BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038E21

Length=729
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP00979.1|  unnamed protein product                                375   1e-124   Coffea canephora [robusta coffee]
ref|XP_009793584.1|  PREDICTED: amino acid permease 6-like              374   3e-124   Nicotiana sylvestris
gb|EYU34219.1|  hypothetical protein MIMGU_mgv1a005305mg                373   8e-124   Erythranthe guttata [common monkey flower]
emb|CDP00978.1|  unnamed protein product                                372   1e-123   Coffea canephora [robusta coffee]
ref|XP_011074307.1|  PREDICTED: amino acid permease 6                   372   2e-123   Sesamum indicum [beniseed]
ref|XP_011078457.1|  PREDICTED: amino acid permease 6-like              368   6e-122   Sesamum indicum [beniseed]
gb|KHG13110.1|  Amino acid permease 6 -like protein                     365   2e-121   Gossypium arboreum [tree cotton]
ref|XP_010245602.1|  PREDICTED: amino acid permease 6                   366   2e-121   Nelumbo nucifera [Indian lotus]
ref|XP_007018375.1|  Amino acid permease 6                              364   1e-120   
ref|XP_009629042.1|  PREDICTED: amino acid permease 6-like              363   6e-120   Nicotiana tomentosiformis
ref|NP_199774.1|  amino acid permease 6                                 361   2e-119   Arabidopsis thaliana [mouse-ear cress]
gb|KJB14684.1|  hypothetical protein B456_002G137400                    360   7e-119   Gossypium raimondii
gb|KHG24473.1|  Amino acid permease 6 -like protein                     358   2e-118   Gossypium arboreum [tree cotton]
gb|KJB58749.1|  hypothetical protein B456_009G224500                    361   2e-118   Gossypium raimondii
ref|XP_010482241.1|  PREDICTED: amino acid permease 6-like isofor...    358   2e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002865746.1|  hypothetical protein ARALYDRAFT_495022             359   3e-118   
ref|XP_010440833.1|  PREDICTED: amino acid permease 6-like              356   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_010442428.1|  PREDICTED: amino acid permease 6                   356   2e-117   Camelina sativa [gold-of-pleasure]
ref|XP_006280391.1|  hypothetical protein CARUB_v10026318mg             355   4e-117   Capsella rubella
ref|XP_010556498.1|  PREDICTED: amino acid permease 6                   355   5e-117   Tarenaya hassleriana [spider flower]
ref|XP_009127448.1|  PREDICTED: amino acid permease 6                   355   6e-117   Brassica rapa
gb|KJB64021.1|  hypothetical protein B456_010G029800                    354   1e-116   Gossypium raimondii
emb|CAD92450.1|  amino acid permease 6                                  353   4e-116   Brassica napus [oilseed rape]
gb|KJB64022.1|  hypothetical protein B456_010G029800                    353   7e-116   Gossypium raimondii
ref|XP_008466098.1|  PREDICTED: amino acid permease 6-like              345   2e-115   Cucumis melo [Oriental melon]
gb|EYU36417.1|  hypothetical protein MIMGU_mgv1a005426mg                350   3e-115   Erythranthe guttata [common monkey flower]
gb|ADB92670.1|  amino acid permease 6                                   349   9e-115   Populus tremula x Populus alba [gray poplar]
ref|XP_011017028.1|  PREDICTED: amino acid permease 6-like              349   1e-114   Populus euphratica
ref|XP_008368120.1|  PREDICTED: amino acid permease 6-like              340   1e-114   
gb|KGN60300.1|  hypothetical protein Csa_3G894480                       339   2e-114   Cucumis sativus [cucumbers]
ref|XP_002301129.2|  amino acid transport protein AAP2                  348   3e-114   
ref|XP_010553668.1|  PREDICTED: amino acid permease 1-like              348   4e-114   Tarenaya hassleriana [spider flower]
ref|XP_004299846.1|  PREDICTED: amino acid permease 6-like              347   8e-114   Fragaria vesca subsp. vesca
ref|XP_009357221.1|  PREDICTED: amino acid permease 6-like              345   4e-113   Pyrus x bretschneideri [bai li]
gb|KDP41551.1|  hypothetical protein JCGZ_15958                         344   8e-113   Jatropha curcas
ref|XP_008219153.1|  PREDICTED: amino acid permease 6-like              344   1e-112   Prunus mume [ume]
emb|CDY46779.1|  BnaCnng14480D                                          343   1e-112   Brassica napus [oilseed rape]
ref|XP_010061591.1|  PREDICTED: amino acid permease 6-like              343   2e-112   Eucalyptus grandis [rose gum]
ref|XP_007222665.1|  hypothetical protein PRUPE_ppa004980mg             343   2e-112   
ref|XP_003588450.1|  Amino acid transporter                             343   3e-112   Medicago truncatula
ref|XP_004136237.1|  PREDICTED: amino acid permease 6-like              342   4e-112   Cucumis sativus [cucumbers]
ref|XP_010269102.1|  PREDICTED: amino acid permease 6-like              342   6e-112   
gb|KHN37208.1|  Amino acid permease 6                                   342   7e-112   Glycine soja [wild soybean]
ref|XP_003526513.1|  PREDICTED: amino acid permease 6-like              342   1e-111   Glycine max [soybeans]
ref|XP_002285557.1|  PREDICTED: amino acid permease 6                   341   1e-111   Vitis vinifera
ref|XP_010320244.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    340   2e-111   
ref|XP_009335480.1|  PREDICTED: amino acid permease 6-like              340   2e-111   Pyrus x bretschneideri [bai li]
gb|KHN08198.1|  Amino acid permease 6                                   340   3e-111   Glycine soja [wild soybean]
ref|NP_001242816.1|  uncharacterized protein LOC100777963               340   3e-111   Glycine max [soybeans]
ref|XP_002510013.1|  amino acid transporter, putative                   340   3e-111   Ricinus communis
ref|XP_008339056.1|  PREDICTED: amino acid permease 6                   340   4e-111   
ref|XP_008378686.1|  PREDICTED: amino acid permease 6-like              330   5e-111   
gb|AFK46687.1|  unknown                                                 332   7e-111   Lotus japonicus
ref|XP_007137276.1|  hypothetical protein PHAVU_009G113800g             339   9e-111   Phaseolus vulgaris [French bean]
emb|CDY53793.1|  BnaCnng25620D                                          338   1e-110   Brassica napus [oilseed rape]
ref|XP_003603665.1|  Amino acid permease                                338   1e-110   Medicago truncatula
ref|XP_004498452.1|  PREDICTED: amino acid permease 6-like              338   1e-110   
emb|CAD92449.1|  amino acid permease 1                                  338   2e-110   Brassica napus [oilseed rape]
gb|AFK42490.1|  unknown                                                 338   3e-110   Medicago truncatula
ref|XP_009102845.1|  PREDICTED: amino acid permease 1                   336   1e-109   Brassica rapa
emb|CDY48843.1|  BnaA09g14700D                                          336   2e-109   Brassica napus [oilseed rape]
ref|XP_010064702.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    336   2e-109   
gb|KJB59872.1|  hypothetical protein B456_009G278100                    335   3e-109   Gossypium raimondii
ref|XP_006392303.1|  hypothetical protein EUTSA_v10023431mg             335   3e-109   Eutrema salsugineum [saltwater cress]
emb|CDY44564.1|  BnaA01g21750D                                          336   3e-109   Brassica napus [oilseed rape]
ref|XP_004501076.1|  PREDICTED: amino acid permease 6-like              335   5e-109   Cicer arietinum [garbanzo]
ref|XP_006302194.1|  hypothetical protein CARUB_v10020203mg             332   3e-108   Capsella rubella
gb|KHG12273.1|  Amino acid permease 6 -like protein                     331   4e-108   Gossypium arboreum [tree cotton]
gb|AAB87674.1|  neutral amino acid transport system II                  332   4e-108   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176132.1|  amino acid permease 1                                 332   5e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010268971.1|  PREDICTED: amino acid permease 6-like              332   5e-108   Nelumbo nucifera [Indian lotus]
emb|CDY49542.1|  BnaCnng17660D                                          322   6e-108   Brassica napus [oilseed rape]
emb|CDY60248.1|  BnaC01g42990D                                          332   8e-108   Brassica napus [oilseed rape]
emb|CDY04349.1|  BnaC04g18440D                                          331   2e-107   
gb|KDO81360.1|  hypothetical protein CISIN_1g011548mg                   324   3e-107   Citrus sinensis [apfelsine]
emb|CAA70968.2|  amino acid transporter                                 330   3e-107   Solanum tuberosum [potatoes]
ref|XP_010268968.1|  PREDICTED: amino acid permease 6-like isofor...    329   4e-107   Nelumbo nucifera [Indian lotus]
ref|XP_007161529.1|  hypothetical protein PHAVU_001G077000g             329   5e-107   Phaseolus vulgaris [French bean]
ref|XP_009138576.1|  PREDICTED: amino acid permease 1-like              329   7e-107   Brassica rapa
gb|KDO81359.1|  hypothetical protein CISIN_1g011548mg                   324   9e-107   Citrus sinensis [apfelsine]
ref|XP_010104540.1|  hypothetical protein L484_025514                   328   1e-106   Morus notabilis
ref|XP_002888218.1|  hypothetical protein ARALYDRAFT_893658             328   1e-106   Arabidopsis lyrata subsp. lyrata
emb|CDY04448.1|  BnaA03g59400D                                          330   2e-106   
gb|KFK40897.1|  hypothetical protein AALP_AA2G057600                    327   6e-106   Arabis alpina [alpine rockcress]
ref|XP_006433701.1|  hypothetical protein CICLE_v10000981mg             327   7e-106   Citrus clementina [clementine]
gb|KDO81356.1|  hypothetical protein CISIN_1g011548mg                   326   1e-105   Citrus sinensis [apfelsine]
ref|XP_010667459.1|  PREDICTED: amino acid permease 6-like              326   1e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006472367.1|  PREDICTED: amino acid permease 6-like              325   3e-105   Citrus sinensis [apfelsine]
ref|XP_010269103.1|  PREDICTED: amino acid permease 6-like              324   3e-105   Nelumbo nucifera [Indian lotus]
ref|XP_006417504.1|  hypothetical protein EUTSA_v10007516mg             324   6e-105   Eutrema salsugineum [saltwater cress]
ref|XP_003550117.1|  PREDICTED: amino acid permease 6                   323   2e-104   Glycine max [soybeans]
ref|XP_010511080.1|  PREDICTED: amino acid permease 1-like              318   3e-104   Camelina sativa [gold-of-pleasure]
ref|XP_006346279.1|  PREDICTED: amino acid permease 6-like              321   5e-104   
ref|XP_010414737.1|  PREDICTED: amino acid permease 1-like              320   3e-103   Camelina sativa [gold-of-pleasure]
ref|NP_001233983.1|  amino acid transporter                             319   3e-103   
emb|CDY22607.1|  BnaC08g42410D                                          319   6e-103   Brassica napus [oilseed rape]
ref|XP_010470262.1|  PREDICTED: amino acid permease 1                   318   2e-102   Camelina sativa [gold-of-pleasure]
gb|KDO49532.1|  hypothetical protein CISIN_1g046038mg                   310   2e-102   Citrus sinensis [apfelsine]
ref|XP_006307429.1|  hypothetical protein CARUB_v10009053mg             316   7e-102   Capsella rubella
ref|XP_004955421.1|  PREDICTED: amino acid permease 6-like              316   9e-102   Setaria italica
ref|XP_009627462.1|  PREDICTED: amino acid permease 6-like              314   3e-101   Nicotiana tomentosiformis
ref|XP_009792204.1|  PREDICTED: amino acid permease 6-like              313   6e-101   Nicotiana sylvestris
ref|XP_006487060.1|  PREDICTED: amino acid permease 6-like              313   9e-101   Citrus sinensis [apfelsine]
ref|XP_009113317.1|  PREDICTED: amino acid permease 1                   314   1e-100   Brassica rapa
ref|XP_010314596.1|  PREDICTED: LOW QUALITY PROTEIN: amino acid p...    313   1e-100   
ref|XP_010475859.1|  PREDICTED: amino acid permease 8-like              311   3e-100   Camelina sativa [gold-of-pleasure]
emb|CDY63746.1|  BnaC05g07760D                                          307   4e-100   Brassica napus [oilseed rape]
ref|XP_010458325.1|  PREDICTED: amino acid permease 8                   311   4e-100   Camelina sativa [gold-of-pleasure]
emb|CDY62728.1|  BnaC05g49210D                                          311   5e-100   Brassica napus [oilseed rape]
ref|XP_010490519.1|  PREDICTED: amino acid permease 8-like              311   5e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006306441.1|  hypothetical protein CARUB_v10012383mg             310   2e-99    Capsella rubella
ref|XP_002889785.1|  hypothetical protein ARALYDRAFT_471112             310   2e-99    
ref|NP_172472.1|  amino acid permease 8                                 310   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148321.1|  PREDICTED: amino acid permease 8                   309   3e-99    Brassica rapa
ref|XP_009118278.1|  PREDICTED: amino acid permease 8-like              309   4e-99    Brassica rapa
ref|XP_002889784.1|  hypothetical protein ARALYDRAFT_888258             308   9e-99    Arabidopsis lyrata subsp. lyrata
ref|XP_002461426.1|  hypothetical protein SORBIDRAFT_02g002440          307   2e-98    Sorghum bicolor [broomcorn]
emb|CDY57932.1|  BnaA06g38010D                                          305   6e-98    Brassica napus [oilseed rape]
emb|CDY22608.1|  BnaC08g42420D                                          306   1e-97    Brassica napus [oilseed rape]
gb|KFK43301.1|  hypothetical protein AALP_AA1G106500                    305   1e-97    Arabis alpina [alpine rockcress]
ref|XP_009148319.1|  PREDICTED: amino acid permease 8-like              305   1e-97    Brassica rapa
ref|XP_006417505.1|  hypothetical protein EUTSA_v10009701mg             305   2e-97    Eutrema salsugineum [saltwater cress]
ref|XP_009118276.1|  PREDICTED: amino acid permease 8-like isofor...    302   2e-96    Brassica rapa
gb|EMT23821.1|  hypothetical protein F775_31800                         297   4e-96    
gb|EYU39081.1|  hypothetical protein MIMGU_mgv1a023099mg                300   6e-96    Erythranthe guttata [common monkey flower]
ref|XP_009118279.1|  PREDICTED: amino acid permease 8-like              301   8e-96    Brassica rapa
gb|KEH43993.1|  transmembrane amino acid transporter family protein     300   9e-96    Medicago truncatula
emb|CDY22609.1|  BnaC08g42430D                                          300   1e-95    Brassica napus [oilseed rape]
emb|CDY53831.1|  BnaA09g57230D                                          300   2e-95    Brassica napus [oilseed rape]
ref|XP_009148320.1|  PREDICTED: amino acid permease 8-like              299   2e-95    Brassica rapa
ref|XP_009397328.1|  PREDICTED: amino acid permease 6                   299   3e-95    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY57931.1|  BnaA06g38000D                                          299   3e-95    Brassica napus [oilseed rape]
ref|XP_010243490.1|  PREDICTED: amino acid permease 6-like              298   4e-95    
ref|XP_010475860.1|  PREDICTED: amino acid permease 8-like              297   1e-94    Camelina sativa [gold-of-pleasure]
dbj|BAJ85485.1|  predicted protein                                      297   1e-94    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH43996.1|  transmembrane amino acid transporter family protein     296   3e-94    Medicago truncatula
ref|XP_010095743.1|  hypothetical protein L484_003355                   297   3e-94    
ref|XP_003557617.1|  PREDICTED: amino acid permease 6                   296   4e-94    Brachypodium distachyon [annual false brome]
ref|XP_010490547.1|  PREDICTED: amino acid permease 8-like isofor...    295   5e-94    
gb|EYU39082.1|  hypothetical protein MIMGU_mgv1a020135mg                293   3e-93    Erythranthe guttata [common monkey flower]
ref|XP_007042690.1|  Amino acid permease 1                              293   6e-93    
ref|XP_011002369.1|  PREDICTED: amino acid permease 6-like              293   7e-93    Populus euphratica
ref|XP_010458324.1|  PREDICTED: amino acid permease 8-like              290   1e-92    Camelina sativa [gold-of-pleasure]
ref|XP_006657428.1|  PREDICTED: amino acid permease 6-like              293   1e-92    Oryza brachyantha
ref|XP_002313926.2|  hypothetical protein POPTR_0009s08840g             292   1e-92    Populus trichocarpa [western balsam poplar]
gb|KHN39882.1|  Amino acid permease 2                                   290   3e-92    Glycine soja [wild soybean]
dbj|BAC82953.1|  putative amino acid permease                           290   4e-92    Oryza sativa Japonica Group [Japonica rice]
gb|EEE66520.1|  hypothetical protein OsJ_22995                          291   5e-92    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010943299.1|  PREDICTED: amino acid permease 6                   291   5e-92    Elaeis guineensis
gb|KCW68582.1|  hypothetical protein EUGRSUZ_F02192                     290   5e-92    Eucalyptus grandis [rose gum]
gb|EEC81471.1|  hypothetical protein OsI_24794                          291   6e-92    Oryza sativa Indica Group [Indian rice]
ref|NP_001058839.1|  Os07g0134000                                       291   6e-92    
gb|EMS56484.1|  hypothetical protein TRIUR3_26560                       297   6e-92    Triticum urartu
gb|KJB79478.1|  hypothetical protein B456_013G052100                    290   8e-92    Gossypium raimondii
ref|XP_008801682.1|  PREDICTED: amino acid permease 6                   290   1e-91    
gb|EYU39084.1|  hypothetical protein MIMGU_mgv1a018317mg                290   1e-91    Erythranthe guttata [common monkey flower]
gb|AAK33098.1|  amino acid transporter                                  290   2e-91    Glycine max [soybeans]
ref|XP_006590854.1|  PREDICTED: amino acid permease 2-like              290   2e-91    Glycine max [soybeans]
ref|NP_001136620.1|  uncharacterized protein LOC100216745               288   4e-91    Zea mays [maize]
ref|XP_003540867.1|  PREDICTED: amino acid permease 2                   290   4e-91    Glycine max [soybeans]
gb|KHN25477.1|  Amino acid permease 2                                   290   4e-91    Glycine soja [wild soybean]
tpg|DAA59488.1|  TPA: hypothetical protein ZEAMMB73_156584              288   4e-91    
ref|XP_007213109.1|  hypothetical protein PRUPE_ppa023539mg             288   9e-91    Prunus persica
ref|XP_008227520.1|  PREDICTED: amino acid permease 4 isoform X3        288   9e-91    Prunus mume [ume]
ref|XP_008227519.1|  PREDICTED: amino acid permease 4 isoform X2        288   9e-91    Prunus mume [ume]
ref|XP_008227518.1|  PREDICTED: amino acid permease 4 isoform X1        288   9e-91    Prunus mume [ume]
ref|XP_002522103.1|  amino acid transporter, putative                   286   1e-90    Ricinus communis
ref|XP_011031114.1|  PREDICTED: amino acid permease 4-like isofor...    288   1e-90    Populus euphratica
ref|XP_011031113.1|  PREDICTED: amino acid permease 4-like isofor...    288   1e-90    Populus euphratica
ref|XP_006382883.1|  amino acid permease AAP1 family protein            287   1e-90    Populus trichocarpa [western balsam poplar]
ref|XP_002307053.2|  hypothetical protein POPTR_0005s06990g             287   2e-90    Populus trichocarpa [western balsam poplar]
ref|XP_006380397.1|  hypothetical protein POPTR_0007s04710g             287   2e-90    
gb|KEH43995.1|  transmembrane amino acid transporter family protein     286   2e-90    Medicago truncatula
ref|XP_010269036.1|  PREDICTED: amino acid permease 3-like              286   2e-90    Nelumbo nucifera [Indian lotus]
ref|XP_009389175.1|  PREDICTED: amino acid permease 4-like              287   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011022870.1|  PREDICTED: amino acid permease 4-like              287   3e-90    Populus euphratica
ref|XP_008788441.1|  PREDICTED: amino acid permease 4-like              287   3e-90    Phoenix dactylifera
emb|CDY53832.1|  BnaA09g57240D                                          298   4e-90    Brassica napus [oilseed rape]
ref|XP_004496860.1|  PREDICTED: amino acid permease 6-like              285   5e-90    Cicer arietinum [garbanzo]
gb|ABR18002.1|  unknown                                                 285   1e-89    Picea sitchensis
ref|XP_004289864.1|  PREDICTED: amino acid permease 4-like              286   1e-89    Fragaria vesca subsp. vesca
emb|CDO96925.1|  unnamed protein product                                285   2e-89    Coffea canephora [robusta coffee]
ref|XP_004515440.1|  PREDICTED: amino acid permease 6-like              284   2e-89    
ref|XP_010025744.1|  PREDICTED: amino acid permease 4-like              283   5e-89    Eucalyptus grandis [rose gum]
ref|XP_002312967.2|  hypothetical protein POPTR_0009s13610g             281   5e-89    
gb|KEH43994.1|  transmembrane amino acid transporter family protein     283   5e-89    Medicago truncatula
ref|XP_004497265.1|  PREDICTED: amino acid permease 6-like              282   1e-88    
gb|EYU37943.1|  hypothetical protein MIMGU_mgv1a004721mg                283   2e-88    Erythranthe guttata [common monkey flower]
ref|XP_011046334.1|  PREDICTED: amino acid permease 3-like              283   2e-88    Populus euphratica
ref|XP_008236004.1|  PREDICTED: amino acid permease 3-like              283   2e-88    Prunus mume [ume]
ref|XP_010920126.1|  PREDICTED: amino acid permease 4-like              282   3e-88    Elaeis guineensis
ref|XP_002278086.1|  PREDICTED: amino acid permease 3                   282   3e-88    Vitis vinifera
ref|XP_009764610.1|  PREDICTED: amino acid permease 3-like isofor...    278   6e-88    Nicotiana sylvestris
ref|XP_008377748.1|  PREDICTED: amino acid permease 3-like              281   1e-87    
ref|XP_008781630.1|  PREDICTED: amino acid permease 3                   280   1e-87    Phoenix dactylifera
ref|XP_008654977.1|  PREDICTED: amino acid carrier isoform X1           279   1e-87    
ref|XP_010095435.1|  hypothetical protein L484_013392                   279   2e-87    
ref|XP_004505788.1|  PREDICTED: amino acid permease 2-like              280   2e-87    Cicer arietinum [garbanzo]
ref|XP_004962032.1|  PREDICTED: amino acid permease 3-like isofor...    279   2e-87    Setaria italica
ref|XP_009604405.1|  PREDICTED: amino acid permease 4-like              280   3e-87    Nicotiana tomentosiformis
ref|XP_007198986.1|  hypothetical protein PRUPE_ppa020916mg             279   4e-87    Prunus persica
gb|KHN23179.1|  Amino acid permease 6                                   276   5e-87    Glycine soja [wild soybean]
ref|XP_009764609.1|  PREDICTED: amino acid permease 4-like isofor...    279   6e-87    Nicotiana sylvestris
ref|XP_010912574.1|  PREDICTED: amino acid permease 3-like              278   7e-87    Elaeis guineensis
dbj|BAJ93107.1|  predicted protein                                      279   8e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010028716.1|  PREDICTED: amino acid permease 4-like              278   8e-87    Eucalyptus grandis [rose gum]
ref|XP_003535676.1|  PREDICTED: amino acid permease 6-like              277   9e-87    Glycine max [soybeans]
ref|NP_001149036.1|  amino acid carrier                                 277   1e-86    
gb|KDO57534.1|  hypothetical protein CISIN_1g015342mg                   274   2e-86    Citrus sinensis [apfelsine]
gb|KDP29639.1|  hypothetical protein JCGZ_18801                         278   2e-86    Jatropha curcas
gb|EYU20407.1|  hypothetical protein MIMGU_mgv1a018639mg                276   2e-86    Erythranthe guttata [common monkey flower]
ref|XP_007048506.1|  Amino acid permease 2 isoform 1                    276   3e-86    
ref|XP_011081743.1|  PREDICTED: amino acid permease 8-like isofor...    276   3e-86    Sesamum indicum [beniseed]
ref|XP_002534252.1|  amino acid transporter, putative                   276   4e-86    
ref|XP_011081742.1|  PREDICTED: amino acid permease 8-like isofor...    276   4e-86    
ref|XP_006387142.1|  hypothetical protein POPTR_1711s00200g             265   5e-86    
gb|KDO68036.1|  hypothetical protein CISIN_1g010376mg                   268   5e-86    Citrus sinensis [apfelsine]
ref|XP_003563762.1|  PREDICTED: amino acid permease 3-like              275   6e-86    Brachypodium distachyon [annual false brome]
gb|KGN54767.1|  hypothetical protein Csa_4G470690                       269   9e-86    Cucumis sativus [cucumbers]
ref|XP_002439825.1|  hypothetical protein SORBIDRAFT_09g020790          275   1e-85    
ref|XP_010090330.1|  hypothetical protein L484_024995                   275   1e-85    Morus notabilis
ref|XP_006656161.1|  PREDICTED: amino acid permease 1-like              274   1e-85    
gb|AFW86930.1|  hypothetical protein ZEAMMB73_950309                    270   1e-85    
ref|XP_009767545.1|  PREDICTED: amino acid permease 3-like              274   1e-85    Nicotiana sylvestris
ref|XP_006654425.1|  PREDICTED: amino acid permease 3-like              275   1e-85    
emb|CAC51425.1|  amino acid permease AAP4                               274   2e-85    Vicia faba var. minor [tick bean]
ref|XP_006464914.1|  PREDICTED: amino acid permease 2-like              274   2e-85    Citrus sinensis [apfelsine]
ref|XP_011074825.1|  PREDICTED: amino acid permease 3-like              274   2e-85    Sesamum indicum [beniseed]
ref|XP_006432100.1|  hypothetical protein CICLE_v10000986mg             274   2e-85    Citrus clementina [clementine]
ref|NP_001057853.1|  Os06g0556000                                       273   3e-85    
ref|XP_002968812.1|  hypothetical protein SELMODRAFT_90661              273   3e-85    
ref|XP_009421017.1|  PREDICTED: amino acid permease 3-like              271   4e-85    
ref|XP_006365537.1|  PREDICTED: amino acid permease 3-like              273   4e-85    Solanum tuberosum [potatoes]
gb|EMT07264.1|  hypothetical protein F775_06597                         272   4e-85    
gb|KDP34177.1|  hypothetical protein JCGZ_07748                         268   4e-85    Jatropha curcas
ref|XP_003568418.2|  PREDICTED: amino acid permease 3-like isofor...    273   4e-85    Brachypodium distachyon [annual false brome]
gb|KEH30491.1|  transmembrane amino acid transporter family protein     274   4e-85    Medicago truncatula
ref|XP_010231354.1|  PREDICTED: amino acid permease 3-like isofor...    273   4e-85    Brachypodium distachyon [annual false brome]
gb|KEH30492.1|  transmembrane amino acid transporter family protein     274   5e-85    Medicago truncatula
ref|XP_011458812.1|  PREDICTED: amino acid permease 3-like isofor...    273   5e-85    Fragaria vesca subsp. vesca
ref|XP_004290907.1|  PREDICTED: amino acid permease 3-like isofor...    273   5e-85    Fragaria vesca subsp. vesca
ref|XP_008442267.1|  PREDICTED: amino acid permease 4-like              272   5e-85    Cucumis melo [Oriental melon]
gb|KJB75356.1|  hypothetical protein B456_012G038000                    274   5e-85    Gossypium raimondii
ref|XP_009390075.1|  PREDICTED: amino acid permease 4-like isofor...    273   6e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010322323.1|  PREDICTED: amino acid transporter isoform X1       272   6e-85    Solanum lycopersicum
ref|XP_003630316.1|  Amino acid permease                                272   6e-85    
gb|KDO68037.1|  hypothetical protein CISIN_1g010376mg                   270   6e-85    Citrus sinensis [apfelsine]
ref|XP_009390074.1|  PREDICTED: amino acid permease 4-like isofor...    273   7e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007143143.1|  hypothetical protein PHAVU_007G047400g             272   8e-85    Phaseolus vulgaris [French bean]
ref|XP_003542145.1|  PREDICTED: amino acid permease 3 isoform X1        272   8e-85    Glycine max [soybeans]
ref|XP_002974163.1|  hypothetical protein SELMODRAFT_100110             271   8e-85    
ref|XP_008442173.1|  PREDICTED: amino acid permease 4-like              272   8e-85    Cucumis melo [Oriental melon]
gb|KHN19623.1|  Amino acid permease 3                                   272   1e-84    Glycine soja [wild soybean]
ref|XP_006596218.1|  PREDICTED: amino acid permease 3-like isofor...    272   1e-84    Glycine max [soybeans]
ref|XP_004144658.1|  PREDICTED: amino acid permease 4-like              271   1e-84    
ref|XP_009596720.1|  PREDICTED: amino acid permease 3-like isofor...    272   1e-84    Nicotiana tomentosiformis
gb|KHN02164.1|  Amino acid permease 6                                   270   1e-84    Glycine soja [wild soybean]
ref|XP_009596721.1|  PREDICTED: amino acid permease 3-like isofor...    272   1e-84    
gb|EMT26484.1|  hypothetical protein F775_32730                         272   1e-84    
emb|CAA70778.1|  amino acid transporter                                 272   1e-84    Vicia faba [broad bean]
gb|AFK37021.1|  unknown                                                 273   1e-84    Medicago truncatula
ref|XP_009388107.1|  PREDICTED: amino acid permease 3-like              271   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011027477.1|  PREDICTED: amino acid permease 3-like              271   2e-84    Populus euphratica
gb|KDO68034.1|  hypothetical protein CISIN_1g010376mg                   269   2e-84    Citrus sinensis [apfelsine]
ref|XP_002302224.2|  hypothetical protein POPTR_0002s08000g             271   2e-84    
gb|KEH35330.1|  transmembrane amino acid transporter family protein     271   2e-84    Medicago truncatula
ref|XP_004151465.1|  PREDICTED: amino acid permease 4-like              269   2e-84    
ref|XP_010691537.1|  PREDICTED: amino acid permease 6-like              272   3e-84    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007041865.1|  Amino acid permease 2 isoform 1                    272   3e-84    
emb|CDY36017.1|  BnaA08g04440D                                          271   3e-84    Brassica napus [oilseed rape]
ref|XP_009118275.1|  PREDICTED: amino acid permease 8-like isofor...    271   4e-84    Brassica rapa
gb|KEH35328.1|  transmembrane amino acid transporter family protein     270   4e-84    Medicago truncatula
gb|AII99817.1|  amino acid transporter                                  270   4e-84    Nicotiana tabacum [American tobacco]
ref|XP_004156002.1|  PREDICTED: amino acid permease 4-like              270   4e-84    
ref|XP_002437146.1|  hypothetical protein SORBIDRAFT_10g021980          271   4e-84    Sorghum bicolor [broomcorn]
ref|XP_004498350.1|  PREDICTED: amino acid permease 3-like isofor...    270   5e-84    Cicer arietinum [garbanzo]
ref|XP_006351135.1|  PREDICTED: amino acid permease 3-like              270   6e-84    Solanum tuberosum [potatoes]
ref|NP_001234606.1|  amino acid transporter                             270   7e-84    
ref|XP_010911284.1|  PREDICTED: amino acid permease 3-like isofor...    270   8e-84    Elaeis guineensis
ref|XP_008658969.1|  PREDICTED: uncharacterized protein LOC100501...    270   1e-83    
ref|XP_010911278.1|  PREDICTED: amino acid permease 3-like isofor...    270   1e-83    
ref|NP_196484.1|  amino acid permease 2                                 270   1e-83    
ref|XP_006386355.1|  amino acid permease which transports basic a...    269   1e-83    
ref|XP_008810907.1|  PREDICTED: amino acid permease 3-like              268   2e-83    
gb|EYU39083.1|  hypothetical protein MIMGU_mgv1a014160mg                259   2e-83    
ref|XP_007161468.1|  hypothetical protein PHAVU_001G071500g             266   2e-83    
gb|KDO68035.1|  hypothetical protein CISIN_1g010376mg                   270   2e-83    
ref|XP_010270272.1|  PREDICTED: amino acid permease 3                   268   2e-83    
gb|KJB15783.1|  hypothetical protein B456_002G196200                    269   3e-83    
gb|AAM61227.1|  amino acid transport protein AAP2                       268   3e-83    
dbj|BAJ91439.1|  predicted protein                                      268   3e-83    
ref|XP_006486755.1|  PREDICTED: amino acid permease 3-like              269   3e-83    
dbj|BAJ86012.1|  predicted protein                                      268   3e-83    
ref|XP_004965605.1|  PREDICTED: amino acid permease 6-like              268   3e-83    
emb|CDP08191.1|  unnamed protein product                                268   3e-83    
ref|XP_010229892.1|  PREDICTED: amino acid permease 8-like              268   3e-83    
ref|XP_011027691.1|  PREDICTED: amino acid permease 3-like              265   4e-83    
ref|XP_009414606.1|  PREDICTED: amino acid permease 3-like              268   4e-83    
ref|XP_009107481.1|  PREDICTED: amino acid permease 5-like              268   4e-83    
ref|NP_001140430.1|  hypothetical protein                               268   4e-83    
ref|XP_002871360.1|  hypothetical protein ARALYDRAFT_487723             268   4e-83    
ref|XP_010484145.1|  PREDICTED: amino acid permease 4                   267   4e-83    
gb|AIS71894.1|  amino acid transporter                                  268   5e-83    
ref|XP_008219594.1|  PREDICTED: amino acid permease 3-like              268   6e-83    
ref|XP_006422618.1|  hypothetical protein CICLE_v10028230mg             268   6e-83    
ref|XP_001784036.1|  predicted protein                                  267   6e-83    
ref|XP_002516532.1|  amino acid transporter, putative                   265   7e-83    
emb|CDP20237.1|  unnamed protein product                                265   8e-83    
ref|XP_007137762.1|  hypothetical protein PHAVU_009G153700g             266   8e-83    
gb|AIL30502.1|  amino acid transporter                                  267   9e-83    
gb|EMS57663.1|  hypothetical protein TRIUR3_25238                       266   9e-83    
ref|XP_006422746.1|  hypothetical protein CICLE_v100286921mg            260   9e-83    
ref|XP_002458869.1|  hypothetical protein SORBIDRAFT_03g041840          267   1e-82    
gb|KJB33339.1|  hypothetical protein B456_006G007300                    266   1e-82    
ref|XP_007137763.1|  hypothetical protein PHAVU_009G153700g             266   1e-82    
ref|XP_006393747.1|  hypothetical protein EUTSA_v10011449mg             266   2e-82    
ref|XP_006307383.1|  hypothetical protein CARUB_v10009009mg             266   2e-82    
ref|NP_201190.1|  amino acid permease 4                                 266   2e-82    
ref|XP_010461080.1|  PREDICTED: amino acid permease 4-like              266   2e-82    
gb|KHG16478.1|  Amino acid permease 2 -like protein                     266   2e-82    
ref|XP_007137761.1|  hypothetical protein PHAVU_009G153700g             267   2e-82    
ref|XP_006279782.1|  hypothetical protein CARUB_v10027867mg             266   2e-82    
gb|AAX56951.1|  amino acid transporter                                  266   3e-82    
ref|XP_009390766.1|  PREDICTED: amino acid permease 4-like              266   3e-82    
ref|XP_006287587.1|  hypothetical protein CARUB_v10000805mg             266   3e-82    
emb|CAA54631.1|  amino acid transporter                                 265   3e-82    
ref|XP_006852748.1|  hypothetical protein AMTR_s00033p00114390          265   3e-82    
ref|XP_010546307.1|  PREDICTED: amino acid permease 2 isoform X2        263   4e-82    
ref|XP_010461433.1|  PREDICTED: amino acid permease 5-like              263   4e-82    
ref|XP_007137460.1|  hypothetical protein PHAVU_009G128600g             265   4e-82    
gb|ACR35411.1|  unknown                                                 261   4e-82    
emb|CAH59424.1|  amino acid permease                                    256   4e-82    
gb|EYU23867.1|  hypothetical protein MIMGU_mgv1a005496mg                265   5e-82    
ref|XP_009609434.1|  PREDICTED: amino acid permease 3-like              265   5e-82    
gb|EYU32508.1|  hypothetical protein MIMGU_mgv1a005226mg                265   7e-82    
emb|CDP02900.1|  unnamed protein product                                265   7e-82    
gb|EYU32509.1|  hypothetical protein MIMGU_mgv1a005226mg                265   7e-82    
gb|AAM62803.1|  amino acid carrier, putative                            265   8e-82    
ref|XP_010527720.1|  PREDICTED: amino acid permease 5-like isofor...    265   8e-82    
ref|XP_003634405.1|  PREDICTED: amino acid permease 3                   265   9e-82    
gb|EMS65401.1|  hypothetical protein TRIUR3_22906                       261   9e-82    
gb|KDO80515.1|  hypothetical protein CISIN_1g0115802mg                  260   9e-82    
ref|XP_010416679.1|  PREDICTED: amino acid permease 3-like              264   9e-82    
emb|CAN61092.1|  hypothetical protein VITISV_005276                     264   1e-81    
ref|XP_010530203.1|  PREDICTED: amino acid permease 5                   264   1e-81    
ref|NP_177862.1|  amino acid permease 3                                 264   1e-81    
ref|XP_010490563.1|  PREDICTED: amino acid permease 8-like isofor...    263   1e-81    
ref|XP_010500132.1|  PREDICTED: amino acid permease 5-like isofor...    264   1e-81    
ref|XP_008789212.1|  PREDICTED: amino acid permease 8-like              264   2e-81    
ref|XP_010423021.1|  PREDICTED: amino acid permease 2-like              264   2e-81    
ref|XP_011019567.1|  PREDICTED: amino acid permease 8-like              264   2e-81    
ref|XP_004160712.1|  PREDICTED: amino acid permease 3-like              260   2e-81    
ref|XP_010479037.1|  PREDICTED: amino acid permease 5 isoform X1        263   2e-81    
ref|XP_010546306.1|  PREDICTED: amino acid permease 4 isoform X1        263   2e-81    
ref|XP_007222611.1|  hypothetical protein PRUPE_ppa004936mg             263   2e-81    
gb|AAM13223.1|  amino acid transporter AAP4                             263   2e-81    
ref|XP_004142635.1|  PREDICTED: amino acid permease 3-like              263   2e-81    
gb|AAM61320.1|  amino acid transporter AAP4                             263   2e-81    
ref|XP_008444195.1|  PREDICTED: amino acid permease 3-like              263   3e-81    
ref|XP_009801366.1|  PREDICTED: amino acid permease 3-like              263   3e-81    
emb|CDY60629.1|  BnaAnng17090D                                          261   3e-81    
gb|ADE75660.1|  unknown                                                 263   4e-81    
ref|XP_010452897.1|  PREDICTED: amino acid permease 2                   263   4e-81    
ref|XP_002864872.1|  hypothetical protein ARALYDRAFT_496573             262   5e-81    
ref|XP_010527719.1|  PREDICTED: amino acid permease 5-like isofor...    264   5e-81    
ref|NP_001055592.1|  Os05g0424000                                       263   5e-81    
gb|EMT28649.1|  hypothetical protein F775_26310                         263   5e-81    
ref|XP_006300985.1|  hypothetical protein CARUB_v10021374mg             262   6e-81    
dbj|BAK03497.1|  predicted protein                                      262   6e-81    
gb|ABR16450.1|  unknown                                                 262   7e-81    
ref|XP_002520323.1|  amino acid transporter, putative                   262   7e-81    
gb|KHN31184.1|  Amino acid permease 2                                   256   8e-81    
gb|AFW65567.1|  hypothetical protein ZEAMMB73_193502                    258   8e-81    
gb|KJB59301.1|  hypothetical protein B456_009G248600                    261   8e-81    
ref|XP_002889140.1|  hypothetical protein ARALYDRAFT_476902             262   8e-81    
ref|XP_009339426.1|  PREDICTED: amino acid permease 3-like              262   1e-80    
gb|KHG20963.1|  Amino acid permease 3 -like protein                     262   1e-80    
ref|XP_008466753.1|  PREDICTED: amino acid permease 3-like              261   1e-80    
ref|XP_008338673.1|  PREDICTED: amino acid permease 3-like              262   1e-80    
ref|NP_001142349.1|  hypothetical protein                               262   1e-80    
ref|XP_009145052.1|  PREDICTED: amino acid permease 5                   261   1e-80    
emb|CAN77083.1|  hypothetical protein VITISV_003992                     263   1e-80    
ref|XP_009411898.1|  PREDICTED: amino acid permease 3-like isofor...    261   1e-80    
ref|XP_009106399.1|  PREDICTED: amino acid permease 3                   261   1e-80    
gb|EMT11988.1|  hypothetical protein F775_30582                         259   1e-80    
ref|XP_010232650.1|  PREDICTED: amino acid permease 3-like              261   2e-80    
gb|EMS58805.1|  hypothetical protein TRIUR3_05113                       253   2e-80    
ref|XP_009411897.1|  PREDICTED: amino acid permease 3-like isofor...    261   2e-80    
ref|XP_009379863.1|  PREDICTED: amino acid permease 4-like              261   2e-80    
gb|KDP32820.1|  hypothetical protein JCGZ_12112                         261   2e-80    
ref|XP_002449171.1|  hypothetical protein SORBIDRAFT_05g005980          261   2e-80    
gb|KFK42132.1|  hypothetical protein AALP_AA2G215300                    261   2e-80    
ref|XP_006847199.1|  hypothetical protein AMTR_s00017p00252280          261   2e-80    
ref|XP_010444306.1|  PREDICTED: amino acid permease 4-like              260   2e-80    
ref|XP_006386360.1|  hypothetical protein POPTR_0002s08040g             261   2e-80    
ref|XP_006434261.1|  hypothetical protein CICLE_v10000991mg             261   2e-80    
gb|KGN47695.1|  hypothetical protein Csa_6G381850                       261   2e-80    
emb|CDX87522.1|  BnaA07g33510D                                          261   2e-80    
ref|XP_004149429.1|  PREDICTED: amino acid permease 3-like              261   3e-80    
ref|XP_009377726.1|  PREDICTED: amino acid permease 3-like              261   3e-80    
ref|XP_009404321.1|  PREDICTED: amino acid permease 4-like              261   3e-80    
ref|XP_004290905.1|  PREDICTED: amino acid permease 3-like              260   3e-80    
ref|XP_007137459.1|  hypothetical protein PHAVU_009G128500g             261   3e-80    
ref|XP_010491540.1|  PREDICTED: amino acid permease 2-like              261   3e-80    
ref|NP_001233979.1|  amino acid transporter                             260   4e-80    
ref|XP_008662536.1|  PREDICTED: amino acid permease 3-like              260   4e-80    
ref|XP_010063420.1|  PREDICTED: amino acid permease 3-like              260   5e-80    
ref|XP_008368062.1|  PREDICTED: amino acid permease 3-like              260   5e-80    
emb|CDY31348.1|  BnaA02g33930D                                          259   5e-80    
ref|XP_007019167.1|  Amino acid permease isoform 1                      260   5e-80    
ref|XP_002309530.2|  hypothetical protein POPTR_0006s25230g             260   6e-80    
emb|CDX88364.1|  BnaC06g38080D                                          259   6e-80    
ref|XP_007019168.1|  Amino acid permease isoform 2                      260   6e-80    
ref|XP_006473027.1|  PREDICTED: amino acid permease 3-like              259   6e-80    
emb|CDY39844.1|  BnaC02g42740D                                          259   6e-80    
gb|KJB16327.1|  hypothetical protein B456_002G223200                    256   7e-80    
ref|XP_006399392.1|  hypothetical protein EUTSA_v10013363mg             260   7e-80    
ref|XP_009130275.1|  PREDICTED: amino acid permease 4                   259   7e-80    
ref|XP_006646758.1|  PREDICTED: amino acid permease 3-like              260   8e-80    
dbj|BAK03421.1|  predicted protein                                      259   8e-80    
ref|XP_002977532.1|  hypothetical protein SELMODRAFT_176236             259   9e-80    
gb|KJB16326.1|  hypothetical protein B456_002G223200                    256   1e-79    
ref|XP_009342937.1|  PREDICTED: amino acid permease 2-like              257   1e-79    
dbj|BAJ95327.1|  predicted protein                                      259   1e-79    
ref|XP_011102302.1|  PREDICTED: amino acid permease 3 isoform X2        259   1e-79    
gb|EEC81839.1|  hypothetical protein OsI_25597                          258   1e-79    
gb|EMT10658.1|  hypothetical protein F775_06068                         257   1e-79    
ref|XP_008679681.1|  PREDICTED: amino acid permease 3-like              258   2e-79    
ref|XP_011102300.1|  PREDICTED: amino acid permease 3 isoform X1        259   2e-79    
ref|XP_007222588.1|  hypothetical protein PRUPE_ppa004920mg             258   2e-79    
ref|XP_008219592.1|  PREDICTED: amino acid permease 3-like isofor...    258   2e-79    
ref|XP_008219591.1|  PREDICTED: amino acid permease 3-like isofor...    258   2e-79    
ref|XP_011003419.1|  PREDICTED: amino acid permease 3-like              258   2e-79    
ref|XP_009381189.1|  PREDICTED: amino acid permease 3-like              258   2e-79    
ref|XP_002516531.1|  amino acid transporter, putative                   258   3e-79    
ref|XP_011002449.1|  PREDICTED: amino acid permease 3-like              258   3e-79    
ref|XP_008377310.1|  PREDICTED: amino acid permease 3-like              258   3e-79    
ref|XP_003527948.1|  PREDICTED: amino acid permease 3                   258   3e-79    
gb|AFW65566.1|  hypothetical protein ZEAMMB73_193502                    249   3e-79    
ref|XP_007137760.1|  hypothetical protein PHAVU_009G153600g             258   3e-79    
emb|CDM85443.1|  unnamed protein product                                258   3e-79    
emb|CAA54632.1|  amino acid permease                                    258   3e-79    
emb|CDX78353.1|  BnaA03g02650D                                          258   3e-79    
ref|XP_009339433.1|  PREDICTED: amino acid permease 3-like              258   3e-79    
emb|CAF22024.1|  amino acid permease                                    258   4e-79    
ref|XP_010428816.1|  PREDICTED: amino acid permease 3                   258   4e-79    
ref|XP_006394236.1|  hypothetical protein EUTSA_v10004152mg             257   4e-79    
ref|XP_010063933.1|  PREDICTED: amino acid permease 3-like              258   4e-79    
gb|EPS61237.1|  amino acid transporter                                  253   5e-79    
ref|XP_010063423.1|  PREDICTED: amino acid permease 3-like              257   5e-79    
tpg|DAA38913.1|  TPA: hypothetical protein ZEAMMB73_639977              256   5e-79    
gb|EEE52230.1|  hypothetical protein OsJ_34158                          256   5e-79    
ref|XP_003522571.1|  PREDICTED: amino acid permease 3-like isofor...    257   5e-79    
ref|XP_010674405.1|  PREDICTED: amino acid permease 4                   257   6e-79    
gb|KHN44307.1|  Amino acid permease 3                                   257   6e-79    
ref|XP_008799058.1|  PREDICTED: amino acid permease 3-like              257   7e-79    
ref|XP_002275881.1|  PREDICTED: amino acid permease 3 isoform X2        257   7e-79    
gb|AAG50558.1|AC074228_13  amino acid permease, putative                257   7e-79    
ref|NP_175076.2|  amino acid permease 5                                 257   7e-79    
ref|XP_010652912.1|  PREDICTED: amino acid permease 3 isoform X1        257   7e-79    
ref|NP_001170050.1|  uncharacterized protein LOC100383966               255   8e-79    
ref|NP_001067425.1|  Os11g0195600                                       256   8e-79    
gb|AAX56952.1|  amino acid transporter                                  256   8e-79    
ref|XP_008668462.1|  PREDICTED: uncharacterized protein LOC100383...    256   1e-78    
ref|XP_010915382.1|  PREDICTED: amino acid permease 1-like              256   1e-78    
gb|EAY84081.1|  hypothetical protein OsI_05462                          256   1e-78    
ref|XP_009131105.1|  PREDICTED: amino acid permease 2                   256   1e-78    
ref|XP_010471931.1|  PREDICTED: amino acid permease 3-like              256   2e-78    
gb|KJB16325.1|  hypothetical protein B456_002G223200                    256   2e-78    
ref|XP_009122500.1|  PREDICTED: amino acid permease 2                   256   2e-78    
emb|CDM85442.1|  unnamed protein product                                256   2e-78    
emb|CAN65437.1|  hypothetical protein VITISV_038918                     256   2e-78    
ref|XP_008338672.1|  PREDICTED: amino acid permease 3-like              256   2e-78    
ref|XP_003523211.1|  PREDICTED: amino acid permease 2-like              256   3e-78    
ref|XP_006662801.1|  PREDICTED: amino acid permease 3-like              255   3e-78    
ref|NP_001045595.1|  Os02g0102200                                       256   3e-78    
ref|XP_002302223.1|  hypothetical protein POPTR_0002s07960g             255   3e-78    
emb|CDY21569.1|  BnaC09g47230D                                          255   4e-78    
ref|XP_006386354.1|  hypothetical protein POPTR_0002s07960g             255   4e-78    
emb|CDX88365.1|  BnaC06g38090D                                          255   4e-78    
dbj|BAO45885.1|  amino acid permease                                    255   4e-78    
ref|XP_006366236.1|  PREDICTED: amino acid permease 3-like              254   4e-78    
ref|XP_008219720.1|  PREDICTED: amino acid permease 3-like              255   4e-78    
emb|CDY62727.1|  BnaC05g49200D                                          254   5e-78    
ref|XP_002449174.1|  hypothetical protein SORBIDRAFT_05g006010          254   5e-78    
ref|XP_002893978.1|  hypothetical protein ARALYDRAFT_473798             254   6e-78    
ref|XP_002520322.1|  amino acid transporter, putative                   254   6e-78    
ref|XP_003526505.1|  PREDICTED: amino acid permease 6-like isofor...    254   6e-78    
ref|XP_008663834.1|  PREDICTED: uncharacterized protein LOC103642302    266   7e-78    
ref|XP_011027478.1|  PREDICTED: amino acid permease 3-like isofor...    254   7e-78    
ref|XP_011027479.1|  PREDICTED: amino acid permease 3-like isofor...    254   7e-78    
ref|XP_004978919.1|  PREDICTED: amino acid permease 3-like              254   7e-78    
ref|XP_011003418.1|  PREDICTED: amino acid permease 3-like              254   8e-78    
gb|AFW56250.1|  hypothetical protein ZEAMMB73_465553                    265   1e-77    
ref|XP_002975129.1|  hypothetical protein SELMODRAFT_442676             254   1e-77    
gb|ABK24505.1|  unknown                                                 253   1e-77    
emb|CAA10608.1|  amino acid carrier                                     253   1e-77    
ref|XP_010684694.1|  PREDICTED: amino acid permease 3-like              254   2e-77    
ref|XP_006390096.1|  hypothetical protein EUTSA_v10018484mg             253   2e-77    
gb|EPS60160.1|  hypothetical protein M569_14643                         249   2e-77    



