.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010470792.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=439

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  402  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  438



>ref|NP_177008.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 ref|NP_001031252.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 sp|Q9M9C6.1|P2C15_ARATH RecName: Full=Probable protein phosphatase 2C 15; Short=AtPP2C15 
[Arabidopsis thaliana]
 gb|AAF26041.1|AC015986_4 putative protein phosphatase; 14863-16856 [Arabidopsis thaliana]
 gb|AAK92818.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AAM14234.1| putative protein phosphatase [Arabidopsis thaliana]
 gb|AEE34790.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
 gb|AEE34791.1| putative protein phosphatase 2C 15 [Arabidopsis thaliana]
Length=436

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  399  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  435



>ref|XP_006302270.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
 gb|EOA35168.1| hypothetical protein CARUB_v10020313mg [Capsella rubella]
Length=437

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  400  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  436



>emb|CDY44900.1| BnaA02g13820D [Brassica napus]
Length=413

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  376  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  412



>ref|XP_004299042.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
 ref|XP_011464089.1| PREDICTED: probable protein phosphatase 2C 15 [Fragaria vesca 
subsp. vesca]
Length=429

 Score = 45.8 bits (107),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  392  GSIFSMSSKPWQGPFLCSDCRNKKDAMEGKRPSGVRV  428



>ref|XP_010415460.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=442

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  405  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  441



>ref|XP_002888662.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64921.1| hypothetical protein ARALYDRAFT_894606 [Arabidopsis lyrata subsp. 
lyrata]
Length=438

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  401  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  437



>ref|XP_011076402.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
 ref|XP_011076409.1| PREDICTED: probable protein phosphatase 2C 15 isoform X1 [Sesamum 
indicum]
Length=428

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  391  GSIFSMSSKPWQGPFLCADCRNKKDAMEGKRPSGVRV  427



>dbj|BAH20040.1| AT1G68410 [Arabidopsis thaliana]
Length=436

 Score = 45.8 bits (107),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  399  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  435



>ref|XP_010511830.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
 ref|XP_010511832.1| PREDICTED: probable protein phosphatase 2C 15 [Camelina sativa]
Length=440

 Score = 45.4 bits (106),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -2

Query  181  GAIXSXSXXPWQGPFLXXXCRXXKDXXXGKRXSGVXV  71
            G+I S S  PWQGPFL   CR  KD   GKR SGV V
Sbjct  403  GSIFSTSLKPWQGPFLCTDCRDKKDAMEGKRPSGVKV  439



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553399861725