>emb|CDP00979.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   375 bits (962),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 178/210 (85%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPE+KVMK ASGVGV+TTTLFYVLCGC GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  272  PPESKVMKWASGVGVSTTTLFYVLCGCTGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVF QP+F FVE+RCS  WP++KFI  E+ VNVP +GT  IN FRLVWRT 
Sbjct  332  IAIHLIGAYQVFAQPIFGFVENRCSSIWPENKFINTEHAVNVPLYGTYYINLFRLVWRTV  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAV+AMIFPFFNDFLGLIGA SFYPLTVYFPIEMHIAQ KIPKYS RWIWLK+LSW
Sbjct  392  YVILTAVIAMIFPFFNDFLGLIGAGSFYPLTVYFPIEMHIAQAKIPKYSVRWIWLKVLSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVSLVAAAGSIQGL  DVKTYKPFK Q
Sbjct  452  ACLVVSLVAAAGSIQGLSQDVKTYKPFKTQ  481



>ref|XP_009793584.1| PREDICTED: amino acid permease 6-like [Nicotiana sylvestris]
Length=481

 Score =   374 bits (959),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 171/210 (81%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPE+KVMK+AS  GV+TTTLFY+LCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  271  PPESKVMKRASLAGVSTTTLFYILCGTIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQPL+ FVE+RC++RW DSKFIT+EY V VPC G  ++N FRLVWRT 
Sbjct  331  IAVHLVGAYQVFCQPLYGFVEARCNERWSDSKFITSEYAVQVPCCGVYNVNLFRLVWRTA  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAV+AMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQ KIPKYSF W+WLKILSW
Sbjct  391  YVVVTAVIAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQRKIPKYSFTWVWLKILSW  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            TCLVVSLVAAAGSIQGL   +K YKPF  Q
Sbjct  451  TCLVVSLVAAAGSIQGLVTSLKHYKPFSTQ  480



>gb|EYU34219.1| hypothetical protein MIMGU_mgv1a005305mg [Erythranthe guttata]
Length=489

 Score =   373 bits (957),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 177/211 (84%), Positives = 188/211 (89%), Gaps = 1/211 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKAS VGV+TTT+FYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  279  PPENRVMKKASFVGVSTTTIFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  338

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVP-CFGTCSINFFRLVWRT  373
            IAIHL+GAYQVF QP+F FVE  C ++WP++KFIT E+   +P C   C IN FRLVWRT
Sbjct  339  IAIHLVGAYQVFAQPIFGFVEKLCRRKWPENKFITKEHAAKIPLCGPNCKINLFRLVWRT  398

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSF WIWLKILS
Sbjct  399  SYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFTWIWLKILS  458

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            W CLVVSLVAAAGSIQGL  DVK YKPFK Q
Sbjct  459  WACLVVSLVAAAGSIQGLAHDVKAYKPFKTQ  489



>emb|CDP00978.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   372 bits (955),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 174/210 (83%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPE+KVMK+ASGVGV+T TLFYVLCGC+GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  272  PPESKVMKRASGVGVSTITLFYVLCGCIGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVF QP+F FVE+RCS +WP++KFI  E+ VNVP +GT  IN FRL WRT 
Sbjct  332  IAIHLIGAYQVFAQPIFGFVENRCSSKWPENKFINTEHAVNVPLYGTYYINLFRLAWRTV  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAV+A+IFPFFNDFLGLIGA SFYPLTVYFPIEMHIAQ KIPKYS RWIWLK+LSW
Sbjct  392  YVILTAVIAVIFPFFNDFLGLIGAGSFYPLTVYFPIEMHIAQAKIPKYSVRWIWLKVLSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVSLVAAAGSIQ L  DVKTYKPFK Q
Sbjct  452  ACLVVSLVAAAGSIQKLSQDVKTYKPFKTQ  481



>ref|XP_011074307.1| PREDICTED: amino acid permease 6 [Sesamum indicum]
Length=483

 Score =   372 bits (954),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 176/211 (83%), Positives = 192/211 (91%), Gaps = 1/211 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENKVMKKAS VGVTTTT+FYVLCGC+GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  273  PAENKVMKKASFVGVTTTTVFYVLCGCVGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCF-GTCSINFFRLVWRT  373
            IA+HLIGAYQVF QPLF FVE+  SQ++PD+KFIT E+ VN+P   G+ +INFFRLVWRT
Sbjct  333  IAVHLIGAYQVFAQPLFGFVENHYSQKYPDNKFITTEHAVNIPLLCGSYNINFFRLVWRT  392

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YV+VTA++AMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQ KIPKYSF W+WLKILS
Sbjct  393  AYVVVTALIAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQNKIPKYSFSWMWLKILS  452

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            W CLVVS+VAAAGSIQGL  DVKTYKPFK Q
Sbjct  453  WACLVVSVVAAAGSIQGLAEDVKTYKPFKTQ  483



>ref|XP_011078457.1| PREDICTED: amino acid permease 6-like [Sesamum indicum]
Length=485

 Score =   368 bits (944),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS VGV TTT+FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  276  PPENKVMKKASLVGVVTTTVFYVLCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  335

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVF QP+F FVESR SQ+WP++KFITAE+ V +P  G  S+N FR+VWRT 
Sbjct  336  IAVHLVGAYQVFTQPIFGFVESRSSQKWPENKFITAEHAVRIPLCGVLSVNLFRMVWRTI  395

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVT ++AMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQ KIPK+SF W+WLKI+SW
Sbjct  396  YVIVTTIIAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQAKIPKFSFTWMWLKIISW  455

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            TC++VSL+AAAGSIQGL  DV+ +KPFK Q
Sbjct  456  TCMIVSLIAAAGSIQGLAHDVRRFKPFKTQ  485



>gb|KHG13110.1| Amino acid permease 6 -like protein [Gossypium arboreum]
 gb|KHG26079.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=433

 Score =   365 bits (936),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS +GV+TTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  223  PPENKSMKRASSIGVSTTTLFYVLCGLIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  282

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVF QPLF FVE  CS+ WP+SKFIT+E+ V+VP +G   +NFFRLVWRT 
Sbjct  283  IAIHLIGAYQVFAQPLFGFVEGWCSRNWPNSKFITSEHAVDVPFYGIYYLNFFRLVWRTA  342

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAVVAMIFPFFNDFLGLIGA SF+PLTVYFPIEMHIAQ+K PKYSFRWIWLKILSW
Sbjct  343  YVIITAVVAMIFPFFNDFLGLIGAGSFWPLTVYFPIEMHIAQSKTPKYSFRWIWLKILSW  402

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVSL+AAAGS+QGL   +KTYKPF+ Q
Sbjct  403  VCLVVSLIAAAGSVQGLIQSLKTYKPFQTQ  432



>ref|XP_010245602.1| PREDICTED: amino acid permease 6 [Nelumbo nucifera]
Length=487

 Score =   366 bits (940),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 169/210 (80%), Positives = 190/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS +GV+TTTLFYVLCGC+GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  275  PPENKVMKKASFIGVSTTTLFYVLCGCVGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  334

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP++ FVE  C+ RWP++ FI+ EY +N+P +G  +INFFR+VWRT 
Sbjct  335  IAIHLIGAYQVFCQPVYGFVEKWCNHRWPENGFISTEYAINIPAYGAYNINFFRVVWRTV  394

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAVVAMIFPFFNDFLGL+GAASF+PLTVYFPIEM+IAQ KIP++SF W WLKILSW
Sbjct  395  YVIVTAVVAMIFPFFNDFLGLLGAASFWPLTVYFPIEMYIAQAKIPRFSFTWTWLKILSW  454

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVS+VAAAGS+QGL  DVK YKPFK Q
Sbjct  455  ACLVVSIVAAAGSVQGLATDVKAYKPFKTQ  484



>ref|XP_007018375.1| Amino acid permease 6 [Theobroma cacao]
 gb|EOY15600.1| Amino acid permease 6 [Theobroma cacao]
Length=483

 Score =   364 bits (935),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 167/210 (80%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+A+ +GV+TTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFW+IDFANVC
Sbjct  273  PPENKSMKRATSIGVSTTTLFYVLCGLVGYAAFGNDAPGNFLTGFGFYEPFWMIDFANVC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQPLF FVE  C+  WPD+KFIT+E+ V+VP +G   INFFRLVWRT 
Sbjct  333  IAVHLIGAYQVFCQPLFGFVEGWCAGHWPDNKFITSEHAVDVPLYGIYYINFFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV AMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQTK+PKYSFRW+WLKILSW
Sbjct  393  YVIVTAVAAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQTKMPKYSFRWMWLKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VSL+AAAGSIQGL   +K Y+PF+ Q
Sbjct  453  ACLIVSLIAAAGSIQGLAQSLKAYRPFQTQ  482



>ref|XP_009629042.1| PREDICTED: amino acid permease 6-like [Nicotiana tomentosiformis]
Length=491

 Score =   363 bits (931),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 189/211 (90%), Gaps = 1/211 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENKVMK+AS VGV TTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  278  PEENKVMKRASLVGVFTTTLFYVLCGTIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  337

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTC-SINFFRLVWRT  373
            IAIHL+GAYQVFCQP++ FVE RCS+RWPD+KFIT+++ +N+P  G    +NFFRL+WRT
Sbjct  338  IAIHLVGAYQVFCQPIYGFVEGRCSERWPDNKFITSQHAINIPFSGHVYYVNFFRLLWRT  397

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YVIVTAV+AMIFPFFN FLGLIGAASFYPLTVY PIEMHIAQ KIPKYSF WIWL+ILS
Sbjct  398  AYVIVTAVIAMIFPFFNHFLGLIGAASFYPLTVYLPIEMHIAQRKIPKYSFTWIWLQILS  457

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            W CL+VSLVAAAGSIQGL  D+K YKPFK+Q
Sbjct  458  WGCLIVSLVAAAGSIQGLSQDLKAYKPFKSQ  488



>ref|NP_199774.1| amino acid permease 6 [Arabidopsis thaliana]
 sp|P92934.1|AAP6_ARATH RecName: Full=Amino acid permease 6; AltName: Full=Amino acid 
transporter AAP6 [Arabidopsis thaliana]
 emb|CAA65051.1| amino acid permease 6 [Arabidopsis thaliana]
 dbj|BAA97227.1| amino acid permease 6 [Arabidopsis thaliana]
 dbj|BAF00980.1| amino acid permease 6 [Arabidopsis thaliana]
 gb|AED95838.1| amino acid permease 6 [Arabidopsis thaliana]
Length=481

 Score =   361 bits (926),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 167/209 (80%), Positives = 189/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  272  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVES+ ++RWPD+KFIT EY+++VPC G  SINF RLVWRT 
Sbjct  332  IAVHLIGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKIHVPCCGDFSINFLRLVWRTS  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ KIPK+SF W WLKILSW
Sbjct  392  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFSFTWTWLKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            TC +VSLVAAAGS+QGL   +K +KPF+A
Sbjct  452  TCFIVSLVAAAGSVQGLIQSLKDFKPFQA  480



>gb|KJB14684.1| hypothetical protein B456_002G137400 [Gossypium raimondii]
Length=483

 Score =   360 bits (923),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 168/210 (80%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS +GV+TTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  273  PPENKSMKRASSIGVSTTTLFYVLCGLIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVF QPLF FVE   S+ WP+SKFIT+E+ V+VP +G   +NFFRLVWRT 
Sbjct  333  IAIHLIGAYQVFAQPLFGFVEGWWSRNWPNSKFITSEHAVDVPFYGIYYLNFFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAVVAMIFPFFNDFLGLIGA SF+PLTVYFPIEMHIAQ+K PKYSFRWIWLKILSW
Sbjct  393  YVIITAVVAMIFPFFNDFLGLIGAGSFWPLTVYFPIEMHIAQSKTPKYSFRWIWLKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVSL+AAAGS+QGL   +KTYKPF+ Q
Sbjct  453  VCLVVSLIAAAGSVQGLIQSLKTYKPFQTQ  482



>gb|KHG24473.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=480

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/210 (79%), Positives = 189/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+ASGVGVTTTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  268  PPENKSMKRASGVGVTTTTLFYVLCGIVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  327

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QPLF FVES C++ +PD+KFIT E+ ++VP  G   +NFFRLVWRT 
Sbjct  328  IAVHLIGAYQVFAQPLFGFVESLCARHYPDNKFITREHAMDVPFCGIYYLNFFRLVWRTA  387

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMIFPFFNDFLGLIGA SF+PLTVYFPIEMHIAQ KIPKYSFRW+WLKILSW
Sbjct  388  YVIVTAVLAMIFPFFNDFLGLIGAGSFWPLTVYFPIEMHIAQAKIPKYSFRWVWLKILSW  447

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++SL+AAAGS++GL   +KTYKPF+ +
Sbjct  448  VCLIISLIAAAGSVEGLIQSLKTYKPFQTR  477



>gb|KJB58749.1| hypothetical protein B456_009G224500 [Gossypium raimondii]
Length=561

 Score =   361 bits (927),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+A+ +GV+TTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  351  PPENKSMKRATTLGVSTTTLFYVLCGLVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  410

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVF QPLF FVE  C+++WPDSKFIT E+ V++PC+G   +N FRLVWRT 
Sbjct  411  IAIHLIGAYQVFAQPLFGFVEGWCARQWPDSKFITREHAVDIPCYGVYYLNLFRLVWRTS  470

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGA SF+PLTVYFPIEMHIAQT +PKYSFRW WLKILSW
Sbjct  471  YVVVTAVVAMIFPFFNDFLGLIGAGSFWPLTVYFPIEMHIAQTNLPKYSFRWTWLKILSW  530

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VSL+AAAGS+QGL   +KTYKPF+ Q
Sbjct  531  ACLIVSLIAAAGSVQGLIQSLKTYKPFQTQ  560



>ref|XP_010482241.1| PREDICTED: amino acid permease 6-like isoform X1 [Camelina sativa]
 ref|XP_010482242.1| PREDICTED: amino acid permease 6-like isoform X2 [Camelina sativa]
Length=481

 Score =   358 bits (920),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/209 (79%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  272  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY+V+VPC G  SINFFRLVWRT 
Sbjct  332  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITREYKVHVPCGGEFSINFFRLVWRTS  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ KI K+SF W WLKILSW
Sbjct  392  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKINKFSFTWTWLKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C +VSLVAAAGS+QGL   +K +KPF+A
Sbjct  452  ACFIVSLVAAAGSVQGLITSLKDFKPFQA  480



>ref|XP_002865746.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42005.1| hypothetical protein ARALYDRAFT_495022 [Arabidopsis lyrata subsp. 
lyrata]
Length=507

 Score =   359 bits (922),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 188/209 (90%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  298  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  357

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY+++VPC G  SINF RLVWRT 
Sbjct  358  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKIHVPCCGEFSINFLRLVWRTS  417

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ KIPK+SF W WLKILSW
Sbjct  418  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIPKFSFTWTWLKILSW  477

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C VVS+VAAAGS+QGL   +K +KPF+A
Sbjct  478  ACFVVSIVAAAGSVQGLITSLKDFKPFQA  506



>ref|XP_010440833.1| PREDICTED: amino acid permease 6-like [Camelina sativa]
Length=481

 Score =   356 bits (914),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 165/209 (79%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  272  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY+V+VPC G  SIN FRLVWRT 
Sbjct  332  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITREYKVHVPCCGEFSINLFRLVWRTS  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ KI K+SF W WLKILSW
Sbjct  392  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKINKFSFTWTWLKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C +VSLVAAAGS+QGL   +K +KPF+A
Sbjct  452  ACFIVSLVAAAGSVQGLITSLKDFKPFQA  480



>ref|XP_010442428.1| PREDICTED: amino acid permease 6 [Camelina sativa]
Length=481

 Score =   356 bits (913),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 187/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  272  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY+++VPC G  SIN FRLVWRT 
Sbjct  332  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITREYKIHVPCCGEFSINLFRLVWRTS  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ KI K+SF W WLKILSW
Sbjct  392  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKINKFSFTWTWLKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C +VSLVAAAGS+QGL   +K +KPF+A
Sbjct  452  ACFIVSLVAAAGSVQGLITSLKDFKPFQA  480



>ref|XP_006280391.1| hypothetical protein CARUB_v10026318mg [Capsella rubella]
 gb|EOA13289.1| hypothetical protein CARUB_v10026318mg [Capsella rubella]
Length=481

 Score =   355 bits (911),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 164/209 (78%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  272  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY++ VPC G  SINFFRLVWRT 
Sbjct  332  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKLQVPCCGEFSINFFRLVWRTS  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ KI K+SF W WLKILSW
Sbjct  392  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKIRKFSFTWTWLKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C +VSLVA AGS+QGL   +K +KPF+A
Sbjct  452  ACFIVSLVALAGSVQGLITSLKDFKPFQA  480



>ref|XP_010556498.1| PREDICTED: amino acid permease 6 [Tarenaya hassleriana]
Length=478

 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 163/210 (78%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT+FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  268  PAENKAMKRASLVGVSTTTMFYMLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  327

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F FVES+ ++RWPD++FIT EY +N+P  G   ++FFRLVWRT 
Sbjct  328  IAIHLIGAYQVFCQPIFQFVESQSAKRWPDNRFITGEYTINIPFCGEIYVSFFRLVWRTS  387

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ K+ K+S  W WLKILSW
Sbjct  388  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQRKMKKFSSTWTWLKILSW  447

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VSLVAAAGS+QGL   +KTYKPF+ Q
Sbjct  448  ACLIVSLVAAAGSVQGLIQSLKTYKPFQVQ  477



>ref|XP_009127448.1| PREDICTED: amino acid permease 6 [Brassica rapa]
Length=481

 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 163/209 (78%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  271  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY++NVPC G   I+ FRLVWRT 
Sbjct  331  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKMNVPCGGDFGISLFRLVWRTS  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ K+ K+SF W WLKILSW
Sbjct  391  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKMKKFSFTWTWLKILSW  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C +VSLVAAAGS+QGL   +K +KPF+A
Sbjct  451  ACFLVSLVAAAGSVQGLIQSLKDFKPFQA  479



>gb|KJB64021.1| hypothetical protein B456_010G029800 [Gossypium raimondii]
Length=486

 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+ASGVGVTTTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  274  PPENKSMKRASGVGVTTTTLFYVLCGIVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QPLF FVES C++ +PD+KFIT E+ ++VP  G   +NFFRLVWRT 
Sbjct  334  IAVHLIGAYQVFAQPLFGFVESLCARHYPDNKFITREHAMDVPFCGVYYLNFFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMIFPFFNDFLGLIGA SF+PLTVYFPIEMHIAQ KIPKYSFRW+ LKILSW
Sbjct  394  YVIVTAVLAMIFPFFNDFLGLIGAGSFWPLTVYFPIEMHIAQAKIPKYSFRWVCLKILSW  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++SL+AAAGS++GL   +KTYKPF+ +
Sbjct  454  VCLIISLIAAAGSVEGLIQSLKTYKPFQTR  483



>emb|CAD92450.1| amino acid permease 6 [Brassica napus]
Length=481

 Score =   353 bits (905),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 162/209 (78%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  271  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY++NVPC G   I+ FRLVWRT 
Sbjct  331  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKMNVPCGGDFGISLFRLVWRTS  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ  + K+SF W WLKILSW
Sbjct  391  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKNMKKFSFTWTWLKILSW  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C +VSLVAAAGS+QGL   +K +KPF+A
Sbjct  451  ACFLVSLVAAAGSVQGLIQSLKDFKPFQA  479



>gb|KJB64022.1| hypothetical protein B456_010G029800 [Gossypium raimondii]
Length=514

 Score =   353 bits (906),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 165/210 (79%), Positives = 188/210 (90%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+ASGVGVTTTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  302  PPENKSMKRASGVGVTTTTLFYVLCGIVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QPLF FVES C++ +PD+KFIT E+ ++VP  G   +NFFRLVWRT 
Sbjct  362  IAVHLIGAYQVFAQPLFGFVESLCARHYPDNKFITREHAMDVPFCGVYYLNFFRLVWRTA  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMIFPFFNDFLGLIGA SF+PLTVYFPIEMHIAQ KIPKYSFRW+ LKILSW
Sbjct  422  YVIVTAVLAMIFPFFNDFLGLIGAGSFWPLTVYFPIEMHIAQAKIPKYSFRWVCLKILSW  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++SL+AAAGS++GL   +KTYKPF+ +
Sbjct  482  VCLIISLIAAAGSVEGLIQSLKTYKPFQTR  511



>ref|XP_008466098.1| PREDICTED: amino acid permease 6-like [Cucumis melo]
Length=310

 Score =   345 bits (885),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 157/209 (75%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKAS VG+TTT+LFY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  102  PAENKAMKKASFVGITTTSLFYILCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  161

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP + FVE  C+++WP+S FIT E+ +N+P  G   +N+FRL+WRT 
Sbjct  162  IVVHLVGAYQVFCQPFYGFVEKWCNKKWPESTFITTEHVINLPFNGEYQLNYFRLIWRTV  221

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAVVAMIFPFFNDFLGLIGAASF+PLTVYFP+EM+IA+TK+P++S  WIWLK LSW
Sbjct  222  YVILTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPVEMYIARTKLPRFSSTWIWLKTLSW  281

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CLV+SL+AAAGSIQGL  DVKTYKPFK+
Sbjct  282  ACLVISLIAAAGSIQGLAQDVKTYKPFKS  310



>gb|EYU36417.1| hypothetical protein MIMGU_mgv1a005426mg [Erythranthe guttata]
Length=484

 Score =   350 bits (899),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 184/210 (88%), Gaps = 2/210 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVMKKAS VGV+TTT+FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  274  PSESKVMKKASLVGVSTTTVFYVLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFG--TCSINFFRLVWR  376
            IA+HL+GAYQVF QP+F FVE RC+++WP S+FIT E+ +N+P       +INFFRL WR
Sbjct  334  IAVHLVGAYQVFAQPIFGFVEKRCTEKWPGSRFITGEHSINLPLIDKPAFTINFFRLAWR  393

Query  375  TGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKIL  196
            T YVI+T+++AMIFPFFN FLGLIGAASFYPLTVYFPIEMHIAQ KI KYSF W WLKIL
Sbjct  394  TAYVILTSLIAMIFPFFNGFLGLIGAASFYPLTVYFPIEMHIAQAKIRKYSFTWTWLKIL  453

Query  195  SWTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            SW CLVVSL+AAAGSIQGL  DVK YKPFK
Sbjct  454  SWACLVVSLIAAAGSIQGLAYDVKKYKPFK  483



>gb|ADB92670.1| amino acid permease 6 [Populus tremula x Populus alba]
Length=483

 Score =   349 bits (896),  Expect = 9e-115, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS VG+ TTT FY+LCGCLGYAAFGN+APGNFLTGFGFYEPFWLID AN C
Sbjct  273  PPENKAMKRASFVGILTTTTFYILCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDLANAC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+FSFVESRC +RWPDSKF+T E+ +N+P +G   +N FRLVWRT 
Sbjct  333  IAIHLIGAYQVFCQPIFSFVESRCHRRWPDSKFMTREHAINIPFYGVYYLNLFRLVWRTL  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMI PFFNDFL L+GA SF+PLTVYFPIEM++A++K+PK+SFRW  LK+LSW
Sbjct  393  YVIVTAVLAMILPFFNDFLALLGAISFWPLTVYFPIEMYMARSKMPKFSFRWTSLKMLSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL VSLV+AAGS++GL   +KTYKPFKAQ
Sbjct  453  ACLAVSLVSAAGSVEGLIQALKTYKPFKAQ  482



>ref|XP_011017028.1| PREDICTED: amino acid permease 6-like [Populus euphratica]
Length=483

 Score =   349 bits (896),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS VG+ TTT FY+LCGCLGYAAFGN+APGNFLTGFGFYEPF LID ANVC
Sbjct  273  PPENKAMKRASFVGILTTTTFYILCGCLGYAAFGNDAPGNFLTGFGFYEPFVLIDLANVC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+FSFVESRC +RWPDSKFIT+E+ +N+P +G   +N FRLVWRT 
Sbjct  333  IAIHLIGAYQVFCQPIFSFVESRCHRRWPDSKFITSEHTINIPFYGVYYLNLFRLVWRTL  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMI PFFNDFL L+GA SF+PLTVYFP+EM++A+TK+PK+S+RW  LK+LSW
Sbjct  393  YVIVTAVLAMILPFFNDFLALLGAISFWPLTVYFPVEMYMARTKVPKFSYRWTSLKMLSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL VSLV+AAGS+QGL   +KTYKPFKAQ
Sbjct  453  ACLAVSLVSAAGSVQGLIQALKTYKPFKAQ  482



>ref|XP_008368120.1| PREDICTED: amino acid permease 6-like [Malus domestica]
Length=226

 Score =   340 bits (871),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+A+ +G+ TTTLFYVLCGC+GYAAFGN APGNFLTGFGFYEPFWL+D AN+C
Sbjct  16   PAENKAMKRATSIGIATTTLFYVLCGCVGYAAFGNXAPGNFLTGFGFYEPFWLVDIANIC  75

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLI AYQVFCQP+F FVES+C++RWPDS FI +EY +N+P  G   +N FRLVWRT 
Sbjct  76   IAIHLIXAYQVFCQPIFGFVESKCAKRWPDSNFINSEYPINIPFCGQLCVNSFRLVWRTA  135

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AM+FPFFNDFLGL+GAASF+PLTVYFPIEM++A+TKIPK++F W W+KILSW
Sbjct  136  YVVMTAILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYMARTKIPKFTFTWTWMKILSW  195

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SLVAAA SIQGL  DVK YKPF  +
Sbjct  196  VCLVISLVAAAASIQGLATDVKKYKPFHTE  225



>gb|KGN60300.1| hypothetical protein Csa_3G894480 [Cucumis sativus]
Length=222

 Score =   339 bits (869),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKAS VG+TTT+LFY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  14   PAENKAMKKASFVGITTTSLFYILCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  73

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGAYQVFCQP + FVE  C+++WP+S FIT E+ +N+P  G   +N+FRL+WRT 
Sbjct  74   IVVHLIGAYQVFCQPFYGFVEKWCNKKWPESTFITTEHTINLPFNGEYQLNYFRLIWRTI  133

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAVVAMIFPFFNDFLGLIGAASF+PLTVYFP+EM+IA+TK+P++S  WIWLK LSW
Sbjct  134  YVILTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPVEMYIARTKLPRFSSTWIWLKTLSW  193

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CLV+SL+AA GS+QGL  DVKTY+PFK+
Sbjct  194  ACLVISLIAAVGSLQGLAQDVKTYRPFKS  222



>ref|XP_002301129.2| amino acid transport protein AAP2 [Populus trichocarpa]
 gb|EEE80402.2| amino acid transport protein AAP2 [Populus trichocarpa]
Length=487

 Score =   348 bits (893),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS VG+ TTT FY+LCGCLGYAAFGN+APGNFLTGFGFYEPF LID ANVC
Sbjct  277  PPENKAMKRASFVGILTTTTFYILCGCLGYAAFGNDAPGNFLTGFGFYEPFVLIDIANVC  336

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+FSFVESRC +RWPDSKFIT+E+ +N+P +G   +N FRLVWRT 
Sbjct  337  IAIHLIGAYQVFCQPIFSFVESRCHRRWPDSKFITSEHAINIPFYGVYYLNLFRLVWRTL  396

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMI PFFNDFL L+GA SF+PLTVYFP+EM++A+TK+PK+SFRW  LK+LSW
Sbjct  397  YVIVTAVLAMILPFFNDFLALLGAISFWPLTVYFPVEMYMARTKMPKFSFRWTSLKMLSW  456

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL VSLV+AAGS++GL   +KTYKPFKAQ
Sbjct  457  ACLAVSLVSAAGSVEGLIQALKTYKPFKAQ  486



>ref|XP_010553668.1| PREDICTED: amino acid permease 1-like [Tarenaya hassleriana]
Length=488

 Score =   348 bits (892),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTTLFYVLCGC+GYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  277  PAENKAMKRASLVGVSTTTLFYVLCGCVGYAAFGNEAPGDFLTDFGFYEPFWLIDFANAC  336

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVFCQP+FSFVE +C ++WP+SKFITAE+ +NVP  G   INFFRLVWRT 
Sbjct  337  IAFHLIGAYQVFCQPIFSFVEKKCGRKWPESKFITAEHGLNVPLLGKFHINFFRLVWRTA  396

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVT ++AMIFPFFN  LGLIGAASF+PLTVYFPIEMHIAQ+KI K+SFRW WLKIL+W
Sbjct  397  YVIVTTILAMIFPFFNAILGLIGAASFWPLTVYFPIEMHIAQSKIKKFSFRWTWLKILNW  456

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             C VVS+VAA GSIQGL   V+TYKPF+
Sbjct  457  LCFVVSIVAAVGSIQGLIQSVRTYKPFR  484



>ref|XP_004299846.1| PREDICTED: amino acid permease 6-like [Fragaria vesca subsp. 
vesca]
Length=482

 Score =   347 bits (889),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKA+ +G++TTT+FYVLCG +GYAAFGN+APGNFLTGFGFYEPFWL+D AN+C
Sbjct  272  PAENKSMKKATSIGISTTTVFYVLCGTVGYAAFGNDAPGNFLTGFGFYEPFWLVDIANIC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP++ FVES+C++RWP+SKFI  EY VN+PC G    N FRLVWRT 
Sbjct  332  IAIHLIGAYQVFCQPVYGFVESKCAKRWPESKFINREYAVNIPCCGAYYFNSFRLVWRTA  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AM+FPFFNDFLGL+GAASF+PLTVYFPIEM+IA+TK+PK+SF W W+KILSW
Sbjct  392  YVVMTAILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYIARTKMPKFSFTWTWMKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SLVAAA SIQGL  DVK YKPF+ +
Sbjct  452  ICLVISLVAAAASIQGLATDVKKYKPFQTE  481



>ref|XP_009357221.1| PREDICTED: amino acid permease 6-like [Pyrus x bretschneideri]
Length=483

 Score =   345 bits (885),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 155/210 (74%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+A+ VG+ TTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWL+D AN+C
Sbjct  273  PAENKAMKRATSVGIATTTLFYVLCGSVGYAAFGNDAPGNFLTGFGFYEPFWLVDIANIC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F FVES+C++RWPDSKFI +EY +N+P  G   +N FRLVWRT 
Sbjct  333  IAIHLIGAYQVFCQPIFGFVESKCAKRWPDSKFINSEYPINIPFCGQFCVNSFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AM+FPFFNDFL L+GAASF+PLTVYFPIEM++A+TKIPK+SF W W+KILSW
Sbjct  393  YVVMTAILAMLFPFFNDFLALLGAASFWPLTVYFPIEMYMARTKIPKFSFTWTWMKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SLVAAA SIQGL  DVK YKPF  +
Sbjct  453  VCLVISLVAAAASIQGLTTDVKKYKPFHTE  482



>gb|KDP41551.1| hypothetical protein JCGZ_15958 [Jatropha curcas]
Length=484

 Score =   344 bits (883),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS +G+ TTTLFYVLCGCLGYAAFGN+APGNFLTGFGFYEPFWLID ANVC
Sbjct  274  PPENKAMKRASFIGILTTTLFYVLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDLANVC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+FSFVE  C QRW ++KFIT+E+ +N+P +G   +N FRLVWRT 
Sbjct  334  IAIHLIGAYQVFCQPIFSFVERYCHQRWSENKFITSEHAINIPYYGVYYLNSFRLVWRTI  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMI PFFNDFLGLIGAA+F+PLTVYFPIEM+IA+T++PK+S  W WLKILS 
Sbjct  394  YVIVTAVLAMILPFFNDFLGLIGAAAFWPLTVYFPIEMYIARTRMPKFSVTWTWLKILSL  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VSLVAAAGSI+GL   +KTYKPF+++
Sbjct  454  ACLIVSLVAAAGSIEGLINSLKTYKPFQSE  483



>ref|XP_008219153.1| PREDICTED: amino acid permease 6-like [Prunus mume]
Length=483

 Score =   344 bits (883),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+A+ +G+ TTT+FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWL+D AN+C
Sbjct  273  PAENKAMKRATSIGIATTTVFYVLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLVDLANIC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F FVES+C++RWP+SKFI +E+ VN+P  G    N FRLVWRT 
Sbjct  333  IAIHLIGAYQVFCQPIFGFVESQCAKRWPESKFINSEHAVNLPFHGAYCFNSFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TAV+AM+FPFFNDFLGL+GAASF+PLTVYFPIEM+IA+TK+P++SF W W+KILSW
Sbjct  393  YVVMTAVLAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYIARTKMPRFSFTWTWMKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SLV+AA +IQGL  DVK YKPF+ +
Sbjct  453  ACLVISLVSAAAAIQGLATDVKKYKPFQTE  482



>emb|CDY46779.1| BnaCnng14480D [Brassica napus]
Length=479

 Score =   343 bits (881),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/197 (80%), Positives = 178/197 (90%), Gaps = 0/197 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  265  PSENKAMKRASLVGVSTTTFFYMLCGCVGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  324

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVES+ ++RWPD+KFIT EY++NVPC G   I+ FRLVWRT 
Sbjct  325  IAVHLVGAYQVFCQPIFQFVESQSAKRWPDNKFITGEYKMNVPCGGDFGISLFRLVWRTS  384

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTAVVAMIFPFFNDFLGLIGAASF+PLTVYFPIEMHIAQ K+ K+SF W WLKILSW
Sbjct  385  YVVVTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPIEMHIAQKKMKKFSFTWTWLKILSW  444

Query  189  TCLVVSLVAAAGSIQGL  139
             C +VSLVAAAGS+QGL
Sbjct  445  ACFLVSLVAAAGSVQGL  461



>ref|XP_010061591.1| PREDICTED: amino acid permease 6-like [Eucalyptus grandis]
 gb|KCW68572.1| hypothetical protein EUGRSUZ_F02185 [Eucalyptus grandis]
 gb|KCW68573.1| hypothetical protein EUGRSUZ_F02185 [Eucalyptus grandis]
Length=486

 Score =   343 bits (881),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 159/210 (76%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G++TTT+FY LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  277  PPENKVMKRASLIGISTTTMFYALCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  336

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVES CS+RWP++  I  E  V+VP +G   IN FRL+WRT 
Sbjct  337  IAVHLIGAYQVFSQPIFGFVESWCSKRWPNNTLIMREIPVDVPWYGIYHINLFRLIWRTV  396

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMI PFFNDFLGLIGAASF+PLTVYFP+EM+IA+T + K+SF W WLKILSW
Sbjct  397  YVIVTAVIAMILPFFNDFLGLIGAASFWPLTVYFPVEMYIARTNMRKFSFTWAWLKILSW  456

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVSLVAAAGS+QGL   +KTYKPFK Q
Sbjct  457  ACLVVSLVAAAGSVQGLIQSLKTYKPFKTQ  486



>ref|XP_007222665.1| hypothetical protein PRUPE_ppa004980mg [Prunus persica]
 gb|EMJ23864.1| hypothetical protein PRUPE_ppa004980mg [Prunus persica]
Length=483

 Score =   343 bits (880),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+A+ +G+ TTT+FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWL+D AN+C
Sbjct  273  PAENKAMKRATSIGIATTTVFYVLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLVDLANIC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F FVES+C++RWP+SKFI +E+ VN+P  G    N FRLVWRT 
Sbjct  333  IAIHLIGAYQVFCQPIFGFVESQCAKRWPESKFINSEHAVNLPFHGAYCFNSFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AM+FPFFNDFLGL+GAASF+PLTVYFPIEM+IA+TK+P++SF W W+KILSW
Sbjct  393  YVVMTAILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYIARTKMPRFSFTWAWMKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SLV+AA +IQGL  DVK YKPF+ +
Sbjct  453  ACLVISLVSAAAAIQGLATDVKKYKPFQTE  482



>ref|XP_003588450.1| Amino acid transporter [Medicago truncatula]
 gb|AES58701.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=472

 Score =   343 bits (879),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 150/210 (71%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMK+AS +G+ TTTLFYVLCG LGYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  262  PPENRVMKRASLIGILTTTLFYVLCGTLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  321

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVE +  Q+WPDSKF+  E+ +N+P +G+ ++N+FR++WR+ 
Sbjct  322  IAVHLIGAYQVFVQPIFGFVEGQSKQKWPDSKFVNGEHAMNIPLYGSYNVNYFRVIWRSC  381

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TA++AM+FPFFNDFLGLIG+ SFYPLTVYFPIEM+I +T +PKYSF W WLKILSW
Sbjct  382  YVIITAIIAMLFPFFNDFLGLIGSLSFYPLTVYFPIEMYIKKTNMPKYSFTWTWLKILSW  441

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+S+++AAGSIQGL   +KTYKPF+ +
Sbjct  442  LCLVISIISAAGSIQGLATSLKTYKPFRGE  471



>ref|XP_004136237.1| PREDICTED: amino acid permease 6-like [Cucumis sativus]
 ref|XP_004168126.1| PREDICTED: amino acid permease 6-like [Cucumis sativus]
Length=477

 Score =   342 bits (878),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 155/209 (74%), Positives = 185/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKAS VG+TTT+LFY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  269  PAENKAMKKASFVGITTTSLFYILCGCVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  328

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGAYQVFCQP + FVE  C+++WP+S FIT E+ +N+P  G   +N+FRL+WRT 
Sbjct  329  IVVHLIGAYQVFCQPFYGFVEKWCNKKWPESTFITTEHTINLPFNGEYQLNYFRLIWRTI  388

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAVVAMIFPFFNDFLGLIGAASF+PLTVYFP+EM+IA+TK+P++S  WIWLK LSW
Sbjct  389  YVILTAVVAMIFPFFNDFLGLIGAASFWPLTVYFPVEMYIARTKLPRFSSTWIWLKTLSW  448

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CLV+SL+AA GS+QGL  DVKTY+PFK+
Sbjct  449  ACLVISLIAAVGSLQGLAQDVKTYRPFKS  477



>ref|XP_010269102.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=465

 Score =   342 bits (876),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 181/207 (87%), Gaps = 0/207 (0%)
 Frame = -1

Query  726  PENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCI  547
            PEN+VMKKAS +GV TT LFYVLCGC+GYAAFGN APGNFLTGFG YEPFWLIDFANVCI
Sbjct  257  PENQVMKKASFIGVLTTALFYVLCGCVGYAAFGNKAPGNFLTGFGLYEPFWLIDFANVCI  316

Query  546  AIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGY  367
             IHLIGAYQVFCQPLF+FVE  CS+RW D+ FIT E+ V +P +G  SINFFRLVWRT Y
Sbjct  317  VIHLIGAYQVFCQPLFAFVEKWCSKRWRDNGFITKEHAVTIPLYGAYSINFFRLVWRTVY  376

Query  366  VIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWT  187
            VI+TAV+AM FPFFNDFLGLIGA S++PL+VYFPIEM+I+Q++IP++SF WIWLKIL W 
Sbjct  377  VILTAVIAMTFPFFNDFLGLIGAVSYWPLSVYFPIEMYISQSRIPRFSFTWIWLKILCWV  436

Query  186  CLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            CLVVS++A  GS+QGL  DVKTYKPFK
Sbjct  437  CLVVSIIAEVGSVQGLAKDVKTYKPFK  463



>gb|KHN37208.1| Amino acid permease 6 [Glycine soja]
Length=469

 Score =   342 bits (876),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G+ TTTLFYVLCGCLGYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  259  PPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVE+   +RWP+S F+  E+ +  P FGT  +NFFR+VWRT 
Sbjct  319  IAVHLVGAYQVFCQPIFGFVENWGKERWPNSHFVNGEHALKFPLFGTFPVNFFRVVWRTT  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ K+SF W WLKILSW
Sbjct  379  YVIITALIAMMFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQKFSFTWTWLKILSW  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++AAGSIQGL  D+K Y+PFKAQ
Sbjct  439  ACLIVSIISAAGSIQGLAQDLKKYQPFKAQ  468



>ref|XP_003526513.1| PREDICTED: amino acid permease 6-like [Glycine max]
Length=479

 Score =   342 bits (876),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G+ TTTLFYVLCGCLGYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  269  PPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  328

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVE+   +RWP+S F+  E+ +  P FGT  +NFFR+VWRT 
Sbjct  329  IAVHLVGAYQVFCQPIFGFVENWGKERWPNSHFVNGEHALKFPLFGTFPVNFFRVVWRTT  388

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ K+SF W WLKILSW
Sbjct  389  YVIITALIAMMFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQKFSFTWTWLKILSW  448

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++AAGSIQGL  D+K Y+PFKAQ
Sbjct  449  ACLIVSIISAAGSIQGLAQDLKKYQPFKAQ  478



>ref|XP_002285557.1| PREDICTED: amino acid permease 6 [Vitis vinifera]
 emb|CBI19332.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   341 bits (875),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 157/210 (75%), Positives = 187/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKA+  G++TT+LFYVLCGC+GYAAFGN+APGNFLTGFGF+EPFWLID ANV 
Sbjct  273  PPENKVMKKATFAGISTTSLFYVLCGCVGYAAFGNDAPGNFLTGFGFFEPFWLIDLANVF  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F FVE  C++RWP+SKFIT E+ ++VP +G   +N FRLVWRT 
Sbjct  333  IAIHLIGAYQVFCQPVFGFVEKWCNKRWPESKFITTEHCIDVPLYGIYYLNLFRLVWRTV  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AM+FPFFN+ +G +GAASF+PLTVYFPIEMHIA+TKIPK+SF W WLKILSW
Sbjct  393  YVIVTAVLAMLFPFFNEVMGFLGAASFWPLTVYFPIEMHIARTKIPKFSFTWTWLKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            TCL+VS+VAAAGSIQGL  +++ YKPF+ Q
Sbjct  453  TCLMVSVVAAAGSIQGLIKEIEKYKPFQTQ  482



>ref|XP_010320244.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Solanum 
lycopersicum]
Length=469

 Score =   340 bits (872),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPE+KVMK+AS  GV+TTTLFYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  271  PPESKVMKRASLAGVSTTTLFYVLCGTIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQPL+ FVE+RCS+RWPDSKFIT+EY + VPC GT ++N FRLVWRT 
Sbjct  331  IAVHLIGAYQVFCQPLYGFVEARCSERWPDSKFITSEYAMQVPCCGTYNLNLFRLVWRTT  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQ KIPKYSF W+WLKILSW
Sbjct  391  YVIVTAVIAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQRKIPKYSFTWVWLKILSW  450

Query  189  TCLV  178
            TCL+
Sbjct  451  TCLI  454



>ref|XP_009335480.1| PREDICTED: amino acid permease 6-like [Pyrus x bretschneideri]
Length=483

 Score =   340 bits (873),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 183/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+A+ +G+ TTT+FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWL+D AN+C
Sbjct  273  PAENKAMKRATSIGIATTTVFYVLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLVDVANIC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F FVES C+QRWP+S+FI  EY +N+P  G   +N FRLVWRT 
Sbjct  333  IAIHLIGAYQVFCQPIFGFVESSCAQRWPESEFINGEYPINIPFCGQFCVNSFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AM+FPFFNDFLGL+GAASF+PLTVYFPIEM+IA+TK+ K++F W W+KILSW
Sbjct  393  YVVMTAILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYIARTKMAKFTFTWTWMKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SL+AAA SIQGL  DVK YKPF  +
Sbjct  453  VCLVISLIAAAASIQGLATDVKKYKPFHTE  482



>gb|KHN08198.1| Amino acid permease 6 [Glycine soja]
Length=479

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G+ TTTLFYVLCGCLGYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  269  PPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  328

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVE+   +RWP+S+F+  E+ +N P  GT  +NFFR+VWRT 
Sbjct  329  IAVHLVGAYQVFCQPIFGFVENWGKERWPNSQFVNGEHALNFPLCGTFPVNFFRVVWRTT  388

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ ++SF W WLKILSW
Sbjct  389  YVIITALIAMMFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQRFSFTWTWLKILSW  448

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++AAGSIQGL  D+K Y+PFKAQ
Sbjct  449  ACLIVSIISAAGSIQGLAQDLKKYQPFKAQ  478



>ref|NP_001242816.1| uncharacterized protein LOC100777963 [Glycine max]
 gb|ACU21356.1| unknown [Glycine max]
Length=479

 Score =   340 bits (872),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 186/210 (89%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G+ TTTLFYVLCGCLGYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  269  PPENKVMKRASLIGILTTTLFYVLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  328

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVE+   +RWP+S+F+  E+ +N P  GT  +NFFR+VWRT 
Sbjct  329  IAVHLVGAYQVFCQPIFGFVENWGRERWPNSQFVNGEHALNFPLCGTFPVNFFRVVWRTT  388

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ ++SF W WLKILSW
Sbjct  389  YVIITALIAMMFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQRFSFTWTWLKILSW  448

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++AAGSIQGL  D+K Y+PFKAQ
Sbjct  449  ACLIVSIISAAGSIQGLAQDLKKYQPFKAQ  478



>ref|XP_002510013.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF52200.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   340 bits (873),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 156/210 (74%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MKKAS VG+ TTT+FY+LCGC+GYAAFGN+APGNFLTGFGFYEPFWLID ANVC
Sbjct  274  PPENKAMKKASFVGIVTTTMFYILCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDIANVC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+FSF+E    QRWP++KFIT EY +N+P  G   ++ FRLVWRT 
Sbjct  334  IAIHLIGAYQVFCQPIFSFMEKNSRQRWPENKFITTEYAINIPFLGVYYLSTFRLVWRTL  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTA+VAMI PFFNDFLGLIGAA+F+PLTVYFPIEM+I +T+IPK+S  WIWLKIL+ 
Sbjct  394  YVIVTAIVAMILPFFNDFLGLIGAAAFWPLTVYFPIEMYITRTRIPKFSSTWIWLKILTL  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVSL+AAAGS++GL   +KTYKPF+++
Sbjct  454  ACLVVSLLAAAGSVEGLINSLKTYKPFQSE  483



>ref|XP_008339056.1| PREDICTED: amino acid permease 6 [Malus domestica]
Length=483

 Score =   340 bits (871),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+A+ +G+ TTTLFYVLCGC+GYAAFGN APGNFLTGFGFYEPFWL+D AN+C
Sbjct  273  PAENKAMKRATSIGIATTTLFYVLCGCVGYAAFGNXAPGNFLTGFGFYEPFWLVDIANIC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLI AYQVFCQP+F FVES C++RWPDS FI +EY +N+P  G   +N FRLVWRT 
Sbjct  333  IAIHLIXAYQVFCQPIFGFVESXCAKRWPDSXFINSEYPINIPFCGQLCVNSFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AM+FPFFNDFLGL+GAASF+PLTVYFPIEM++A+TK PK++F W W+KILSW
Sbjct  393  YVVMTAILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYMARTKXPKFTFTWTWMKILSW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SLVAAA SIQGL  DVK YKPF  +
Sbjct  453  VCLVISLVAAAASIQGLATDVKKYKPFHTE  482



>ref|XP_008378686.1| PREDICTED: amino acid permease 6-like [Malus domestica]
Length=205

 Score =   330 bits (845),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 149/204 (73%), Positives = 180/204 (88%), Gaps = 0/204 (0%)
 Frame = -1

Query  711  MKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCIAIHLI  532
            MK+A+ +G+ TTT+FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWL+D AN+CIAIHLI
Sbjct  1    MKRATSIGIATTTVFYVLCGCVGYAAFGNDAPGNFLTGFGFYEPFWLVDVANICIAIHLI  60

Query  531  GAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGYVIVTA  352
            GAYQVFCQP+F FVES C+QRWP+S+FI  EY +N+P  G   +N FRLVWRT YV++TA
Sbjct  61   GAYQVFCQPIFGFVESSCAQRWPESEFINGEYPINIPFCGQFCVNSFRLVWRTAYVVMTA  120

Query  351  VVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWTCLVVS  172
            ++AM+FPFFNDFLGL+GAASF+PLTVYFPIEM+IA+TK+PK++F W W+KILSW CLV+S
Sbjct  121  ILAMLFPFFNDFLGLLGAASFWPLTVYFPIEMYIARTKMPKFTFTWTWMKILSWVCLVIS  180

Query  171  LVAAAGSIQGLXXDVKTYKPFKAQ  100
            LVAAA SIQGL  DVK YKPF  +
Sbjct  181  LVAAAASIQGLATDVKKYKPFHTE  204



>gb|AFK46687.1| unknown [Lotus japonicus]
Length=283

 Score =   332 bits (852),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G+ TTT+FY+LCG LGYAAFGN+APGNFLTGFGFYEPFWL+DFAN+C
Sbjct  73   PPENKVMKRASLIGILTTTMFYMLCGILGYAAFGNDAPGNFLTGFGFYEPFWLMDFANIC  132

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F FVE     +W +S+FI  E+ +N+P  GT  +NFFR+VWRT 
Sbjct  133  IAIHLIGAYQVFCQPIFGFVEKWSQGKWTNSQFINGEHALNIPFCGTFYVNFFRVVWRTT  192

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ KYSF W WLKILSW
Sbjct  193  YVIITALIAMVFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMKKYSFTWTWLKILSW  252

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS++AAAGSIQGL   +K Y+PFKAQ
Sbjct  253  ACLIVSIIAAAGSIQGLSQSLKKYQPFKAQ  282



>ref|XP_007137276.1| hypothetical protein PHAVU_009G113800g [Phaseolus vulgaris]
 gb|ESW09270.1| hypothetical protein PHAVU_009G113800g [Phaseolus vulgaris]
Length=482

 Score =   339 bits (869),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 151/210 (72%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENKVMK+AS +G+ TTTLFY+LCGCLGYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  272  PAENKVMKRASLIGIMTTTLFYMLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP+F FVE+   +RWP+S+F+  E+ VN P  GT S+NFFR+VWRT 
Sbjct  332  IAVHLVGAYQVFCQPIFGFVENWSKERWPNSQFVNGEHAVNFPLCGTFSVNFFRVVWRTT  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+ + K+SF W WLKILSW
Sbjct  392  YVVITALIAMLFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSNMQKFSFTWTWLKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++AAGSIQGL  D+K Y+PFKAQ
Sbjct  452  VCLIVSIISAAGSIQGLAQDLKKYQPFKAQ  481



>emb|CDY53793.1| BnaCnng25620D [Brassica napus]
Length=479

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  268  PAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  327

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE +C++ WPD+KFIT+EY VN+P  G  SIN FRLVWRT 
Sbjct  328  IAFHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNIPFLGKFSINLFRLVWRTA  387

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T +VAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W
Sbjct  388  YVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSSRWIGLKMLCW  447

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  448  VCLIVSLLAAAGSIAGLISSVKTYKPFR  475



>ref|XP_003603665.1| Amino acid permease [Medicago truncatula]
 gb|AES73916.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=482

 Score =   338 bits (868),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMK+AS +G+ TTT+FY+LCGCLGYAAFGN+APGNFLTGFGFYEPFWLID AN+ 
Sbjct  272  PPENQVMKRASLIGILTTTMFYMLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDLANIF  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVES+  ++W +S+F+  E+ VN+P  GT  +NFFR+VWRT 
Sbjct  332  IAVHLIGAYQVFCQPIFGFVESKSKEKWSNSQFVNGEHAVNIPLCGTLHVNFFRVVWRTA  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AMIFPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ ++SF W W+KILSW
Sbjct  392  YVVITALIAMIFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQRFSFTWTWMKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++AAGSIQGL  D+K Y+PFKAQ
Sbjct  452  ACLIVSIISAAGSIQGLAHDLKKYQPFKAQ  481



>ref|XP_004498452.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=471

 Score =   338 bits (867),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMK+AS +G+ TTTLFYVLCG LGYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  261  PPENRVMKRASLIGILTTTLFYVLCGTLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  320

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVE +  Q+WPDSKF+  E+ +N+P +G+ ++NFFR++WR+ 
Sbjct  321  IAVHLIGAYQVFVQPIFGFVEGQSKQKWPDSKFVNGEHPMNLPLYGSYNVNFFRVIWRSS  380

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I +TK+ K+SF W WLKILSW
Sbjct  381  YVIITAIIAMLFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKKTKMQKFSFTWTWLKILSW  440

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+S+++AAGSIQGL   +K Y+PFK +
Sbjct  441  ACLVISIISAAGSIQGLAQSLKKYQPFKGE  470



>emb|CAD92449.1| amino acid permease 1 [Brassica napus]
Length=485

 Score =   338 bits (868),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  274  PAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTNFGFYEPFWLIDFANAC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE +C++ WPD+KFIT+EY VN+P  G  SIN FRLVWRT 
Sbjct  334  IAFHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNIPFLGKFSINLFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T +VAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W
Sbjct  394  YVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSSRWIGLKMLCW  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  454  VCLIVSLLAAAGSIAGLISSVKTYKPFR  481



>gb|AFK42490.1| unknown [Medicago truncatula]
Length=482

 Score =   338 bits (866),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMK+AS +G+ TTT+FY+LCGCLGYAAFGN+APGNFLTGFGFYEPFWLID AN+ 
Sbjct  272  PPENQVMKRASLIGILTTTMFYMLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDLANIF  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVES+  ++W +S+F+  E+ VN+P  GT  +NFFR VWRT 
Sbjct  332  IAVHLIGAYQVFCQPIFGFVESKSKEKWSNSQFVNGEHAVNIPLCGTLHVNFFRAVWRTA  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA++AMIFPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ ++SF W W+KILSW
Sbjct  392  YVVITALIAMIFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQRFSFTWTWMKILSW  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++AAGSIQGL  D+K Y+PFKAQ
Sbjct  452  ACLIVSIISAAGSIQGLAHDLKKYQPFKAQ  481



>ref|XP_009102845.1| PREDICTED: amino acid permease 1 [Brassica rapa]
Length=484

 Score =   336 bits (861),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  273  PAENKSMKRASLVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE RC++ WPD+KFIT+EY VNVP  G  +I+ FRLVWRT 
Sbjct  333  IAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITSEYSVNVPFLGKFNISLFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W
Sbjct  393  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKMLCW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  453  VCLIVSLLAAAGSIAGLISSVKTYKPFR  480



>emb|CDY48843.1| BnaA09g14700D [Brassica napus]
Length=479

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  268  PAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  327

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE +C++ WPD+KFIT+EY VN+P  G  +IN FRLVWRT 
Sbjct  328  IAFHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNIPFLGKFNINLFRLVWRTA  387

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T +VAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W
Sbjct  388  YVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKMLCW  447

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  448  VCLIVSLLAAAGSIAGLISSVKTYKPFR  475



>ref|XP_010064702.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Eucalyptus 
grandis]
Length=485

 Score =   336 bits (861),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G++TTT+FY LCGC+GYAAFGN+AP +FLTGFGFYEPFW+IDFAN C
Sbjct  266  PPENKVMKRASLIGISTTTMFYALCGCIGYAAFGNDAPXDFLTGFGFYEPFWVIDFANAC  325

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVES CS+RWP++ FIT E  V+VP +G   IN FRL+WRT 
Sbjct  326  IAVHLIGAYQVFSQPIFGFVESWCSKRWPNNTFITREIPVDVPWYGIYHINLFRLIWRTV  385

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMI PFFNDFLGLIGAASF+PLTVYFP+EM+IA+T + K+SF W WLKIL+W
Sbjct  386  YVIVTAVIAMILPFFNDFLGLIGAASFWPLTVYFPVEMYIARTNMRKFSFTWAWLKILNW  445

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLVVSLVAAAGS+QGL   +KTYKPFK
Sbjct  446  ACLVVSLVAAAGSVQGLIQSLKTYKPFK  473



>gb|KJB59872.1| hypothetical protein B456_009G278100 [Gossypium raimondii]
Length=477

 Score =   335 bits (859),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 182/209 (87%), Gaps = 0/209 (0%)
 Frame = -1

Query  726  PENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCI  547
            PENK MK+A+ +GV+TTT+FYVLCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+CI
Sbjct  268  PENKSMKRATAIGVSTTTIFYVLCGLVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANICI  327

Query  546  AIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGY  367
            AIHL+GAYQVF QPLF FVE  CS+RWP ++FIT+E  V VP +G   IN FRLVWRT Y
Sbjct  328  AIHLLGAYQVFAQPLFGFVEGWCSRRWPGNRFITSEQAVRVPFYGVYYINLFRLVWRTTY  387

Query  366  VIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWT  187
            VIVTA+VAM+FPFFN+FLGLIGA SF+PL VYFPIE+HIAQTK+ KYSF+W+WLKIL+W 
Sbjct  388  VIVTALVAMLFPFFNNFLGLIGAGSFWPLVVYFPIEIHIAQTKMAKYSFKWMWLKILTWA  447

Query  186  CLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            CL+VSL+AAA S+QGL   ++ YKPF+ Q
Sbjct  448  CLIVSLIAAAASVQGLIQSLQAYKPFQLQ  476



>ref|XP_006392303.1| hypothetical protein EUTSA_v10023431mg [Eutrema salsugineum]
 gb|ESQ29589.1| hypothetical protein EUTSA_v10023431mg [Eutrema salsugineum]
Length=484

 Score =   335 bits (860),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  273  PAENKAMKRASLVGVSTTTFFYILCGCLGYAAFGNQAPGDFLTDFGFYEPFWLIDFANAC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVE +C++ WPD+KFIT+EY VNVP  G  +I+ FRLVWRT 
Sbjct  333  IAVHLIGAYQVFAQPIFQFVEKKCNRNWPDNKFITSEYSVNVPFLGKFNISLFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T +VAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W
Sbjct  393  YVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKMLCW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLVVSL+A AGSI GL   VKTYKPF+
Sbjct  453  VCLVVSLLAGAGSIAGLISSVKTYKPFR  480



>emb|CDY44564.1| BnaA01g21750D [Brassica napus]
Length=507

 Score =   336 bits (861),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/208 (75%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  296  PAENKSMKRASLVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  355

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE RC++ WPD+KFIT+EY VNVP  G  +I+ FRLVWRT 
Sbjct  356  IAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITSEYSVNVPFLGKFNISLFRLVWRTA  415

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W
Sbjct  416  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKMLCW  475

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  476  VCLIVSLLAAAGSIAGLISSVKTYKPFR  503



>ref|XP_004501076.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=481

 Score =   335 bits (858),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMK+AS +G+ TTT+FY+LCGCLGYAAFGN+APGNFLTGFGFYEP+WLID AN+C
Sbjct  271  PPENQVMKRASLIGILTTTMFYMLCGCLGYAAFGNDAPGNFLTGFGFYEPYWLIDVANIC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVES+  ++W +S+F+  E+ V +P  GT  +NFFR+VWRT 
Sbjct  331  IAVHLIGAYQVFCQPIFGFVESKSKEKWSNSQFVNGEHAVTIPLCGTYYVNFFRVVWRTT  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTA++AM+FPFFNDFLGLIG+ SF+PLTVYFPIEM+I Q+K+ ++SF W WLKILSW
Sbjct  391  YVVVTALIAMLFPFFNDFLGLIGSLSFWPLTVYFPIEMYIKQSKMQRFSFTWTWLKILSW  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+VS+++A GSIQGL  D+K Y+PFKAQ
Sbjct  451  ACLIVSIISAVGSIQGLAHDLKKYQPFKAQ  480



>ref|XP_006302194.1| hypothetical protein CARUB_v10020203mg [Capsella rubella]
 gb|EOA35092.1| hypothetical protein CARUB_v10020203mg [Capsella rubella]
Length=486

 Score =   332 bits (852),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGNNAPG+FLT FGF+EP+WLIDFAN C
Sbjct  275  PAENKAMKRASLVGVSTTTFFYILCGCLGYAAFGNNAPGDFLTDFGFFEPYWLIDFANAC  334

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE +C + +PD+KFI AEY VNVP  G  +I+FFRLVWRT 
Sbjct  335  IAAHLIGAYQVFAQPIFQFVEKKCKKNYPDNKFINAEYSVNVPLLGKFNISFFRLVWRTA  394

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK++ +
Sbjct  395  YVVLTTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKMMCY  454

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  455  VCLIVSLLAAAGSIAGLISSVKTYKPFR  482



>gb|KHG12273.1| Amino acid permease 6 -like protein [Gossypium arboreum]
Length=452

 Score =   331 bits (849),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/209 (72%), Positives = 181/209 (87%), Gaps = 0/209 (0%)
 Frame = -1

Query  726  PENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCI  547
            PENK MK+A+ +GV+TTT+FY+LCG +GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+CI
Sbjct  243  PENKSMKRATAIGVSTTTIFYLLCGLVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANICI  302

Query  546  AIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGY  367
            AIHL+GAYQVF QPLF FVE  CS+RWP ++FIT+E  V VP +G   IN FRLVWRT Y
Sbjct  303  AIHLLGAYQVFAQPLFGFVEGWCSRRWPGNRFITSEQAVRVPFYGVYYINLFRLVWRTTY  362

Query  366  VIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWT  187
            VIVTA VAM+FPFFN+FLGLIGA SF+PL VYFPIE+HIAQTK+ K+SF+W+WLKIL+W 
Sbjct  363  VIVTAFVAMLFPFFNNFLGLIGAGSFWPLVVYFPIEIHIAQTKMAKFSFKWMWLKILTWA  422

Query  186  CLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            CL+VSL+AAA S+QGL   ++ YKPF+ Q
Sbjct  423  CLIVSLIAAAASVQGLIQSLQAYKPFQLQ  451



>gb|AAB87674.1| neutral amino acid transport system II [Arabidopsis thaliana]
Length=485

 Score =   332 bits (852),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGNNAPG+FLT FGF+EPFWLIDFAN C
Sbjct  274  PAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNNAPGDFLTDFGFFEPFWLIDFANAC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVE +C++ +PD+KFIT+EY VNVP  G  +I+ FRLVWRT 
Sbjct  334  IAVHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITSEYSVNVPFLGKFNISLFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK + +
Sbjct  394  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKTMCY  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  454  VCLIVSLLAAAGSIAGLISSVKTYKPFR  481



>ref|NP_176132.1| amino acid permease 1 [Arabidopsis thaliana]
 sp|Q42400.1|AAP1_ARATH RecName: Full=Amino acid permease 1; AltName: Full=Amino acid 
transporter AAP1; AltName: Full=Neutral amino acid transporter 
II [Arabidopsis thaliana]
 gb|AAF82252.1|AC008051_3 Identical to the amino acid permease I (AAP1) gb|X67124 and neutral 
amino acid transport system II (NAT2) gb|AF031649 from 
Arabidopsis thaliana and contains a transmembrane amino acid 
transporter protein PF|01490 domain. EST gb|AI995511, gb|Z18061 
comes from this gene [Arabidopsis thaliana]
 emb|CAA47603.1| amino acid permease I [Arabidopsis thaliana]
 gb|AAA32726.1| amino acid transporter [Arabidopsis thaliana]
 dbj|BAB83868.1| amino acid permease I [Arabidopsis thaliana]
 gb|AEE33541.1| amino acid permease 1 [Arabidopsis thaliana]
Length=485

 Score =   332 bits (852),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGNNAPG+FLT FGF+EPFWLIDFAN C
Sbjct  274  PAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNNAPGDFLTDFGFFEPFWLIDFANAC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVE +C++ +PD+KFIT+EY VNVP  G  +I+ FRLVWRT 
Sbjct  334  IAVHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITSEYSVNVPFLGKFNISLFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK + +
Sbjct  394  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKTMCY  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  454  VCLIVSLLAAAGSIAGLISSVKTYKPFR  481



>ref|XP_010268971.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=469

 Score =   332 bits (850),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 152/210 (72%), Positives = 182/210 (87%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +GV+TT +FY+LCGC+GYAAFGN+APGNFLTG GFYEPFWLIDFANVC
Sbjct  260  PPENKVMKRASFIGVSTTAMFYILCGCIGYAAFGNDAPGNFLTGLGFYEPFWLIDFANVC  319

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIG YQ+  Q LF++VE+ C   WPD+ FIT E+ VN+P  GT  INFFRLVWRT 
Sbjct  320  IAIHLIGVYQLLSQILFAYVENFCRNHWPDNGFITKEHPVNIPLHGTYHINFFRLVWRTV  379

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI TA+VAMIFPFFNDFLGLIGA S++PL+VYFPIE++IAQ++IP++SF W WLK+LS+
Sbjct  380  YVIATAIVAMIFPFFNDFLGLIGAFSYWPLSVYFPIEIYIAQSRIPRFSFTWTWLKMLSF  439

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVS+VAA GS+QGL  D+KTYKPFK +
Sbjct  440  ACLVVSIVAAVGSVQGLAADLKTYKPFKTR  469



>emb|CDY49542.1| BnaCnng17660D [Brassica napus]
Length=206

 Score =   322 bits (825),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 153/202 (76%), Positives = 173/202 (86%), Gaps = 0/202 (0%)
 Frame = -1

Query  711  MKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCIAIHLI  532
            MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN CIA HLI
Sbjct  1    MKRASLVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFWLIDFANACIAFHLI  60

Query  531  GAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGYVIVTA  352
            GAYQVF QP+F FVE RC++ WPD+KFIT+EY VNVP  G  +I+ FRLVWRT YV++T 
Sbjct  61   GAYQVFAQPIFQFVEKRCNRNWPDNKFITSEYSVNVPFLGKFNISLFRLVWRTAYVVITT  120

Query  351  VVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWTCLVVS  172
            VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W CL+VS
Sbjct  121  VVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKMLCWVCLIVS  180

Query  171  LVAAAGSIQGLXXDVKTYKPFK  106
            L+AAAGSI GL   VKTYKPF+
Sbjct  181  LLAAAGSIAGLISSVKTYKPFR  202



>emb|CDY60248.1| BnaC01g42990D [Brassica napus]
Length=507

 Score =   332 bits (852),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 156/208 (75%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  296  PAENKSMKRASLVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  355

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE RC++ WPD+KFIT+EY VNV   G  +I+ FRLVWRT 
Sbjct  356  IAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITSEYSVNVLFLGKFNISLFRLVWRTA  415

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK+L W
Sbjct  416  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKMLCW  475

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  476  VCLIVSLLAAAGSIAGLISSVKTYKPFR  503



>emb|CDY04349.1| BnaC04g18440D [Brassica napus]
Length=484

 Score =   331 bits (848),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS +GV+TTT FY+LCGC GYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  273  PAENKSMKRASLLGVSTTTFFYILCGCFGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE RC++ WPD+KFIT+EY VNVP  G  +I+ FRLVWRT 
Sbjct  333  IAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITSEYSVNVPFLGKFNISIFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EM+IAQTK+ KYS RWI LK+L W
Sbjct  393  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMNIAQTKVKKYSPRWIGLKVLCW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  453  VCLIVSLLAAAGSIAGLISSVKTYKPFR  480



>gb|KDO81360.1| hypothetical protein CISIN_1g011548mg [Citrus sinensis]
Length=314

 Score =   324 bits (831),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+A+ VGVTTTTLFY++CG +GY AFGN+APGNFLTGFGFYEPFWL+DFAN C
Sbjct  102  PPENKSMKRATAVGVTTTTLFYIMCGVMGYLAFGNDAPGNFLTGFGFYEPFWLVDFANAC  161

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVE  C++RWP++KFIT+E+ +NVPC+G   +N FRLVWRT 
Sbjct  162  IAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTA  221

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIV+AV+AMIFPFFNDF+GLIGAASF+PLTVYFP+EM+IA+TKI ++SF W+WLKIL W
Sbjct  222  YVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVWLKILIW  281

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +C +VSLVA  GS+QGL   +KTYKPF+A
Sbjct  282  SCFIVSLVALVGSVQGLIQSLKTYKPFQA  310



>emb|CAA70968.2| amino acid transporter [Solanum tuberosum]
Length=469

 Score =   330 bits (845),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVMK+AS  GV+TTTLFYVLCG +GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  271  PSESKVMKRASLAGVSTTTLFYVLCGTIGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQPL+ FVE RCS+RWPDSKFIT+EY + VP  GT ++N FRLVWRT 
Sbjct  331  IAVHLVGAYQVFCQPLYGFVEGRCSERWPDSKFITSEYAMQVPWCGTYNLNLFRLVWRTT  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMIFPFFNDFLGLIGAASFYPLTVYFPIEM+IAQ KIPKYSF W+WLKILSW
Sbjct  391  YVIVTAVIAMIFPFFNDFLGLIGAASFYPLTVYFPIEMYIAQRKIPKYSFTWVWLKILSW  450

Query  189  TCLV  178
            TCL+
Sbjct  451  TCLI  454



>ref|XP_010268968.1| PREDICTED: amino acid permease 6-like isoform X1 [Nelumbo nucifera]
Length=466

 Score =   329 bits (844),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 153/210 (73%), Positives = 179/210 (85%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+ S +GV+TT +FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDFANVC
Sbjct  257  PPENKVMKRVSFIGVSTTAMFYVLCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDFANVC  316

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIG YQ+  Q LF+FVE+ C   WP++KFI  E  VNVP  G   IN FRLVWR+ 
Sbjct  317  IALHLIGVYQLLSQILFAFVENFCRNHWPENKFIAKERAVNVPLHGKYYINLFRLVWRSV  376

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T VVAMIFPFFNDFLGLIGA S++PL+VYFPIE++I+Q+KIPK+SF W WLKILS+
Sbjct  377  YVIATTVVAMIFPFFNDFLGLIGAFSYWPLSVYFPIEIYISQSKIPKFSFTWTWLKILSY  436

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVS+VAA GS+QGL  DVKTYKPFK++
Sbjct  437  ACLVVSIVAAVGSVQGLAADVKTYKPFKSR  466



>ref|XP_007161529.1| hypothetical protein PHAVU_001G077000g [Phaseolus vulgaris]
 gb|ESW33523.1| hypothetical protein PHAVU_001G077000g [Phaseolus vulgaris]
Length=474

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 145/210 (69%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN++MK+AS +G+ TTTLFYVLCGCLGYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  264  PPENRMMKRASLIGIMTTTLFYVLCGCLGYAAFGNDAPGNFLTGFGFYEPFWLIDFANIC  323

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVF QP+F FVE    ++WP+S+FI  E+ VNVP     ++NFFR+ WRT 
Sbjct  324  IAVHLVGAYQVFVQPIFGFVEKWSKEKWPESQFINGEHGVNVPLCEGITLNFFRMFWRTT  383

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAV+AM+FPFFNDFLGLIG+ SF+PLTVYFP+EM+I ++ +  +SF WIWLKILSW
Sbjct  384  YVIITAVLAMLFPFFNDFLGLIGSLSFWPLTVYFPVEMYIKRSNMKSFSFTWIWLKILSW  443

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++S+++A GSIQGL  D+K YKPF+AQ
Sbjct  444  VCLIISIISAVGSIQGLAHDLKKYKPFQAQ  473



>ref|XP_009138576.1| PREDICTED: amino acid permease 1-like [Brassica rapa]
Length=484

 Score =   329 bits (843),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC GYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  273  PAENKSMKRASLVGVSTTTFFYILCGCFGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE RC++ WPD+KFIT EY VN+   G  +I+ FRLVWRT 
Sbjct  333  IAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITYEYSVNIHFLGKFNISIFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK++ W
Sbjct  393  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKVMCW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  453  VCLIVSLLAAAGSIAGLISSVKTYKPFR  480



>gb|KDO81359.1| hypothetical protein CISIN_1g011548mg [Citrus sinensis]
Length=340

 Score =   324 bits (830),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+A+ VGVTTTTLFY++CG +GY AFGN+APGNFLTGFGFYEPFWL+DFAN C
Sbjct  128  PPENKSMKRATAVGVTTTTLFYIMCGVMGYLAFGNDAPGNFLTGFGFYEPFWLVDFANAC  187

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVE  C++RWP++KFIT+E+ +NVPC+G   +N FRLVWRT 
Sbjct  188  IAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTA  247

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIV+AV+AMIFPFFNDF+GLIGAASF+PLTVYFP+EM+IA+TKI ++SF W+WLKIL W
Sbjct  248  YVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVWLKILIW  307

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +C +VSLVA  GS+QGL   +KTYKPF+A
Sbjct  308  SCFIVSLVALVGSVQGLIQSLKTYKPFQA  336



>ref|XP_010104540.1| hypothetical protein L484_025514 [Morus notabilis]
 gb|EXC01141.1| hypothetical protein L484_025514 [Morus notabilis]
Length=484

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 161/210 (77%), Positives = 180/210 (86%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MKKA+  G+ TTT FYVLCGC+GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  275  PPENKSMKKATFTGIATTTTFYVLCGCVGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  334

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVF QP++  VE  CS R  ++KFIT+EY VN+P  G   ++ F++VWRT 
Sbjct  335  IAIHLIGAYQVFSQPIYGVVERYCSNRLSENKFITSEYAVNIPFHGAYYVSPFKVVWRTA  394

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T V+AMIFPFFNDFLGL+GAASF+PLTVYFPIEMHIAQTK PKYSFRW  LK LSW
Sbjct  395  YVILTTVIAMIFPFFNDFLGLLGAASFWPLTVYFPIEMHIAQTKTPKYSFRWTMLKTLSW  454

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVS+VAAAGS+QGL  DVKTYKPFK Q
Sbjct  455  ACLVVSIVAAAGSVQGLATDVKTYKPFKTQ  484



>ref|XP_002888218.1| hypothetical protein ARALYDRAFT_893658 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64477.1| hypothetical protein ARALYDRAFT_893658 [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   328 bits (842),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFGN APG+FLT FGF+EPFWLIDFAN C
Sbjct  274  PAENKAMKRASLVGVSTTTFFYILCGCIGYAAFGNKAPGDFLTDFGFFEPFWLIDFANAC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVE +C++ +PD+KFIT+EY VNVP  G  +I+ FRLVWR+ 
Sbjct  334  IAVHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITSEYPVNVPFLGKFNISLFRLVWRSA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK++ +
Sbjct  394  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKMMCY  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  454  VCLIVSLLAAAGSIAGLISSVKTYKPFR  481



>emb|CDY04448.1| BnaA03g59400D [Brassica napus]
Length=540

 Score =   330 bits (845),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC GYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  273  PAENKSMKRASLVGVSTTTFFYILCGCFGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE RC++ WPD+KFIT EY VN+   G  +I+ FRLVWRT 
Sbjct  333  IAFHLIGAYQVFAQPIFQFVEKRCNRNWPDNKFITYEYSVNIHFLGKFNISIFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTK+ KYS RWI LK++ W
Sbjct  393  YVVITTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKVKKYSPRWIGLKVMCW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  453  VCLIVSLLAAAGSIAGLISSVKTYKPFR  480



>gb|KFK40897.1| hypothetical protein AALP_AA2G057600 [Arabis alpina]
Length=484

 Score =   327 bits (838),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FYVLCGC+GYAAFGN APG+FLT FGF+EPFWLIDFAN C
Sbjct  273  PAENKAMKRASLVGVSTTTFFYVLCGCIGYAAFGNKAPGDFLTDFGFFEPFWLIDFANAC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE  C + WPD+KFI +E+ VN+P  G  +++FFRLVWRT 
Sbjct  333  IAAHLIGAYQVFAQPIFQFVEKNCKKNWPDNKFINSEHSVNIPFLGKFNVSFFRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T +VAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK+L W
Sbjct  393  YVVITTLVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSPRWIGLKMLCW  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VK YKPF+
Sbjct  453  VCLIVSLLAAAGSIAGLIGSVKQYKPFR  480



>ref|XP_006433701.1| hypothetical protein CICLE_v10000981mg [Citrus clementina]
 gb|ESR46941.1| hypothetical protein CICLE_v10000981mg [Citrus clementina]
Length=483

 Score =   327 bits (837),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 154/209 (74%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+A+ VGVTTTTLFY++CG +GY AFGN+APGNFLTGFGFYEPFWLIDFAN C
Sbjct  271  PPENKSMKRATAVGVTTTTLFYIMCGVMGYLAFGNDAPGNFLTGFGFYEPFWLIDFANAC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVE  C++RWP++KFIT+E+ +NVPC+G   +N FRLVWRT 
Sbjct  331  IAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTA  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIV+AV+AMIFPFFNDF+GLIGAASF+PLTVYFP+EM+IA+TKI ++SF W+WLKIL W
Sbjct  391  YVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVWLKILIW  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +C +VSLVA  GS+QGL   +KTYKPF+A
Sbjct  451  SCFIVSLVALVGSVQGLIQSLKTYKPFQA  479



>gb|KDO81356.1| hypothetical protein CISIN_1g011548mg [Citrus sinensis]
Length=483

 Score =   326 bits (836),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 153/209 (73%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+A+ VGVTTTTLFY++CG +GY AFGN+APGNFLTGFGFYEPFWL+DFAN C
Sbjct  271  PPENKSMKRATAVGVTTTTLFYIMCGVMGYLAFGNDAPGNFLTGFGFYEPFWLVDFANAC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVE  C++RWP++KFIT+E+ +NVPC+G   +N FRLVWRT 
Sbjct  331  IAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTA  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIV+AV+AMIFPFFNDF+GLIGAASF+PLTVYFP+EM+IA+TKI ++SF W+WLKIL W
Sbjct  391  YVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVWLKILIW  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +C +VSLVA  GS+QGL   +KTYKPF+A
Sbjct  451  SCFIVSLVALVGSVQGLIQSLKTYKPFQA  479



>ref|XP_010667459.1| PREDICTED: amino acid permease 6-like [Beta vulgaris subsp. vulgaris]
Length=491

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 181/211 (86%), Gaps = 1/211 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS VGV+TT+LFY+LCGC GYAAFGN APGNFLTGFGFYEPFWL+DFANVC
Sbjct  280  PPENKVMKKASLVGVSTTSLFYILCGCFGYAAFGNEAPGNFLTGFGFYEPFWLVDFANVC  339

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVP-CFGTCSINFFRLVWRT  373
            IA+HL+GAYQVF QP+F FVES   + WP++KFIT ++ + +P   G    N+FRLVWRT
Sbjct  340  IAVHLVGAYQVFTQPVFGFVESWSKKHWPENKFITRDHPIEIPFGNGIYYFNWFRLVWRT  399

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YVIVTA++AM+FPFFNDFLGL+G+ SF+PLTV+FP+EMHI+Q K+PKYS +WI LK LS
Sbjct  400  SYVIVTAILAMLFPFFNDFLGLLGSLSFWPLTVFFPVEMHISQAKVPKYSSKWIALKTLS  459

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            + CLVVSL+AAAGSIQGL   VK YKPF+AQ
Sbjct  460  YACLVVSLIAAAGSIQGLVGSVKKYKPFQAQ  490



>ref|XP_006472367.1| PREDICTED: amino acid permease 6-like [Citrus sinensis]
Length=483

 Score =   325 bits (833),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/209 (73%), Positives = 186/209 (89%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+A+ VGVTTTTLFY++CG +GY AFGN+APGNFLTGFGFYEPFWL+DFAN C
Sbjct  271  PPENKSMKRATAVGVTTTTLFYIMCGVMGYLAFGNDAPGNFLTGFGFYEPFWLVDFANAC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP+F FVE  C++RWP++KFIT+E+ +NVPC+G   +N FRLVWRT 
Sbjct  331  IAVHLIGAYQVFCQPIFGFVEKWCNKRWPENKFITSEHGINVPCYGVYHVNSFRLVWRTA  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIV+AV+AMIFPFFNDF+GLIGAASF+PLTVYFP+EM+IA+TKI ++SF W+WLKIL W
Sbjct  391  YVIVSAVLAMIFPFFNDFVGLIGAASFWPLTVYFPVEMYIARTKIRRFSFTWVWLKILIW  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +C +VSLVA  GS+QGL   +KTY+PF+A
Sbjct  451  SCFIVSLVALVGSVQGLIQSLKTYRPFQA  479



>ref|XP_010269103.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=465

 Score =   324 bits (831),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/210 (71%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKAS +GV  T++FYVLCGC+GYAAFGN+APGNFLTGFGFYEPFWLIDF+N C
Sbjct  256  PPENEVMKKASFIGVLITSMFYVLCGCIGYAAFGNDAPGNFLTGFGFYEPFWLIDFSNAC  315

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQ  F+FVE  C ++WP++ FI  E  V+VP +G   IN FRLVWRT 
Sbjct  316  IVVHLVGAYQVFCQIFFAFVEKWCRKQWPNNGFIGKERAVSVPLYGKYYINSFRLVWRTM  375

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+  V+AMIFPFFNDF+GLIGAAS++PL V+FPIEM+IAQ++IPK+SFRW  L+ILSW
Sbjct  376  YVILMTVIAMIFPFFNDFMGLIGAASYWPLCVFFPIEMYIAQSRIPKFSFRWALLQILSW  435

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL VS+VAA GS+QGL  DVKTYKPFK Q
Sbjct  436  ACLSVSIVAAVGSVQGLAADVKTYKPFKTQ  465



>ref|XP_006417504.1| hypothetical protein EUTSA_v10007516mg [Eutrema salsugineum]
 gb|ESQ35857.1| hypothetical protein EUTSA_v10007516mg [Eutrema salsugineum]
Length=478

 Score =   324 bits (830),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS VGV+TTT+FY+LCGC+GYAAFGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  268  PPENKVMKKASLVGVSTTTVFYILCGCIGYAAFGNQAPGDFLTDFGFYEPYWLIDFANAC  327

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQV+ QP F FVES+C ++WP+SKFI  EY  N+P  G C +N FRLVWRT 
Sbjct  328  IALHLIGAYQVYGQPFFQFVESKCKKKWPESKFINKEYSSNIPMLGKCRVNLFRLVWRTC  387

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGL+GA +F+PLTVYFP+ MHIAQTK+ KYS RW+ L +L  
Sbjct  388  YVILTTVVAMIFPFFNAILGLLGALAFWPLTVYFPVAMHIAQTKVKKYSRRWLALYLLVL  447

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS +AA GSI GL   VKTYKPFK
Sbjct  448  VCLIVSFLAAVGSIVGLISSVKTYKPFK  475



>ref|XP_003550117.1| PREDICTED: amino acid permease 6 [Glycine max]
Length=470

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G+ TTTLFYVLCGCLGYAAFGN+AP NFLTGFGFYEPFWLIDFANVC
Sbjct  260  PPENKVMKRASLIGIMTTTLFYVLCGCLGYAAFGNDAPSNFLTGFGFYEPFWLIDFANVC  319

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVF QP+F FVE    + W +S+FI  E+ +N+P  G+ ++NFFR+VWRT 
Sbjct  320  IAVHLVGAYQVFVQPIFGFVEKWSKENWTESQFINGEHTLNIPLCGSYNVNFFRVVWRTA  379

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAVVAM+ PFFNDFL LIGA SF+PLTVYFPIEM+I ++ + ++SF W WLKILSW
Sbjct  380  YVIITAVVAMLLPFFNDFLALIGALSFWPLTVYFPIEMYIKKSNMQRFSFTWTWLKILSW  439

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++S+++  GSIQGL   +K YKPF+A+
Sbjct  440  VCLIISIISLVGSIQGLSVSIKKYKPFQAE  469



>ref|XP_010511080.1| PREDICTED: amino acid permease 1-like [Camelina sativa]
Length=371

 Score =   318 bits (816),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC GYAAFG++APG+FLT FGFYEP+WL+DFAN C
Sbjct  160  PAENKAMKRASLVGVSTTTFFYILCGCFGYAAFGSDAPGDFLTDFGFYEPYWLVDFANAC  219

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE +C++ +PD+KFITAEY VNVP  G  +I+ FRLVWRT 
Sbjct  220  IAAHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITAEYSVNVPVLGKFNISLFRLVWRTA  279

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VT VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK++ +
Sbjct  280  YVVVTTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKMMCY  339

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  340  VCLIVSLLAAAGSIAGLISSVKTYKPFR  367



>ref|XP_006346279.1| PREDICTED: amino acid permease 6-like [Solanum tuberosum]
Length=464

 Score =   321 bits (823),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 144/210 (69%), Positives = 177/210 (84%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MKKA+ VG++ +T+FY LCG LGYAAFGN APGNFLTGFGFYEPFWL+DFANVC
Sbjct  254  PPENKSMKKAALVGISVSTIFYTLCGLLGYAAFGNKAPGNFLTGFGFYEPFWLVDFANVC  313

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQPLF FVE    Q+WP SKFIT EY +N+   G  + NF+RLVWRT 
Sbjct  314  IVVHLVGAYQVFCQPLFGFVEGWSKQKWPQSKFITKEYMINLSPLGLFNFNFYRLVWRTS  373

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+ T ++AM+FPFFNDF+GL+GAASF+PLTVYFPI+M+IAQ KIPK SF WIWL ILS+
Sbjct  374  YVVFTTILAMLFPFFNDFVGLLGAASFWPLTVYFPIQMYIAQAKIPKNSFTWIWLNILSF  433

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++SL+AAAGS+QGL   ++ +KPF+++
Sbjct  434  VCLIISLLAAAGSVQGLIKSLREFKPFQSR  463



>ref|XP_010414737.1| PREDICTED: amino acid permease 1-like [Camelina sativa]
Length=485

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFG+ APG+FLT FGFYEP+WLIDFAN C
Sbjct  274  PAENKAMKRASLVGVSTTTFFYILCGCMGYAAFGSAAPGDFLTDFGFYEPYWLIDFANAC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE +C++ +PD+KFITAEY VNVP  G  +I+ FRLVWRT 
Sbjct  334  IAAHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITAEYSVNVPVLGKFNISLFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VT VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK++ +
Sbjct  394  YVVVTTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKMMCY  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  454  VCLIVSLLAAAGSIAGLISSVKTYKPFR  481



>ref|NP_001233983.1| amino acid transporter [Solanum lycopersicum]
 gb|AAO13688.1|AF013279_1 amino acid transporter [Solanum lycopersicum]
Length=465

 Score =   319 bits (818),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 143/210 (68%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MKKA+  G++ +T+FY+LCG LGYAAFGN APGNFLTGFGFYEPFWLIDFANVC
Sbjct  255  PPENKSMKKATFTGISVSTIFYLLCGLLGYAAFGNKAPGNFLTGFGFYEPFWLIDFANVC  314

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVFCQP+F FVE    Q+WP+SKFIT EY +N+   G  + NF+RLVWRT 
Sbjct  315  IVIHLVGAYQVFCQPIFGFVEGWSRQKWPESKFITKEYMINLSHLGLFNFNFYRLVWRTL  374

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+ T ++AM+FPFFNDF+G IGAASF+PLTVYFPI+M+IAQ KIPKYSF WIWL ILS+
Sbjct  375  YVVFTTILAMLFPFFNDFVGFIGAASFWPLTVYFPIQMYIAQAKIPKYSFTWIWLNILSF  434

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++SL+AAAGS++GL   ++ ++PF+++
Sbjct  435  VCLIISLLAAAGSVRGLIKSLQEFEPFQSR  464



>emb|CDY22607.1| BnaC08g42410D [Brassica napus]
Length=481

 Score =   319 bits (817),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 170/209 (81%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS   V+TTT FY+LCGC+GYA FGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  270  PPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLTDFGFYEPYWLIDFANAC  329

Query  549  IAIHLIGAYQ-VFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRT  373
            IA+HLIGAYQ VF QP+F FVE +C+Q WP+S FIT E+ +NVP  G C INFFRLVWRT
Sbjct  330  IAVHLIGAYQQVFAQPIFQFVEKKCNQAWPESNFITKEHSMNVPLLGKCRINFFRLVWRT  389

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YVI + VVAMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q K+ KYS RWI LK+L 
Sbjct  390  TYVIFSTVVAMIFPFFNAILGLIGAVAFWPLTVYFPVEMHISQKKVKKYSVRWIVLKLLV  449

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            + CL+VSL+AA GSI GL   VK YKPF 
Sbjct  450  FVCLIVSLLAAIGSIVGLISSVKAYKPFH  478



>ref|XP_010470262.1| PREDICTED: amino acid permease 1 [Camelina sativa]
Length=485

 Score =   318 bits (815),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGC+GYAAFG+ APG+FLT FGF+EP+WLIDFAN C
Sbjct  274  PAENKAMKRASLVGVSTTTFFYILCGCMGYAAFGSAAPGDFLTDFGFFEPYWLIDFANAC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA HLIGAYQVF QP+F FVE +C++ +PD+KFITAEY VNVP  G  +I+ FRLVWRT 
Sbjct  334  IAAHLIGAYQVFAQPIFQFVEKKCNRNYPDNKFITAEYSVNVPVLGKFNISLFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VT VVAMIFPFFN  LGLIGAASF+PLTVYFP+EMHIAQTKI KYS RWI LK++ +
Sbjct  394  YVVVTTVVAMIFPFFNAILGLIGAASFWPLTVYFPVEMHIAQTKIKKYSARWIALKMMCY  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  454  VCLIVSLLAAAGSIAGLISSVKTYKPFR  481



>gb|KDO49532.1| hypothetical protein CISIN_1g046038mg, partial [Citrus sinensis]
Length=265

 Score =   310 bits (794),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS VGV+ TT+FY+LCG LGYAAFG+ APGNFLTGFGFYEPFWL+DFAN+C
Sbjct  55   PPENKVMKRASFVGVSITTIFYMLCGTLGYAAFGDKAPGNFLTGFGFYEPFWLVDFANMC  114

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+ VE+ C  +WP+S F+T  + +  P  G C +N FR++WRT 
Sbjct  115  IVVHLVGAYQVFCQPIFTTVENWCCHKWPESGFVTKRHPITFPSCGVCYVNMFRVIWRTV  174

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAV+AM+FPFFN  +GL+GA +F+PLTVYFP+EM+I++ KI K+S  W+WL++LSW
Sbjct  175  YVILTAVIAMLFPFFNSVIGLLGAIAFWPLTVYFPVEMYISRAKIRKFSVTWMWLQVLSW  234

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            TC +V+L+AAAGSIQGL  D++TYKPF +
Sbjct  235  TCFIVTLLAAAGSIQGLVKDLQTYKPFSS  263



>ref|XP_006307429.1| hypothetical protein CARUB_v10009053mg [Capsella rubella]
 gb|EOA40327.1| hypothetical protein CARUB_v10009053mg [Capsella rubella]
Length=468

 Score =   316 bits (809),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCG +GYAAFGN APG+ LT FGFYEP+WLIDFAN C
Sbjct  257  PPENKVMKKASLAGVSTTTAFYILCGGMGYAAFGNQAPGDLLTDFGFYEPYWLIDFANAC  316

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+ AYQVF QP+F FVE +C+++WP+S FIT+E+ +++P  GTC INFFRL+WRT 
Sbjct  317  IVLHLVAAYQVFAQPIFQFVEKKCNKKWPESNFITSEHSMDIPLIGTCRINFFRLLWRTA  376

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVT VVAMIFPFFN  LGLIG+ +F+PLTVYFP+ MH+AQTK+ KYS RWI L++L  
Sbjct  377  YVIVTTVVAMIFPFFNAILGLIGSFAFWPLTVYFPVAMHMAQTKVKKYSLRWIGLELLVS  436

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AA GSI GL   VK YKPF 
Sbjct  437  LCLIVSLLAAMGSIVGLISSVKAYKPFN  464



>ref|XP_004955421.1| PREDICTED: amino acid permease 6-like [Setaria italica]
Length=483

 Score =   316 bits (809),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKAS +GV+TTT+FY+LCG LGYAAFGN APGNFLTGFGFY+PFWLID  NVC
Sbjct  274  PPENVVMKKASFIGVSTTTMFYMLCGVLGYAAFGNQAPGNFLTGFGFYDPFWLIDVGNVC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+F+FVE+    RWPDS F+ AE  V VP  G   ++ FRLVWRT 
Sbjct  334  IAIHLIGAYQVFCQPIFAFVEAWARDRWPDSGFLNAERVVRVPLAGDFPLSPFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA+VAMIFPFFNDFLGLIGA SF+PLTVYFP++M++AQ K  ++S  W W+ +LS+
Sbjct  394  YVVITALVAMIFPFFNDFLGLIGAVSFWPLTVYFPVQMYMAQAKTRRFSPTWTWMNVLSF  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CLVVSL+AAAGS+QGL  D+K YKPFK
Sbjct  454  SCLVVSLLAAAGSVQGLITDLKGYKPFK  481



>ref|XP_009627462.1| PREDICTED: amino acid permease 6-like [Nicotiana tomentosiformis]
Length=472

 Score =   314 bits (805),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 140/210 (67%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN+ MK+AS +G++ +T+FY+LCG +GYAAFGN APGNFLTGFGFYEPFWL+DFANVC
Sbjct  262  PRENQYMKRASCIGISVSTIFYMLCGLIGYAAFGNKAPGNFLTGFGFYEPFWLVDFANVC  321

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE    Q+WP+SKFIT EY +N+   G    +F+RLVWRT 
Sbjct  322  IVVHLVGAYQVFCQPIFAFVEGWSKQKWPESKFITREYMINLSPLGLFPFSFYRLVWRTA  381

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T ++AM+FPFFNDF+GL+GAASF+PLTVYFPI+M+IAQ KIPKYSF WIWLKILS 
Sbjct  382  YVIFTTILAMLFPFFNDFVGLLGAASFWPLTVYFPIQMYIAQAKIPKYSFTWIWLKILSL  441

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++SL+AAAGS+QGL   ++ ++ FK++
Sbjct  442  VCLIISLLAAAGSVQGLIKSLQKFQLFKSE  471



>ref|XP_009792204.1| PREDICTED: amino acid permease 6-like [Nicotiana sylvestris]
Length=472

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 178/210 (85%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN+ MK+AS +G++ +T+FY+LCG +GYAAFGN APGNFLTGFGFYEPFWL+DFANVC
Sbjct  262  PRENQYMKRASCIGISVSTIFYMLCGLIGYAAFGNKAPGNFLTGFGFYEPFWLVDFANVC  321

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE    Q+WP+SKFIT EY +N+   G    +F+RLVWRT 
Sbjct  322  IVVHLVGAYQVFCQPIFAFVEGWSKQKWPESKFITREYMINLSPLGLFPFSFYRLVWRTA  381

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T ++AM+FPFFNDF+GL+GAASF+PLTVYFPI+M+IAQ +IPKYSF WIWLKILS 
Sbjct  382  YVIFTTILAMLFPFFNDFVGLLGAASFWPLTVYFPIQMYIAQARIPKYSFTWIWLKILSL  441

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++SL+AAAGS+QGL   ++ ++ FK++
Sbjct  442  VCLIISLLAAAGSVQGLIKSLQKFQLFKSE  471



>ref|XP_006487060.1| PREDICTED: amino acid permease 6-like [Citrus sinensis]
Length=475

 Score =   313 bits (802),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 177/209 (85%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS VGV+ TT+FY+LCG LGYAAFG+ APGNFLTGFGFYEPFWL+DFAN+C
Sbjct  265  PPENKVMKRASFVGVSITTIFYMLCGTLGYAAFGDKAPGNFLTGFGFYEPFWLVDFANMC  324

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+ VE+ C  +WP+S F+T  + +  P  G C +N FR++WRT 
Sbjct  325  IVVHLVGAYQVFCQPIFTTVENWCCHKWPESGFVTKRHPITFPSCGVCYVNMFRVIWRTV  384

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+TAV+AM+FPFFN  +GL+GA +F+PLTVYFP+EM+I++ KI K+S  W+WL++LSW
Sbjct  385  YVILTAVIAMLFPFFNSVIGLLGAIAFWPLTVYFPVEMYISRAKIRKFSVTWMWLQVLSW  444

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            TC +V+L+AAAGSIQGL  D++TYKPF +
Sbjct  445  TCFIVTLLAAAGSIQGLVKDLQTYKPFSS  473



>ref|XP_009113317.1| PREDICTED: amino acid permease 1 [Brassica rapa]
Length=515

 Score =   314 bits (805),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 153/238 (64%), Positives = 175/238 (74%), Gaps = 30/238 (13%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+AS VGV+TTT FY+LCGCLGYAAFGN APG+FLT FGFYEPFWLIDFAN C
Sbjct  274  PAENKAMKRASFVGVSTTTFFYILCGCLGYAAFGNKAPGDFLTDFGFYEPFWLIDFANAC  333

Query  549  IAIHLIGAY------------------------------QVFCQPLFSFVESRCSQRWPD  460
            IA HLIGAY                              QVF  P+F FVE + ++ WPD
Sbjct  334  IAFHLIGAYQVKPNPKGEKDCFLFALSRSLAYEKETYFLQVFAHPIFQFVEKKGNRNWPD  393

Query  459  SKFITAEYEVNVPCFGTCSINFFRLVWRTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPL  280
            +KFIT+EY VN+P  G  +IN FRLVWRT YV++T +VAMIFPFFN  LGLIGAASF+PL
Sbjct  394  NKFITSEYSVNIPFLGKFNINLFRLVWRTAYVVITTLVAMIFPFFNAILGLIGAASFWPL  453

Query  279  TVYFPIEMHIAQTKIPKYSFRWIWLKILSWTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            TVYFP+EMHIAQTK+ KYS RWI LK+L W CL+VSL+AAAGSI GL   VKTYKPF+
Sbjct  454  TVYFPVEMHIAQTKVKKYSPRWIGLKMLCWVCLIVSLLAAAGSIAGLISSVKTYKPFR  511



>ref|XP_010314596.1| PREDICTED: LOW QUALITY PROTEIN: amino acid permease 6-like [Solanum 
lycopersicum]
Length=469

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 141/180 (78%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS VGV TTTLFYVLCG +GYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC
Sbjct  276  PPENKAMKRASLVGVFTTTLFYVLCGTIGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  335

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP++SFVE RC ++WP++KFI +++++N+P  G  ++++FR++WRT 
Sbjct  336  IAIHLIGAYQVFCQPIYSFVEGRCIEKWPENKFIKSQHDINIPWLGVYNLSYFRMIWRTI  395

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTA++AMIFPFFN  LGLIGAASFYPLTVYFPIEMHIAQ KIPKYSF+WIWL ILSW
Sbjct  396  YVIVTAIIAMIFPFFNAILGLIGAASFYPLTVYFPIEMHIAQRKIPKYSFKWIWLHILSW  455



>ref|XP_010475859.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=469

 Score =   311 bits (798),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+ LT FGFYEP+WL+DFAN C
Sbjct  259  PPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNRAPGDLLTDFGFYEPYWLVDFANAC  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+ AYQVF QP+F FVE++C+++WP+SKFIT+E+ +++P  G C IN FRL WRT 
Sbjct  319  IVLHLVAAYQVFAQPIFQFVENKCNKKWPESKFITSEHSMSIPLIGKCRINLFRLWWRTA  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGLIG+ +F+PLTVYFP+ MHIAQTK+ KYS RW+ L +L  
Sbjct  379  YVILTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIAQTKVKKYSPRWLALNLLVV  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AA GSI GL   VK YKPF 
Sbjct  439  VCLIVSLLAALGSIVGLISSVKAYKPFS  466



>emb|CDY63746.1| BnaC05g07760D, partial [Brassica napus]
Length=356

 Score =   307 bits (787),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS +GV+TTT+FY+LCGC+GYAAFGN APG+FLT FGFYEPFWL+ FANVC
Sbjct  146  PPENKVMKKASLIGVSTTTVFYLLCGCIGYAAFGNIAPGDFLTDFGFYEPFWLVIFANVC  205

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQV+ QP F FVES+C+++WP+S FI  EY + +P  G   +N FRLVWRT 
Sbjct  206  IAVHLVGAYQVYVQPFFQFVESKCNKKWPESNFINKEYSLKIPLLGKFRVNHFRLVWRTN  265

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T  +AMIFPFFN  LGL+GA +F+PLTVYFP+ MHIAQTK+ KYS RW+ L +L  
Sbjct  266  YVILTTFIAMIFPFFNSILGLLGALAFWPLTVYFPVAMHIAQTKVKKYSGRWLALHLLVL  325

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VS +AA GSI GL  +VK YKPF++
Sbjct  326  VCLIVSALAAVGSIVGLINNVKKYKPFES  354



>ref|XP_010458325.1| PREDICTED: amino acid permease 8 [Camelina sativa]
Length=476

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS  GV+TTT FY+LCGC GYAAFGN APG+FLT FGFY+P+WLIDFAN C
Sbjct  266  PPENKVMKRASLAGVSTTTFFYILCGCFGYAAFGNKAPGDFLTEFGFYDPYWLIDFANAC  325

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQV+ QP F FVES C + WP S FI  EY  N+P FG C +N FRLVWRT 
Sbjct  326  IALHLIGAYQVYGQPFFQFVESNCKKNWPQSNFINKEYSSNIPLFGKCRVNLFRLVWRTC  385

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGL+GA SF+PLTVYFP+ MHIAQTK+ KYS RW+ L +L  
Sbjct  386  YVVMTTVVAMIFPFFNAILGLLGALSFWPLTVYFPVSMHIAQTKVKKYSPRWLALNLLVV  445

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS +AA GSI GL   VK YKPFK
Sbjct  446  VCLIVSCLAAVGSIIGLISSVKAYKPFK  473



>emb|CDY62728.1| BnaC05g49210D [Brassica napus]
Length=482

 Score =   311 bits (798),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 171/209 (82%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+FLT F FYEP+WLID+AN C
Sbjct  275  PPENKVMKKASLAGVSTTTFFYMLCGCIGYAAFGNKAPGDFLTEF-FYEPYWLIDYANAC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLI AYQVF QP+F FVE++C++ WP+S FIT E+ +N+P  G C +NFFRLVWRT 
Sbjct  334  IVLHLIAAYQVFAQPIFQFVENKCNKAWPESNFITIEHSMNIPFLGKCRVNFFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGLIGAA+F+PLTVYFP+EMHI+Q KI KYS RWI LK+L  
Sbjct  394  YVILTTVVAMIFPFFNSILGLIGAAAFWPLTVYFPVEMHISQRKIKKYSMRWIGLKLLVS  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+V+L+AA GSI GL   VK YK F +
Sbjct  454  VCLIVTLLAAIGSIVGLIKSVKAYKHFHS  482



>ref|XP_010490519.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
 ref|XP_010490528.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
 ref|XP_010490536.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=476

 Score =   311 bits (797),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS  GV+TTT+FY+LCGC+GYAAFGN APG+FLT FGFY+P+WLIDFAN C
Sbjct  266  PPENKVMKRASLAGVSTTTVFYILCGCIGYAAFGNAAPGDFLTEFGFYDPYWLIDFANAC  325

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQV+ QP F FVES C ++WP S FI  EY  N+P FG C +N FRLVWRT 
Sbjct  326  IALHLIGAYQVYGQPFFQFVESNCKKKWPQSNFINKEYSSNIPLFGKCRVNLFRLVWRTC  385

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGL+GA SF+PLTVYFP+ MHIAQTK+ KYS RW+ L +L  
Sbjct  386  YVVMTTVVAMIFPFFNAILGLLGALSFWPLTVYFPVSMHIAQTKVKKYSPRWLALNLLVV  445

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS +AA GSI GL   VK YKPF 
Sbjct  446  VCLIVSCLAAVGSIIGLIRSVKAYKPFN  473



>ref|XP_006306441.1| hypothetical protein CARUB_v10012383mg [Capsella rubella]
 gb|EOA39339.1| hypothetical protein CARUB_v10012383mg [Capsella rubella]
Length=475

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+A+  GV+TTT+FY+LCGCLGYAAFGN+APG+FLT FGFYEP+WL+DFAN C
Sbjct  265  PPENKVMKRATLAGVSTTTVFYILCGCLGYAAFGNHAPGDFLTDFGFYEPYWLVDFANAC  324

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQV+ QP F FVES C+++WP + FI  EY   VP  G   +N FRLVWRT 
Sbjct  325  IALHLIGAYQVYAQPFFQFVESNCNKKWPQNNFINREYSTKVPLLGKFRVNLFRLVWRTC  384

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAM FPFFN  LGL+GA SF+PLTVYFP+ MH+AQ K+ KYS RW+ L +L W
Sbjct  385  YVVMTTVVAMTFPFFNAILGLLGALSFWPLTVYFPVSMHMAQKKVQKYSRRWLALNLLLW  444

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VS +AA GSI GL   VK+YKPFK+
Sbjct  445  VCLIVSCLAATGSIIGLIKSVKSYKPFKS  473



>ref|XP_002889785.1| hypothetical protein ARALYDRAFT_471112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66044.1| hypothetical protein ARALYDRAFT_471112 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS  GV+TTT+FY+LCGC+GYAAFGN APG+FLT FGFYEP+WL+DFAN C
Sbjct  277  PPENKVMKRASLAGVSTTTVFYILCGCIGYAAFGNQAPGDFLTDFGFYEPYWLVDFANAC  336

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQV+ QP F FVE  C+++WP S FI  EY  ++P  G C +N FRLVWRT 
Sbjct  337  IALHLIGAYQVYAQPFFQFVEENCNKKWPQSNFINKEYSSDIPLLGKCRVNLFRLVWRTC  396

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T  VAMIFPFFN  LGL+GA +F+PLTVYFP+ MHIAQ K+ KYS RW+ L +L  
Sbjct  397  YVVLTTFVAMIFPFFNAILGLLGALAFWPLTVYFPVAMHIAQAKVKKYSRRWLALNLLVL  456

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS++AA GSI GL   VK+YKPFK
Sbjct  457  VCLIVSILAAVGSIIGLINSVKSYKPFK  484



>ref|NP_172472.1| amino acid permease 8 [Arabidopsis thaliana]
 sp|O80592.1|AAP8_ARATH RecName: Full=Amino acid permease 8; AltName: Full=Amino acid 
transporter AAP8 [Arabidopsis thaliana]
 gb|AAC34329.1| putative amino acid permease [Arabidopsis thaliana]
 gb|AEE28528.1| amino acid permease 8 [Arabidopsis thaliana]
Length=475

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS VGV+TTT+FY+LCGC+GYAAFGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  265  PPENKVMKRASLVGVSTTTVFYILCGCIGYAAFGNQAPGDFLTDFGFYEPYWLIDFANAC  324

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQV+ QP F FVE  C+++WP S FI  EY   VP  G C +N FRLVWRT 
Sbjct  325  IALHLIGAYQVYAQPFFQFVEENCNKKWPQSNFINKEYSSKVPLLGKCRVNLFRLVWRTC  384

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T  VAMIFPFFN  LGL+GA +F+PLTVYFP+ MHIAQ K+ KYS RW+ L +L  
Sbjct  385  YVVLTTFVAMIFPFFNAILGLLGAFAFWPLTVYFPVAMHIAQAKVKKYSRRWLALNLLVL  444

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS +AA GSI GL   VK+YKPFK
Sbjct  445  VCLIVSALAAVGSIIGLINSVKSYKPFK  472



>ref|XP_009148321.1| PREDICTED: amino acid permease 8 [Brassica rapa]
Length=486

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS +GV+TTT+FY+LCGC+GYAAFGN +PG+FLT FGFYEPFWL+ FANVC
Sbjct  276  PPENKVMKKASLIGVSTTTVFYLLCGCIGYAAFGNLSPGDFLTDFGFYEPFWLVIFANVC  335

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQV+ QP F FVES+C+++WP+S FI  EY + +P  G   +NFFRLVWRT 
Sbjct  336  IAVHLVGAYQVYVQPFFQFVESKCNKKWPESNFINKEYSLKIPLLGKFRVNFFRLVWRTN  395

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T  +AMIFPFFN  LGL+GA +F+PLTVYFP+ MHIAQTK+ KYS RW+ L +L  
Sbjct  396  YVILTTFIAMIFPFFNSILGLLGALAFWPLTVYFPVAMHIAQTKVKKYSGRWLALNLLVL  455

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VS +AA GSI GL  +VK YKPF++
Sbjct  456  VCLIVSALAAVGSIVGLINNVKKYKPFES  484



>ref|XP_009118278.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=489

 Score =   309 bits (792),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/207 (68%), Positives = 165/207 (80%), Gaps = 0/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKAS VGV+T T FY+LC C+GYA FG+ APG+ LT FGFYEP+WLIDFAN C
Sbjct  279  PPENIVMKKASLVGVSTATAFYILCACMGYATFGSQAPGDLLTDFGFYEPYWLIDFANAC  338

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIG YQV  QP+F FVE +C++ WP+S FIT E+ +N+P  G C INFFRLVWRT 
Sbjct  339  IAVHLIGVYQVIAQPIFQFVEKKCNKAWPESNFITKEHSMNIPLLGKCRINFFRLVWRTI  398

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI + V+AMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q KI KY+ RWI LK+L  
Sbjct  399  YVIFSTVIAMIFPFFNAVLGLIGAVAFWPLTVYFPVEMHISQKKIKKYTMRWIGLKLLVL  458

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CL+VSL+AA GSI GL   VK YKPF
Sbjct  459  VCLIVSLLAAVGSIVGLISSVKAYKPF  485



>ref|XP_002889784.1| hypothetical protein ARALYDRAFT_888258 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66043.1| hypothetical protein ARALYDRAFT_888258 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   308 bits (790),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT+FY+LCG +GYAAFGN APG+ LT FGFYEP+WLIDFAN C
Sbjct  283  PPENKVMKKASLAGVSTTTVFYILCGGIGYAAFGNKAPGDLLTDFGFYEPYWLIDFANAC  342

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLI AYQVF QP+F FVE +C+++WP+S FIT+E+ +N+P  G C+IN FRL+WRT 
Sbjct  343  IVLHLIAAYQVFAQPIFQFVEKKCNKKWPESIFITSEHSMNIPLIGKCTINLFRLLWRTC  402

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGL+GA +F+PLTVYFP+ MHI Q K+ KYS RWI LK+L  
Sbjct  403  YVVLTTVVAMIFPFFNAILGLLGALAFWPLTVYFPVAMHIEQAKVKKYSLRWIGLKLLVS  462

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+A  GSI GL   VK YKPF 
Sbjct  463  LCLIVSLLATIGSIVGLITSVKAYKPFN  490



>ref|XP_002461426.1| hypothetical protein SORBIDRAFT_02g002440 [Sorghum bicolor]
 gb|EER97947.1| hypothetical protein SORBIDRAFT_02g002440 [Sorghum bicolor]
Length=480

 Score =   307 bits (787),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 173/208 (83%), Gaps = 3/208 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKAS +GV+TTT+FY+LCG LGYAAFGN+APGNFLTGFGFY+PFWLID  NVC
Sbjct  274  PPENVVMKKASFIGVSTTTMFYMLCGVLGYAAFGNDAPGNFLTGFGFYDPFWLIDVGNVC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVFCQP++ FVE+    RWPDS F+ AE+ V     G  S++ FRLVWRT 
Sbjct  334  IAVHLIGAYQVFCQPIYQFVEAWARSRWPDSVFLNAEHTV---AGGLFSVSPFRLVWRTA  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VTA+VAM+FPFFNDFLGLIGA SF+PLTVYFPI+M++AQ K  ++S  W W+ +LS+
Sbjct  391  YVVVTALVAMVFPFFNDFLGLIGAVSFWPLTVYFPIQMYMAQAKTRRFSPAWTWMNVLSY  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL VSL+AAAGS+QGL  D+K YKPFK
Sbjct  451  ACLFVSLLAAAGSVQGLVKDLKGYKPFK  478



>emb|CDY57932.1| BnaA06g38010D [Brassica napus]
Length=462

 Score =   305 bits (782),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 143/209 (68%), Positives = 169/209 (81%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+FLT F FYEP+WLIDFAN C
Sbjct  255  PPENKVMKKASLAGVSTTTFFYMLCGCIGYAAFGNKAPGDFLTDF-FYEPYWLIDFANAC  313

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLI AYQVF QP+F FVE++C++ WP+S FIT E+ +N+   G C I+FFRLVWRT 
Sbjct  314  IVLHLIAAYQVFAQPIFQFVENKCNKAWPESNFITKEHSMNILFLGKCRISFFRLVWRTA  373

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T VVAMIFPFFN  LGLIGAA+F+PLTVYFP+EMHI+Q KI K+S RWI LK+L  
Sbjct  374  YVIFTTVVAMIFPFFNAILGLIGAAAFWPLTVYFPVEMHISQRKIKKHSMRWIGLKLLVL  433

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+V+L+AA GSI GL   VK YK F +
Sbjct  434  VCLIVTLLAAIGSIVGLIKSVKAYKHFHS  462



>emb|CDY22608.1| BnaC08g42420D [Brassica napus]
Length=504

 Score =   306 bits (784),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 166/209 (79%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKAS VGV+T T FY+LC C+GYA FG+ APG+ LT FGFYEP+WLIDFAN C
Sbjct  293  PPENIVMKKASIVGVSTATAFYILCACMGYATFGSQAPGDLLTDFGFYEPYWLIDFANAC  352

Query  549  IAIHLIGAYQ-VFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRT  373
            IA+HLIGAYQ V  QP+F FVE +C++ WP+S FIT E+ +N+P  G C INFFRLVWRT
Sbjct  353  IAVHLIGAYQQVIAQPIFQFVEKKCNKAWPESNFITKEHSMNIPLLGKCRINFFRLVWRT  412

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YVI + V+AMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q KI KY+ RWI LK+L 
Sbjct  413  IYVIFSTVIAMIFPFFNAVLGLIGAVAFWPLTVYFPVEMHISQKKIKKYTMRWIGLKLLV  472

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
              CL+VSL+AA GSI GL   VK YKPF 
Sbjct  473  LVCLIVSLLAAVGSIVGLISSVKAYKPFH  501



>gb|KFK43301.1| hypothetical protein AALP_AA1G106500 [Arabis alpina]
Length=472

 Score =   305 bits (782),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT+FY+LCGC+GYA FGN+APG+FLT FGFYEP+WL+DFAN C
Sbjct  262  PPENKVMKKASLAGVSTTTVFYILCGCIGYATFGNSAPGDFLTDFGFYEPYWLVDFANAC  321

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQV+ QP F FVE+ C ++WP+S FI  EY   +P  G C +NFFRLVWRT 
Sbjct  322  IALHLIGAYQVYAQPFFRFVENICKKKWPESNFINHEYSSKIPLLGKCRVNFFRLVWRTV  381

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGL+GA SF PLTVYFP+ MHIAQ K+  +S RW+ L +L +
Sbjct  382  YVILTTVVAMIFPFFNSILGLLGALSFCPLTVYFPVAMHIAQKKVKVFSPRWLALNLLVF  441

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS +AA GS+ GL   VKTY+PFK
Sbjct  442  VCLIVSSLAAVGSVVGLIQKVKTYQPFK  469



>ref|XP_009148319.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=466

 Score =   305 bits (780),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 169/209 (81%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+FLT F FYEP+WLIDFAN C
Sbjct  259  PPENKVMKKASLAGVSTTTFFYMLCGCIGYAAFGNKAPGDFLTDF-FYEPYWLIDFANAC  317

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLI AYQVF QP+F FVE++C++ WP+S FIT E+ +N+   G C I+FFRLVWRT 
Sbjct  318  IVLHLIAAYQVFAQPIFQFVENKCNKAWPESNFITKEHSMNILFLGKCRISFFRLVWRTA  377

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T VVAMIFPFFN  LGLIGAA+F+PLTVYFP+EMHI+Q KI K+S RWI LK+L  
Sbjct  378  YVIFTTVVAMIFPFFNAILGLIGAAAFWPLTVYFPVEMHISQRKIKKHSMRWIGLKLLVL  437

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C++V+L+AA GSI GL   VK YK F +
Sbjct  438  VCMIVTLLAAIGSIVGLIKSVKAYKHFHS  466



>ref|XP_006417505.1| hypothetical protein EUTSA_v10009701mg [Eutrema salsugineum]
 gb|ESQ35858.1| hypothetical protein EUTSA_v10009701mg [Eutrema salsugineum]
Length=469

 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT+FY+LCGC+GYAAFGNNAPG+FLT FGFYEP+WLIDFAN C
Sbjct  259  PPENKVMKKASLAGVSTTTVFYILCGCIGYAAFGNNAPGDFLTDFGFYEPYWLIDFANAC  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLI AYQVF QP+F FVES+C+++WP+S FIT E+ +N+P  G   IN FRLVWRTG
Sbjct  319  IALHLIAAYQVFAQPIFQFVESKCNKKWPESNFITNEHLMNLPLLGKYRINLFRLVWRTG  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGLIGA SF+PLTVYFP+EMHI+Q  + +YS RWI L++L  
Sbjct  379  YVILTTVVAMIFPFFNAILGLIGAVSFWPLTVYFPVEMHISQKNVKQYSLRWIGLQLLVL  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AA GSI GL   VK YKPF 
Sbjct  439  LCLIVSLLAATGSIVGLITSVKAYKPFH  466



>ref|XP_009118276.1| PREDICTED: amino acid permease 8-like isoform X2 [Brassica rapa]
Length=472

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 169/207 (82%), Gaps = 0/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS   V+TTT FY+LCGC+GYA FGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  262  PPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLTDFGFYEPYWLIDFANAC  321

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVE +C+Q WP+S FIT E+ +N+P  G C INFFRLVWRT 
Sbjct  322  IAVHLIGAYQVFAQPIFQFVEKKCNQAWPESNFITKEHSMNIPLLGKCRINFFRLVWRTT  381

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI + VVAMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q K+ KYS RWI LK+L  
Sbjct  382  YVIFSTVVAMIFPFFNAILGLIGAVAFWPLTVYFPVEMHISQKKVKKYSVRWIVLKLLVL  441

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CL+VSL+AA GSI GL   VK YKPF
Sbjct  442  VCLIVSLLAAIGSIVGLISSVKAYKPF  468



>gb|EMT23821.1| hypothetical protein F775_31800 [Aegilops tauschii]
Length=343

 Score =   297 bits (760),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 169/211 (80%), Gaps = 3/211 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN VMKKAS +GV+TTT FY+LCG LGYAAFG++APGNFLTGFGFYEPFWL+D  NVC
Sbjct  131  PAENTVMKKASLIGVSTTTTFYMLCGVLGYAAFGSSAPGNFLTGFGFYEPFWLVDIGNVC  190

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCF---GTCSINFFRLVW  379
            I +HL+GAYQVFCQP++ FVE     RWPDS F+ AE  + +P     G   ++ FRLVW
Sbjct  191  IVVHLVGAYQVFCQPIYQFVEGCARSRWPDSAFLHAERVLRLPAVLGGGEFPVSPFRLVW  250

Query  378  RTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKI  199
            RT YV++TAVVAM+FPFFNDFLGLIGA SF+PLTVYFP+EM++AQ K+ ++S  W W+ +
Sbjct  251  RTAYVVLTAVVAMLFPFFNDFLGLIGAVSFWPLTVYFPVEMYMAQAKVRRFSPTWTWMNV  310

Query  198  LSWTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            LS  CLVVS++AAAGS+QGL  DV  YKPFK
Sbjct  311  LSVACLVVSVLAAAGSVQGLIKDVAGYKPFK  341



>gb|EYU39081.1| hypothetical protein MIMGU_mgv1a023099mg [Erythranthe guttata]
Length=465

 Score =   300 bits (769),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 177/208 (85%), Gaps = 5/208 (2%)
 Frame = -1

Query  726  PENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCI  547
            PEN VMKKA+  G++ +T+FY+LCG LGYAAFGNNAPGNFLTGFGFYEPFWL+D ANVCI
Sbjct  261  PENVVMKKATLAGISVSTMFYMLCGILGYAAFGNNAPGNFLTGFGFYEPFWLVDIANVCI  320

Query  546  AIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGY  367
             +HLIGAYQVFCQP+++FVE   +++WP++KFIT EY V   C     ++FFRL+WRT Y
Sbjct  321  VVHLIGAYQVFCQPIYAFVEKWSNEKWPENKFITWEYSV---C--GLKLSFFRLIWRTLY  375

Query  366  VIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWT  187
            VI T V+AM+FPFFNDF+GL+GAASF+PLTVYFPIEM+IA+ KIP++SF WIW++ILS  
Sbjct  376  VIFTTVLAMLFPFFNDFVGLLGAASFWPLTVYFPIEMYIARRKIPRFSFMWIWMQILSGI  435

Query  186  CLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            CLV++L++AAGSI+GL   +KT+KPF +
Sbjct  436  CLVITLLSAAGSIEGLIRSLKTFKPFHS  463



>ref|XP_009118279.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=488

 Score =   301 bits (770),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  278  PPENKVMKKASLAGVSTTTGFYILCGCIGYAAFGNQAPGDFLTDFGFYEPYWLIDFANAC  337

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLI AYQVF QP+F F+E +C++ WP+S FI  +Y +N+P  G C INFFRLVWR+ 
Sbjct  338  IAVHLIAAYQVFAQPIFQFIEKKCNKAWPESNFIAKDYSINIPLLGKCRINFFRLVWRST  397

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q KI KY+ RWI LK+L  
Sbjct  398  YVILTTVVAMIFPFFNAILGLIGALTFWPLTVYFPVEMHISQKKIKKYTMRWIGLKLLVL  457

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CLVVSL+AA GSI GL   VK YKPF
Sbjct  458  VCLVVSLLAAVGSIVGLISSVKAYKPF  484



>gb|KEH43993.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=470

 Score =   300 bits (768),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKK++  G+T TT FY LCG +GYAAFGN APGNFLTGFGFYEPFWL+D  N+ 
Sbjct  261  PPENQVMKKSNLTGITITTFFYALCGLVGYAAFGNKAPGNFLTGFGFYEPFWLVDIGNLF  320

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QP+FS VES  ++RWP SK +T EY V +P  GT  +N FR++WRT 
Sbjct  321  IVIHLVGAYQVFGQPVFSLVESWGNKRWPQSKLVTQEYYVKIPLVGTWRMNMFRVIWRTL  380

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T V+AMIFPFFN  +GL+GA SF+PLTVYFPIEM++ Q K+PKYS  WI +K+LSW
Sbjct  381  YVIFTTVIAMIFPFFNSVVGLLGAISFFPLTVYFPIEMYLTQAKVPKYSSIWIGMKLLSW  440

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+V+LVAA GSI+G+  D+KTYKPF + 
Sbjct  441  FCLIVTLVAAVGSIEGIVTDLKTYKPFHSS  470



>emb|CDY22609.1| BnaC08g42430D [Brassica napus]
Length=481

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  271  PPENKVMKKASLAGVSTTTGFYILCGCIGYAAFGNQAPGDFLTDFGFYEPYWLIDFANAC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLI AYQVF QP+F F+E +C++ WP+S FIT +Y +N+P  G C INFFRLVWR+ 
Sbjct  331  IAVHLIAAYQVFAQPIFQFIEKKCNKAWPESNFITKDYSINIPLLGKCRINFFRLVWRST  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T V AMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q K+ KY+ RWI LK+L  
Sbjct  391  YVILTTVAAMIFPFFNAILGLIGALTFWPLTVYFPVEMHISQKKVKKYTMRWIGLKLLVL  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLVVSL+AA GSI GL   VK YKPF 
Sbjct  451  VCLVVSLLAAVGSIVGLISSVKAYKPFH  478



>emb|CDY53831.1| BnaA09g57230D [Brassica napus]
Length=481

 Score =   300 bits (767),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  271  PPENKVMKKASLAGVSTTTGFYILCGCIGYAAFGNQAPGDFLTDFGFYEPYWLIDFANAC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLI AYQVF QP+F F+E +C++ WP+S FI  +Y +N+P  G C INFFRLVWR+ 
Sbjct  331  IAVHLIAAYQVFAQPIFQFIEKKCNKAWPESNFIAKDYSINIPLLGKCRINFFRLVWRST  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q K+ KY+ RWI LK+L  
Sbjct  391  YVILTTVVAMIFPFFNAILGLIGALTFWPLTVYFPVEMHISQRKVKKYTMRWIGLKLLVL  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLVVSL+AA GSI GL   VK YKPF 
Sbjct  451  VCLVVSLLAAVGSIVGLISSVKAYKPFH  478



>ref|XP_009148320.1| PREDICTED: amino acid permease 8-like [Brassica rapa]
Length=470

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKA+  GV+TTT+FY+LCGC+GYAAFGN APG+FLT FGFYEP+WLI+F N C
Sbjct  262  PPENKVMKKATLAGVSTTTVFYILCGCMGYAAFGNRAPGDFLTDFGFYEPYWLINFDNAC  321

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+ AYQVF QP+F  VE++C++ WP++ FI  E+ +N+P  G   INFFRLVWRT 
Sbjct  322  IDLHLMAAYQVFAQPIFQLVENKCNKAWPENNFINKEHSINIPFLGKWRINFFRLVWRTA  381

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T  VA+IFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q K+ KYS +W  LK+L  
Sbjct  382  YVILTTFVAVIFPFFNSILGLIGATAFWPLTVYFPVEMHISQRKVKKYSMKWNALKLLIS  441

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VSL+AA GSI GL   VK YKPF +
Sbjct  442  VCLIVSLLAAIGSIVGLINSVKAYKPFHS  470



>ref|XP_009397328.1| PREDICTED: amino acid permease 6 [Musa acuminata subsp. malaccensis]
Length=481

 Score =   299 bits (766),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKA+ +GV TTT FY+LCG LGYAAFGN APGNFLTGFGFY+PFWL+D  N+C
Sbjct  272  PPENQVMKKATTIGVLTTTTFYMLCGVLGYAAFGNTAPGNFLTGFGFYDPFWLVDIGNIC  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGA+QVF QP+F F+E+    RWPD++F+T E+ +N+P  G C  + FR++WR+ 
Sbjct  332  IVVHLIGAFQVFAQPIFQFIETWSRNRWPDNRFVTTEHVINIPLLGDCPFSLFRMIWRSL  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+TAVVAMIFPFFNDFLGLIGA SF+PLTVYFP+EM+I Q KI ++S  W WLKILS 
Sbjct  392  FVIITAVVAMIFPFFNDFLGLIGAVSFWPLTVYFPVEMYIVQAKIRRFSATWTWLKILSI  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSLVAA GS+QGL   ++ YKPFK
Sbjct  452  VCLIVSLVAACGSVQGLIHSLQDYKPFK  479



>emb|CDY57931.1| BnaA06g38000D [Brassica napus]
Length=466

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/209 (65%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKA+  GV+TTT+FY+LCGC+GYAAFGN APG+FLT FGFYEP+WLI+FAN C
Sbjct  258  PPENKVMKKATLAGVSTTTVFYILCGCMGYAAFGNRAPGDFLTDFGFYEPYWLINFANAC  317

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLI AYQVF QP+F  VE++C++ WP++ FI  E+ +N+   G   INFFRLVWRT 
Sbjct  318  IVLHLIAAYQVFAQPIFQLVENKCNKAWPENNFIHKEHSINILFLGKWRINFFRLVWRTA  377

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T  VA+IFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q K+ KYS +W  LK+L  
Sbjct  378  YVILTTFVAVIFPFFNSILGLIGATAFWPLTVYFPVEMHISQRKVKKYSMKWNALKLLIS  437

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VSL+AA GSI GL   VK YKPF +
Sbjct  438  VCLIVSLLAAIGSIVGLINSVKAYKPFHS  466



>ref|XP_010243490.1| PREDICTED: amino acid permease 6-like [Nelumbo nucifera]
Length=462

 Score =   298 bits (763),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKA+ +GV+T    Y++CG +GYAAFGN+APGNFLTGFGFYEPFWLIDFAN+C
Sbjct  254  PPENKVMKKATSIGVSTIAFLYIVCGGVGYAAFGNDAPGNFLTGFGFYEPFWLIDFANLC  313

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVF QPLF  VE+ C   WP++ FIT E+ V +P +G   INFF++VWRT 
Sbjct  314  IAVHLVGAYQVFAQPLFRIVENWCITHWPENGFITPEHAVKIPLYGKYHINFFQVVWRTV  373

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+ T V+AMIFPFFND LGL+GA S++PLTVY PIEM+I +++IP++SF W WLK+LS+
Sbjct  374  YVVSTTVIAMIFPFFNDILGLVGAISYWPLTVYLPIEMYIVRSRIPRFSFTWTWLKVLSF  433

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            TCL+V++VAA GS+QGL   VKTYK FK
Sbjct  434  TCLLVAVVAAVGSVQGLAAGVKTYKLFK  461



>ref|XP_010475860.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=469

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+ LT FGFY+P+WL+DFAN C
Sbjct  259  PPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLLTEFGFYDPYWLVDFANAC  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+ AYQVF QP+F FVE +C+++WP+SKFIT+E+ +++P  G C IN FRL+WRT 
Sbjct  319  IVLHLVAAYQVFAQPIFQFVEKKCNKKWPESKFITSEHSMSIPLIGKCRINLFRLLWRTA  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGLIG+ +F+PLTVYFP+ MHIAQTK+ KYS RW+ L++L  
Sbjct  379  YVILTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIAQTKVKKYSLRWMGLELLVL  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AA GSI GL   VK YKPF+
Sbjct  439  LCLIVSLLAALGSIVGLISSVKAYKPFR  466



>dbj|BAJ85485.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 167/211 (79%), Gaps = 3/211 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN VMKKAS +GV+TTT FY+LCG LGYAAFG++APGNFLTGFGFYEPFWL+D  NVC
Sbjct  271  PAENTVMKKASLIGVSTTTTFYMLCGVLGYAAFGSSAPGNFLTGFGFYEPFWLVDVGNVC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCF---GTCSINFFRLVW  379
            I +HL+GAYQVFCQP + FVE     RWPDS F+ AE  V +P     G   ++ FRLVW
Sbjct  331  IVVHLVGAYQVFCQPFYQFVEGWARSRWPDSAFLHAERVVQLPAIVGGGEFPVSPFRLVW  390

Query  378  RTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKI  199
            RT YV +TAVVAM+FPFFNDFLGLIGA SF+PLTVYFP+EM++AQ K+ ++S  W W+ +
Sbjct  391  RTAYVALTAVVAMLFPFFNDFLGLIGAVSFWPLTVYFPVEMYMAQAKVRRFSPTWTWMNV  450

Query  198  LSWTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            LS  CLVVS++AAAGS+QGL  DV  YKPFK
Sbjct  451  LSIACLVVSVLAAAGSVQGLVKDVAGYKPFK  481



>gb|KEH43996.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=472

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKK+S +G+T +T+FY LCG LGY AFGN APGNFLTGFGFYEP+WL+D  N+ 
Sbjct  263  PPENQVMKKSSLIGITISTIFYSLCGLLGYGAFGNKAPGNFLTGFGFYEPYWLVDIGNLF  322

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QP+FS VES  S+RWP SK IT EY+V +P  GT  +N FR++WRT 
Sbjct  323  IIIHLVGAYQVFAQPIFSIVESWVSKRWPQSKLITQEYDVRIPLVGTWRMNMFRVIWRTL  382

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T ++AMIFPFFN+ +GL+GA SF+PLTVYFPIEM++ Q ++PKYS  WI +K+LS 
Sbjct  383  YVIITTLIAMIFPFFNNIVGLLGAMSFFPLTVYFPIEMYLKQARVPKYSCIWIRMKLLSG  442

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+V+LV    SIQG+   +KTYKPFK+ 
Sbjct  443  FCLIVTLVGVVASIQGIIVGLKTYKPFKSN  472



>ref|XP_010095743.1| hypothetical protein L484_003355 [Morus notabilis]
 gb|EXB62126.1| hypothetical protein L484_003355 [Morus notabilis]
Length=488

 Score =   297 bits (760),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKA+ VGV  TT FY+LCG LGY AFGN+APGNFL GFG++EP W++DFAN C
Sbjct  278  PPENVVMKKATAVGVFVTTAFYMLCGILGYIAFGNDAPGNFLAGFGYFEPAWIVDFANAC  337

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVF QP++  +E    ++WP+S F+  EY + +PC GTC+ N FR VWRT 
Sbjct  338  IVVHLLGAYQVFAQPVYRKMEDWSKEKWPESDFVVKEYSIGIPCLGTCNFNGFRAVWRTL  397

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T  +A+I PFFND LGL+GA  F+PLTVYFP+EMHIAQ KIPKYS RW+ L +LS 
Sbjct  398  YVILTCTLAIILPFFNDILGLLGAFVFWPLTVYFPLEMHIAQNKIPKYSRRWVGLNLLSG  457

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +CL+VSL+AA GSIQG+   +KTY+PFK+
Sbjct  458  SCLIVSLLAAGGSIQGIITALKTYRPFKS  486



>ref|XP_003557617.1| PREDICTED: amino acid permease 6 [Brachypodium distachyon]
Length=473

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/210 (66%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENKVMKKAS +GV+TTT FY+LCG LGYAAFG+ APGNFLTGFGFYEPFWL+D  N C
Sbjct  269  PAENKVMKKASLIGVSTTTTFYMLCGVLGYAAFGSGAPGNFLTGFGFYEPFWLVDIGNAC  328

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP++ FVES    RWPDS F+ AE+       G   ++ FRL WRT 
Sbjct  329  IVVHLVGAYQVFCQPIYQFVESWARARWPDSAFLHAEFP-----LGPVHVSPFRLTWRTA  383

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV +TAVVAM+FPFFNDFLGLIGA SF+PLTVYFP+EM++AQ K+ ++S  W W+ +LS 
Sbjct  384  YVALTAVVAMLFPFFNDFLGLIGAVSFWPLTVYFPVEMYMAQAKVRRFSPTWTWMNVLSA  443

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVSL+AAAGS+QGL   V  YKPFKA 
Sbjct  444  ACLVVSLLAAAGSVQGLIKAVSGYKPFKAS  473



>ref|XP_010490547.1| PREDICTED: amino acid permease 8-like isoform X1 [Camelina sativa]
 ref|XP_010490556.1| PREDICTED: amino acid permease 8-like isoform X1 [Camelina sativa]
Length=467

 Score =   295 bits (756),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+ LT FGFYEP+WL+DFAN C
Sbjct  259  PPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLLTEFGFYEPYWLVDFANAC  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+ AYQVF QP+F FVE +C+++WP+SKFI +E+ +++P  G C IN FRL+WRT 
Sbjct  319  IVLHLVAAYQVFAQPIFQFVEKKCNKKWPESKFIISEHSMSIPLIGKCRINLFRLLWRTA  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++T VVAMIFPFFN  LGLIG+ +F+PLTVYFP+ MHIAQTK+ KYS RWI L++L  
Sbjct  379  YVVLTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIAQTKVTKYSLRWIGLELLVL  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL+AA GSI GL   VK YKPF 
Sbjct  439  LCLIVSLLAALGSIVGLISSVKAYKPFS  466



>gb|EYU39082.1| hypothetical protein MIMGU_mgv1a020135mg [Erythranthe guttata]
Length=466

 Score =   293 bits (751),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 171/208 (82%), Gaps = 4/208 (2%)
 Frame = -1

Query  726  PENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCI  547
             EN+ MK A+  G++ +T+FY+LCG LGYAAFGN+APGNFLTGFGFYEPFWL+  AN+ I
Sbjct  261  SENRTMKNATLAGISISTIFYMLCGVLGYAAFGNDAPGNFLTGFGFYEPFWLVGLANLFI  320

Query  546  AIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGY  367
             IHL+GAYQV+CQP F+FVE    ++WP+SKF+T EY +    +G   +N FRLVWR+ +
Sbjct  321  VIHLVGAYQVYCQPTFAFVEELGRKKWPESKFVTREYSI----YGRFDLNLFRLVWRSSF  376

Query  366  VIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWT  187
            VI+T VVAM+FPFFNDF+GL+GAASF+PLTVYFPIEM+IA+ KIP++SF WIW++ILS  
Sbjct  377  VILTTVVAMLFPFFNDFMGLLGAASFWPLTVYFPIEMYIARAKIPRFSFTWIWMQILSGI  436

Query  186  CLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            CLV+SL+AAAG+IQGL   + T+KPF +
Sbjct  437  CLVISLLAAAGAIQGLIKSLGTFKPFHS  464



>ref|XP_007042690.1| Amino acid permease 1 [Theobroma cacao]
 gb|EOX98521.1| Amino acid permease 1 [Theobroma cacao]
Length=479

 Score =   293 bits (750),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 164/209 (78%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+ MKKA+ VG++ TT+FY+LCG LGYAA GN APGNFLTGFGFYEP+WLID ANVC
Sbjct  269  PPENEAMKKATSVGISITTVFYMLCGVLGYAALGNKAPGNFLTGFGFYEPYWLIDVANVC  328

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F  VE  CS RWP++ FI     +++P FG    + FRLVWRT 
Sbjct  329  IIVHLVGAYQVFCQPIFKCVEDWCSNRWPNNSFIKEGRPISLPIFGVYHFSAFRLVWRTA  388

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T  VAMIFPFFND LGL+G ASF PLTVYFPI+MHIA+ KI  +S +WIWL +L  
Sbjct  389  YVIMTTTVAMIFPFFNDVLGLLGGASFLPLTVYFPIQMHIAREKIQPWSCKWIWLNVLVL  448

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             C V+SL AAAGSI+G+  D++ +KPF +
Sbjct  449  LCSVISLPAAAGSIEGIVKDLRNFKPFTS  477



>ref|XP_011002369.1| PREDICTED: amino acid permease 6-like [Populus euphratica]
Length=473

 Score =   293 bits (749),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  726  PENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCI  547
            PEN+VMKKAS VGV TTT+FY+LCG LGYAAFGN APGNFLTGFGFYEP+WL+DFAN+CI
Sbjct  264  PENQVMKKASLVGVATTTVFYMLCGTLGYAAFGNVAPGNFLTGFGFYEPYWLVDFANLCI  323

Query  546  AIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGY  367
             IHL+GAYQV+CQP+F  VE  C ++WP+S FIT E+ V++  +G   +N FRL+WRT Y
Sbjct  324  VIHLVGAYQVYCQPIFKLVEDSCRKKWPESGFITNEHPVDILFYGVFHVNSFRLLWRTAY  383

Query  366  VIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWT  187
            VI ++V+AM FPFFN  LG IGA SF+PLT+YFP++M+I+Q +I +++F W WL IL+ +
Sbjct  384  VIASSVMAMTFPFFNSVLGFIGAISFWPLTLYFPVQMYISQARIRRFTFTWTWLTILTVS  443

Query  186  CLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            CL+VSL AAA  +QGL  ++ +++PFK+
Sbjct  444  CLIVSLAAAAACVQGLIVELHSFQPFKS  471



>ref|XP_010458324.1| PREDICTED: amino acid permease 8-like [Camelina sativa]
Length=394

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 170/207 (82%), Gaps = 0/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS  GV+TTT FY+LCGC+GYAAFGN APG+ LT FGFYEP+WL+DFAN C
Sbjct  188  PPENKVMKKASLAGVSTTTAFYILCGCMGYAAFGNKAPGDLLTEFGFYEPYWLVDFANAC  247

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+ AYQVF QP+F FVE +C+++WP+SKFIT+E+ +++P  G C IN FRL+WRT 
Sbjct  248  IVLHLVAAYQVFAQPIFQFVEKKCNKKWPESKFITSEHSMSIPLIGKCRINLFRLLWRTT  307

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T VVAMIFPFFN  LGLIG+ +F+PLTVYFP+ MHIAQTK+ KYS +WI L++L  
Sbjct  308  YVILTTVVAMIFPFFNAILGLIGSCAFWPLTVYFPVAMHIAQTKVKKYSPKWIGLELLVL  367

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CL+VSL+AA GSI GL   VK YK F
Sbjct  368  LCLIVSLLAALGSIVGLISSVKAYKAF  394



>ref|XP_006657428.1| PREDICTED: amino acid permease 6-like [Oryza brachyantha]
Length=484

 Score =   293 bits (749),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 167/209 (80%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN+VMKKAS +GV+TTT FY+LCG LGYAAFGN APGNFLTGFGFYEPFWL+D  NVC
Sbjct  273  PAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGFGFYEPFWLVDVGNVC  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPC-FGTCSINFFRLVWRT  373
            I +HL+GAYQVFCQP++ FVE     RWPDS F+ AE  + +P   G   ++ FRL+WRT
Sbjct  333  IVVHLVGAYQVFCQPIYQFVEGWAHSRWPDSGFLNAERVLRLPLGAGDFPVSPFRLLWRT  392

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YV++TAVVAM FPFFNDFLGLIGA SF+PLTVYFP++M+++Q K+ ++S  W W+ +LS
Sbjct  393  LYVVLTAVVAMAFPFFNDFLGLIGAVSFWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLS  452

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            + CLVVSL+AAAGSIQGL   V  YKPF 
Sbjct  453  FACLVVSLLAAAGSIQGLIKSVAHYKPFS  481



>ref|XP_002313926.2| hypothetical protein POPTR_0009s08840g [Populus trichocarpa]
 gb|EEE87881.2| hypothetical protein POPTR_0009s08840g [Populus trichocarpa]
Length=473

 Score =   292 bits (748),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/209 (62%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKAS VGV TTT+FY+LCG LGYAAFGN APGNFLTGFGFYEP+WL+DFAN+C
Sbjct  263  PPENQVMKKASLVGVATTTVFYMLCGTLGYAAFGNVAPGNFLTGFGFYEPYWLVDFANLC  322

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+ QP+F  VE  C ++WP+S FIT E+ V++P  G   +N FRL+WRT 
Sbjct  323  IVIHLVGAYQVYGQPIFKLVEDSCRKKWPESGFITNEHPVDIPFCGVFHVNSFRLLWRTA  382

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI ++V+AM FPFFN  LG IGA SF+PLT+YFP++M+I+Q +I +++F W WL IL+ 
Sbjct  383  YVIASSVIAMTFPFFNSVLGFIGAISFWPLTLYFPVQMYISQARIRRFTFTWTWLTILTV  442

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VSL AAA  +QGL   ++ ++PFK+
Sbjct  443  ACLIVSLAAAAACVQGLIMQLRNFEPFKS  471



>gb|KHN39882.1| Amino acid permease 2 [Glycine soja]
Length=450

 Score =   290 bits (743),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K M+KA+ + +  TT+FY+LCGC+GYAAFG+NAPGN LTGFGFY P+WL+D AN+ 
Sbjct  240  PAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFYNPYWLLDIANLA  299

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QPLF+FVE   +++WP S F+TAEY++ +PCFG   +NFFRLVWRT 
Sbjct  300  IVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPCFGVYQLNFFRLVWRTI  359

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFPI+M+I+Q KI +++ RW+ L++LS 
Sbjct  360  FVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWLGLQLLSA  419

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL++SL+AA GS+ G+  D+KTYKPFK
Sbjct  420  SCLIISLLAAVGSMAGVVLDLKTYKPFK  447



>dbj|BAC82953.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAD30613.1| putative amino acid permease [Oryza sativa Japonica Group]
Length=460

 Score =   290 bits (743),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN+VMKKAS +GV+TTT FY+LCG LGYAAFGN APGNFLTGFGFYEPFWL+D  NVC
Sbjct  249  PAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGFGFYEPFWLVDVGNVC  308

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPC-FGTCSINFFRLVWRT  373
            I +HL+GAYQVFCQP++ F E+    RWPDS F+  E  + +P   G   ++  RLVWRT
Sbjct  309  IVVHLVGAYQVFCQPIYQFAEAWARSRWPDSAFVNGERVLRLPLGAGDFPVSALRLVWRT  368

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YV++TAV AM FPFFNDFLGLIGA SF+PLTVYFP++M+++Q K+ ++S  W W+ +LS
Sbjct  369  AYVVLTAVAAMAFPFFNDFLGLIGAVSFWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLS  428

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
              CLVVSL+AAAGSIQGL   V  YKPF 
Sbjct  429  LACLVVSLLAAAGSIQGLIKSVAHYKPFS  457



>gb|EEE66520.1| hypothetical protein OsJ_22995 [Oryza sativa Japonica Group]
Length=485

 Score =   291 bits (745),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN+VMKKAS +GV+TTT FY+LCG LGYAAFGN APGNFLTGFGFYEPFWL+D  NVC
Sbjct  274  PAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGFGFYEPFWLVDVGNVC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPC-FGTCSINFFRLVWRT  373
            I +HL+GAYQVFCQP++ F E+    RWPDS F+  E  + +P   G   ++  RLVWRT
Sbjct  334  IVVHLVGAYQVFCQPIYQFAEAWARSRWPDSAFVNGERVLRLPLGAGDFPVSALRLVWRT  393

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YV++TAV AM FPFFNDFLGLIGA SF+PLTVYFP++M+++Q K+ ++S  W W+ +LS
Sbjct  394  AYVVLTAVAAMAFPFFNDFLGLIGAVSFWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLS  453

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
              CLVVSL+AAAGSIQGL   V  YKPF 
Sbjct  454  LACLVVSLLAAAGSIQGLIKSVAHYKPFS  482



>ref|XP_010943299.1| PREDICTED: amino acid permease 6 [Elaeis guineensis]
Length=473

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKAS +GV+ TT+FY+LCG LGYAAFGN+APGNFLTGFGFYEPFWL+D  N+C
Sbjct  264  PPENQVMKKASNIGVSITTVFYMLCGVLGYAAFGNDAPGNFLTGFGFYEPFWLVDVGNIC  323

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            +AIHLIGAYQVF QP+F  VE+    RW     +T E+ V++P  G    +FFRL+WR  
Sbjct  324  VAIHLIGAYQVFTQPVFQVVENWWHGRWSRRHLLTIEHVVSIPFLGDYPFSFFRLIWRIL  383

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T V+AMIFPFFNDF+GLIGA S++PLTVYFPIEM IAQ KI ++S  W WLK+LS+
Sbjct  384  YVILTTVIAMIFPFFNDFVGLIGAVSYWPLTVYFPIEMFIAQAKIGRFSATWTWLKVLSF  443

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+V+L+   GS+QGL   V+ YKPFK+
Sbjct  444  GCLLVALLGTCGSLQGLIHSVRGYKPFKS  472



>gb|KCW68582.1| hypothetical protein EUGRSUZ_F02192 [Eucalyptus grandis]
Length=466

 Score =   290 bits (743),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 165/208 (79%), Gaps = 19/208 (9%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMK+AS +G++TTT+                   +FLTGFGFYEPFW+IDFAN C
Sbjct  266  PPENKVMKRASLIGISTTTM-------------------DFLTGFGFYEPFWVIDFANAC  306

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HLIGAYQVF QP+F FVES CS+RWP++ FIT E  V+VP +G   IN FRL+WRT 
Sbjct  307  IAVHLIGAYQVFSQPIFGFVESWCSKRWPNNTFITREIPVDVPWYGIYHINLFRLIWRTV  366

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVIVTAV+AMI PFFNDFLGLIGAASF+PLTVYFP+EM+IA+T + K+SF W WLKIL+W
Sbjct  367  YVIVTAVIAMILPFFNDFLGLIGAASFWPLTVYFPVEMYIARTNMRKFSFTWAWLKILNW  426

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLVVSLVAAAGS+QGL   +KTYKPFK
Sbjct  427  ACLVVSLVAAAGSVQGLIQSLKTYKPFK  454



>gb|EEC81471.1| hypothetical protein OsI_24794 [Oryza sativa Indica Group]
Length=485

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN+VMKKAS +GV+TTT FY+LCG LGYAAFGN APGNFLTGFGFYEPFWL+D  NVC
Sbjct  274  PAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGFGFYEPFWLVDVGNVC  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPC-FGTCSINFFRLVWRT  373
            I +HL+GAYQVFCQP++ F E+    RWPDS F+  E  + +P   G   ++  RLVWRT
Sbjct  334  IVVHLVGAYQVFCQPIYQFAEAWARSRWPDSAFVNGERVLRLPLGAGDFPVSALRLVWRT  393

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YV++TAV AM FPFFNDFLGLIGA SF+PLTVYFP++M+++Q K+ ++S  W W+ +LS
Sbjct  394  AYVVLTAVAAMAFPFFNDFLGLIGAVSFWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLS  453

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
              CLVVSL+AAAGSIQGL   V  YKPF 
Sbjct  454  LACLVVSLLAAAGSIQGLIKSVAHYKPFS  482



>ref|NP_001058839.1| Os07g0134000 [Oryza sativa Japonica Group]
 dbj|BAC82952.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAD30612.1| putative amino acid permease [Oryza sativa Japonica Group]
 dbj|BAF20753.1| Os07g0134000 [Oryza sativa Japonica Group]
 dbj|BAG97575.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99938.1| unnamed protein product [Oryza sativa Japonica Group]
Length=487

 Score =   291 bits (744),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 163/209 (78%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P EN+VMKKAS +GV+TTT FY+LCG LGYAAFGN APGNFLTGFGFYEPFWL+D  NVC
Sbjct  276  PAENEVMKKASFIGVSTTTTFYMLCGVLGYAAFGNRAPGNFLTGFGFYEPFWLVDVGNVC  335

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPC-FGTCSINFFRLVWRT  373
            I +HL+GAYQVFCQP++ F E+    RWPDS F+  E  + +P   G   ++  RLVWRT
Sbjct  336  IVVHLVGAYQVFCQPIYQFAEAWARSRWPDSAFVNGERVLRLPLGAGDFPVSALRLVWRT  395

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YV++TAV AM FPFFNDFLGLIGA SF+PLTVYFP++M+++Q K+ ++S  W W+ +LS
Sbjct  396  AYVVLTAVAAMAFPFFNDFLGLIGAVSFWPLTVYFPVQMYMSQAKVRRFSPTWTWMNVLS  455

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
              CLVVSL+AAAGSIQGL   V  YKPF 
Sbjct  456  LACLVVSLLAAAGSIQGLIKSVAHYKPFS  484



>gb|EMS56484.1| hypothetical protein TRIUR3_26560 [Triticum urartu]
Length=737

 Score =   297 bits (761),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/211 (66%), Positives = 169/211 (80%), Gaps = 3/211 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENKVMKKAS +GV+TTT FY+LCG LGYAAFG++APGNFLTGFGFYEPFWL+D  NVC
Sbjct  525  PAENKVMKKASLIGVSTTTTFYMLCGVLGYAAFGSSAPGNFLTGFGFYEPFWLVDIGNVC  584

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCF---GTCSINFFRLVW  379
            I +HL+GAYQVFCQP++ FVE     RWPDS F+ AE  + +P     G   ++  RLVW
Sbjct  585  IIVHLVGAYQVFCQPIYQFVEGWARSRWPDSAFLHAERVLRLPAVLGGGEFPVSPLRLVW  644

Query  378  RTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKI  199
            RT YV++TAVVAM+FPFFNDFLGLIGA SF+PLTVYFP+EM++AQ K+ ++S  W W+ +
Sbjct  645  RTAYVVLTAVVAMLFPFFNDFLGLIGAVSFWPLTVYFPVEMYMAQAKVRRFSPTWTWMNV  704

Query  198  LSWTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            LS  CLVVS++AAAGS+QGL  DV  YKPFK
Sbjct  705  LSVACLVVSVLAAAGSVQGLIKDVAGYKPFK  735



>gb|KJB79478.1| hypothetical protein B456_013G052100 [Gossypium raimondii]
Length=462

 Score =   290 bits (741),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+ MKKA+ VGV+ TT+FYV CG LGYAAFGNNAPGNFLTGFGFYEP+WLID ANV 
Sbjct  252  PPENESMKKATLVGVSVTTVFYVSCGALGYAAFGNNAPGNFLTGFGFYEPYWLIDMANVF  311

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGAYQVFCQP+F  VE RC  RWP+S FI     + +P FG  S + FR+VWRTG
Sbjct  312  IIVHLIGAYQVFCQPIFKQVEDRCFNRWPNSSFIKESPPIKLPLFGVYSFSVFRVVWRTG  371

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T V+AM+ PFFN  LGL+GAASF+PLTVYFPI+MHI++ +I  +S++WIWL  L  
Sbjct  372  YVILTIVLAMLLPFFNAILGLLGAASFWPLTVYFPIQMHISREQIRAFSWKWIWLNFLVL  431

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VS++AAAGSI  +  D+ TY+PF +
Sbjct  432  LCLIVSVLAAAGSIATIVKDLSTYEPFNS  460



>ref|XP_008801682.1| PREDICTED: amino acid permease 6 [Phoenix dactylifera]
Length=480

 Score =   290 bits (742),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKAS +GV+ TT+FY LCG LGYAAFGN+APGNFLTGFGFYEPFWL+D  N+C
Sbjct  271  PPENQVMKKASNIGVSITTVFYALCGVLGYAAFGNDAPGNFLTGFGFYEPFWLVDVGNIC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            + IHLIGAYQVF QP+F  VE+    RW    F+T E+ V++P  G    +F RL+WRT 
Sbjct  331  VTIHLIGAYQVFAQPVFQVVENWWHSRWTGKHFLTIEHVVSIPLLGDYPFSFLRLIWRTL  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T V+AMIFPFFN+F+GLIGA S++PLTVYFPIEM IAQ KI ++S  W WLK+LS 
Sbjct  391  YVILTTVIAMIFPFFNEFIGLIGAISYWPLTVYFPIEMFIAQAKIGRFSAAWTWLKVLSI  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+V+L+   GSIQGL   +K YKPFK
Sbjct  451  GCLLVALLGGCGSIQGLIHSIKGYKPFK  478



>gb|EYU39084.1| hypothetical protein MIMGU_mgv1a018317mg [Erythranthe guttata]
Length=466

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 168/208 (81%), Gaps = 5/208 (2%)
 Frame = -1

Query  726  PENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVCI  547
            PENKVMKKA+  G++ +T+FY+LCG LGYAAFGN+APGNFLTGFGFYEPFWL+ FAN+CI
Sbjct  262  PENKVMKKATLAGISISTVFYMLCGVLGYAAFGNDAPGNFLTGFGFYEPFWLVSFANLCI  321

Query  546  AIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTGY  367
             IHL+GAYQVFCQP+F FVE     +WP++KFIT EY +         +NF RLVWRT Y
Sbjct  322  VIHLVGAYQVFCQPIFGFVEDWSKGKWPENKFITEEYSI-----WGFKVNFLRLVWRTCY  376

Query  366  VIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSWT  187
            VI T  +AM+FPFFNDF+G +GA +F+PLTVYFPIEM+IA+ KIP++SF WIW++IL+  
Sbjct  377  VIFTTALAMLFPFFNDFVGFLGAITFWPLTVYFPIEMYIARRKIPRFSFTWIWMEILNGI  436

Query  186  CLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            CLV+SL+AAAGSI GL   ++ +KPF +
Sbjct  437  CLVISLLAAAGSIHGLVKSLRLFKPFHS  464



>gb|AAK33098.1| amino acid transporter [Glycine max]
Length=513

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K M+KA+ + +  TT+FY+LCGC+GYAAFG+NAPGN LTGFGFY P+WL+D AN+ 
Sbjct  303  PAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFYNPYWLLDIANLA  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QPLF+FVE   +++WP S F+TAEY++ +PCFG   +NFFRLVWRT 
Sbjct  363  IVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPCFGVYQLNFFRLVWRTI  422

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFPI+M+I+Q KI +++ RW+ L++LS 
Sbjct  423  FVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWLGLQLLSA  482

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL++SL+AA GS+ G+  D+KTYKPFK
Sbjct  483  SCLIISLLAAVGSMAGVVLDLKTYKPFK  510



>ref|XP_006590854.1| PREDICTED: amino acid permease 2-like [Glycine max]
Length=513

 Score =   290 bits (743),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K M+KA+ + +  TT+FY+LCGC+GYAAFG+NAPGN LTGFGFY P+WL+D AN+ 
Sbjct  303  PAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFYNPYWLLDIANLA  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QPLF+FVE   +++WP S F+TAEY++ +PCFG   +NFFRLVWRT 
Sbjct  363  IVIHLVGAYQVFSQPLFAFVEKWSARKWPKSNFVTAEYDIPIPCFGVYQLNFFRLVWRTI  422

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFPI+M+I+Q KI +++ RW+ L++LS 
Sbjct  423  FVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWLGLQLLSA  482

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL++SL+AA GS+ G+  D+KTYKPFK
Sbjct  483  SCLIISLLAAVGSMAGVVLDLKTYKPFK  510



>ref|NP_001136620.1| uncharacterized protein LOC100216745 [Zea mays]
 gb|ACF82283.1| unknown [Zea mays]
Length=483

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKAS +GV+TTT FY+LCG LGYAAFG++APGNFLTGFGFY+PFWLID  NVC
Sbjct  275  PPENVVMKKASFIGVSTTTAFYMLCGVLGYAAFGSDAPGNFLTGFGFYDPFWLIDVGNVC  334

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP++ FVE+    RWPD  F+ AE  V      T S   FRLVWRT 
Sbjct  335  IAVHLVGAYQVFCQPIYQFVEAWARGRWPDCAFLHAELAVVAGSSFTASP--FRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA+VA +FPFFNDFLGLIGA SF+PLTVYFPI+M++AQ K  ++S  W W+ +LS+
Sbjct  393  YVVLTALVATVFPFFNDFLGLIGAVSFWPLTVYFPIQMYMAQAKTRRFSPAWTWMNVLSY  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CL VSL+AAAGS+QGL  D+K YKP 
Sbjct  453  ACLFVSLLAAAGSVQGLVKDLKGYKPL  479



>ref|XP_003540867.1| PREDICTED: amino acid permease 2 [Glycine max]
Length=513

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K M+KA+ + +  TT+FY+LCGC+GYAAFG+NAPGN LTGFGFY P+WL+D AN+ 
Sbjct  303  PAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFYNPYWLLDIANLA  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QPLF+FVE    ++WP S F+TAEY++ +PCFG   +NFFRLVWRT 
Sbjct  363  IVIHLVGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIPCFGVYQLNFFRLVWRTI  422

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFPI+M+I+Q KI +++ RWI L++LS 
Sbjct  423  FVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWIGLQLLSV  482

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL++SL+AA GS+ G+  D+KTYKPFK
Sbjct  483  SCLIISLLAAVGSMAGVVLDLKTYKPFK  510



>gb|KHN25477.1| Amino acid permease 2 [Glycine soja]
Length=513

 Score =   290 bits (741),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K M+KA+ + +  TT+FY+LCGC+GYAAFG+NAPGN LTGFGFY P+WL+D AN+ 
Sbjct  303  PAEHKTMRKATTLSIAVTTVFYLLCGCMGYAAFGDNAPGNLLTGFGFYNPYWLLDIANLA  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QPLF+FVE    ++WP S F+TAEY++ +PCFG   +NFFRLVWRT 
Sbjct  363  IVIHLVGAYQVFSQPLFAFVEKWSVRKWPKSNFVTAEYDIPIPCFGVYQLNFFRLVWRTI  422

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFPI+M+I+Q KI +++ RWI L++LS 
Sbjct  423  FVLLTTLIAMLMPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTSRWIGLQLLSV  482

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL++SL+AA GS+ G+  D+KTYKPFK
Sbjct  483  SCLIISLLAAVGSMAGVVLDLKTYKPFK  510



>tpg|DAA59488.1| TPA: hypothetical protein ZEAMMB73_156584 [Zea mays]
Length=483

 Score =   288 bits (738),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKAS +GV+TTT FY+LCG LGYAAFG++APGNFLTGFGFY+PFWLID  NVC
Sbjct  275  PPENVVMKKASFIGVSTTTAFYMLCGVLGYAAFGSDAPGNFLTGFGFYDPFWLIDVGNVC  334

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IA+HL+GAYQVFCQP++ FVE+    RWPD  F+ AE  V      T S   FRLVWRT 
Sbjct  335  IAVHLVGAYQVFCQPIYQFVEAWARGRWPDCAFLHAELAVVAGSSFTASP--FRLVWRTA  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV++TA+VA +FPFFNDFLGLIGA SF+PLTVYFPI+M++AQ K  ++S  W W+ +LS+
Sbjct  393  YVVLTALVATVFPFFNDFLGLIGAVSFWPLTVYFPIQMYMAQAKTRRFSPAWTWMNVLSY  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CL VSL+AAAGS+QGL  D+K YKP 
Sbjct  453  ACLFVSLLAAAGSVQGLVKDLKGYKPL  479



>ref|XP_007213109.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
 gb|EMJ14308.1| hypothetical protein PRUPE_ppa023539mg [Prunus persica]
Length=480

 Score =   288 bits (736),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  270  PSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAA  329

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE   +QRWP+SK IT E++V VP   +  +N FRLVWRT 
Sbjct  330  IVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLNLFRLVWRTK  389

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IPK+S RWI L++LS 
Sbjct  390  FVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSI  449

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVAAAGSI G+  D+K Y+PFK
Sbjct  450  ACLVISLVAAAGSIAGVMLDLKVYRPFK  477



>ref|XP_008227520.1| PREDICTED: amino acid permease 4 isoform X3 [Prunus mume]
Length=481

 Score =   288 bits (736),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  271  PSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAA  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE   +QRWP+SK IT E++V VP   +  +N FRLVWRT 
Sbjct  331  IVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLNLFRLVWRTK  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IPK+S RWI L++LS 
Sbjct  391  FVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSI  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVAAAGSI G+  D+K Y+PFK
Sbjct  451  ACLVISLVAAAGSIAGVMLDLKVYRPFK  478



>ref|XP_008227519.1| PREDICTED: amino acid permease 4 isoform X2 [Prunus mume]
Length=482

 Score =   288 bits (736),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  272  PSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAA  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE   +QRWP+SK IT E++V VP   +  +N FRLVWRT 
Sbjct  332  IVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLNLFRLVWRTK  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IPK+S RWI L++LS 
Sbjct  392  FVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSI  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVAAAGSI G+  D+K Y+PFK
Sbjct  452  ACLVISLVAAAGSIAGVMLDLKVYRPFK  479



>ref|XP_008227518.1| PREDICTED: amino acid permease 4 isoform X1 [Prunus mume]
Length=480

 Score =   288 bits (736),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  270  PSEAKTMKKATVLSIAVTTTFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAA  329

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE   +QRWP+SK IT E++V VP   +  +N FRLVWRT 
Sbjct  330  IVVHLVGAYQVFCQPIFAFVEKWAAQRWPESKLITKEFQVPVPGLPSFKLNLFRLVWRTK  389

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IPK+S RWI L++LS 
Sbjct  390  FVMLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKQIPKWSTRWICLQMLSI  449

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVAAAGSI G+  D+K Y+PFK
Sbjct  450  ACLVISLVAAAGSIAGVMLDLKVYRPFK  477



>ref|XP_002522103.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF40303.1| amino acid transporter, putative [Ricinus communis]
Length=454

 Score =   286 bits (733),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 169/209 (81%), Gaps = 4/209 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKK+S VGVTTTT+FY+LCG LGYAAFG  APGN LTGFGFYEPFWL+D AN+C
Sbjct  248  PPENQVMKKSSLVGVTTTTIFYILCGTLGYAAFGEQAPGNLLTGFGFYEPFWLVDLANIC  307

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVFCQP+F  VE  C+++WP+S+F+T  Y    P  G   +NFFRL+WRTG
Sbjct  308  IVIHLVGAYQVFCQPIFKLVEDWCNKKWPESRFLTKGY----PIGGVFHVNFFRLLWRTG  363

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YV+VT+++AM FPFFN  LGL+GA SF+PLT+YFP+EM+I+Q KI ++SF WIWL ILS 
Sbjct  364  YVMVTSLLAMTFPFFNSVLGLLGALSFWPLTLYFPLEMYISQAKIARFSFTWIWLNILSM  423

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CLV SL+AAA SI+G+  D+  +KP  +
Sbjct  424  VCLVASLLAAAASIRGIIMDLSNFKPLHS  452



>ref|XP_011031114.1| PREDICTED: amino acid permease 4-like isoform X2 [Populus euphratica]
Length=493

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG  APGN LTGFGFY P+WLID ANV 
Sbjct  283  PAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYWLIDIANVA  342

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHLIGAYQVFCQPLF+F+E   +Q+WP++ FIT E+ + VP F   ++N FRLVWRT 
Sbjct  343  IVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPGFRPYNLNLFRLVWRTI  402

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KIPK+S RWI L++LS 
Sbjct  403  FVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSM  462

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVA AGSI G+  D+K YKPFK
Sbjct  463  ACLVISLVAVAGSIAGVVLDLKAYKPFK  490



>ref|XP_011031113.1| PREDICTED: amino acid permease 4-like isoform X1 [Populus euphratica]
Length=494

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG  APGN LTGFGFY P+WLID ANV 
Sbjct  284  PAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGEQAPGNLLTGFGFYNPYWLIDIANVA  343

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHLIGAYQVFCQPLF+F+E   +Q+WP++ FIT E+ + VP F   ++N FRLVWRT 
Sbjct  344  IVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFRIPVPGFRPYNLNLFRLVWRTI  403

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KIPK+S RWI L++LS 
Sbjct  404  FVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSM  463

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVA AGSI G+  D+K YKPFK
Sbjct  464  ACLVISLVAVAGSIAGVVLDLKAYKPFK  491



>ref|XP_006382883.1| amino acid permease AAP1 family protein [Populus trichocarpa]
 gb|ERP60680.1| amino acid permease AAP1 family protein [Populus trichocarpa]
Length=492

 Score =   287 bits (735),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY P+WLID ANV 
Sbjct  282  PAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYWLIDIANVA  341

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHLIGAYQVFCQPLF+F+E   +Q+WP++ FIT E+++ VP F    +N FR+VWRT 
Sbjct  342  IVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPGFRPYKLNLFRMVWRTI  401

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KIPK+S RWI L++LS 
Sbjct  402  FVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSM  461

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVA AGSI G+  D+K YKPFK
Sbjct  462  ACLVISLVAVAGSIAGVVLDLKVYKPFK  489



>ref|XP_002307053.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
 gb|EEE94049.2| hypothetical protein POPTR_0005s06990g [Populus trichocarpa]
Length=494

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY P+WLID ANV 
Sbjct  284  PAESKTMKKAAKISIVVTTTFYMLCGCMGYAAFGDQAPGNLLTGFGFYNPYWLIDIANVA  343

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHLIGAYQVFCQPLF+F+E   +Q+WP++ FIT E+++ VP F    +N FR+VWRT 
Sbjct  344  IVIHLIGAYQVFCQPLFAFIEKWANQKWPENYFITKEFKIPVPGFRPYKLNLFRMVWRTI  403

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KIPK+S RWI L++LS 
Sbjct  404  FVLLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSM  463

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVA AGSI G+  D+K YKPFK
Sbjct  464  ACLVISLVAVAGSIAGVVLDLKVYKPFK  491



>ref|XP_006380397.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
 gb|ERP58194.1| hypothetical protein POPTR_0007s04710g [Populus trichocarpa]
Length=492

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 164/210 (78%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY P+WLID AN  
Sbjct  282  PAESKTMKKAARISIVVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLIDIANAA  341

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVFCQPLF+F+E   +Q+WP+S FIT E+ + VP  G   +N FRLVWRT 
Sbjct  342  IVIHLVGAYQVFCQPLFAFIEKWANQKWPESYFITKEFNIAVPGLGLYKLNLFRLVWRTI  401

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KIPK+S RWI L++LS 
Sbjct  402  FVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQRKIPKWSTRWICLQMLSM  461

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+SLVA AGS+ G+  D+K YKPFK  
Sbjct  462  ACLVISLVAVAGSLAGVVLDLKAYKPFKTS  491



>gb|KEH43995.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=469

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKK+S VG+  TT FY LCG LGYAAFGN APGNFLTGFGFYEP+WL+D  N+ 
Sbjct  260  PPENQVMKKSSLVGIIITTFFYALCGLLGYAAFGNKAPGNFLTGFGFYEPYWLVDIGNLF  319

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QP+FS VE   S++WP SK +T EY+V +P  G   +N FRL WRT 
Sbjct  320  IIIHLVGAYQVFAQPIFSAVERLGSKQWPQSKLMTKEYDVRIPFVGIWRMNMFRLTWRTI  379

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T ++AMI PFFN+ +GL+GA SF+PLTVYFP EM++ Q ++PKYS  WI +K+LS 
Sbjct  380  YVIITTLIAMILPFFNNVVGLLGAISFFPLTVYFPTEMYLTQAQVPKYSTIWIGMKLLSG  439

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+V+LVAA GSI+G+  D+KTY PF 
Sbjct  440  FCLIVTLVAAVGSIEGIVSDLKTYHPFN  467



>ref|XP_010269036.1| PREDICTED: amino acid permease 3-like [Nelumbo nucifera]
Length=476

 Score =   286 bits (733),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   V  TTLFY+LCGC+GYAAFG+ APGN LTGFGFY PFW+ID AN  
Sbjct  266  PSEAKTMKKATLFSVFVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPFWVIDIANAA  325

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            + IHL+GAYQVFCQPLF+F+E   SQRWPDSKFIT E +V +P F    +N FRLVWR+ 
Sbjct  326  VVIHLVGAYQVFCQPLFAFIEKWASQRWPDSKFITNEIKVPIPGFCPYKLNLFRLVWRSA  385

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V+ T +++M+ PFFND +G++GA SF+PLTV+FP++M+IAQ KIP++S RW+ L+ILS+
Sbjct  386  FVVATTIISMLLPFFNDVVGILGAFSFWPLTVFFPVQMYIAQKKIPRWSTRWLSLQILSF  445

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+S+ AAAGSI G+  D+K YKPFK
Sbjct  446  ACLVISVAAAAGSIAGVILDLKVYKPFK  473



>ref|XP_009389175.1| PREDICTED: amino acid permease 4-like [Musa acuminata subsp. 
malaccensis]
Length=513

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 170/210 (81%), Gaps = 1/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK M+KA+ + +  TT+FY+LCGC+GYAAFG++APGN LTGFGFY P+WL+D AN+ 
Sbjct  302  PAENKTMRKATLLSIVVTTVFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLLDIANLA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFG-TCSINFFRLVWRT  373
            I +HL+GAYQVFCQPLF+FVE   ++RWP S+ IT EYE  +PC G T  +N FRLVWRT
Sbjct  362  IVVHLVGAYQVFCQPLFAFVEKWSAKRWPKSELITHEYEARIPCTGATYKLNLFRLVWRT  421

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             +V++T V++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI  +S RW+ L++LS
Sbjct  422  AFVVLTTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIRPWSSRWVGLQLLS  481

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +TCLVVSL AA GS+ G+  D+K+Y+PF++
Sbjct  482  FTCLVVSLAAACGSMAGVVLDLKSYRPFES  511



>ref|XP_011022870.1| PREDICTED: amino acid permease 4-like [Populus euphratica]
Length=493

 Score =   287 bits (734),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 164/208 (79%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY P+WLID AN  
Sbjct  283  PAESKTMKKAARISIVVTTTFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLIDIANAA  342

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVFCQPLF+F+E   +Q+WP S FIT E+ + VP +G   +N FRLVWRT 
Sbjct  343  IVIHLVGAYQVFCQPLFAFIEKWANQKWPGSYFITKEFNIAVPGYGLYKLNLFRLVWRTI  402

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KIPK+S RWI L++LS 
Sbjct  403  FVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIVQKKIPKWSTRWICLQMLSM  462

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+SLVA AGS+ G+  D+K YKPFK
Sbjct  463  ACLVISLVAVAGSVAGVVLDLKAYKPFK  490



>ref|XP_008788441.1| PREDICTED: amino acid permease 4-like [Phoenix dactylifera]
Length=514

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/210 (60%), Positives = 169/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKA+ V +  TT+FY+LCGC+GYAAFG++ PGN LTGFGFY P+WL+D AN+ 
Sbjct  303  PAENKTMKKATLVSIAVTTIFYLLCGCMGYAAFGDDVPGNLLTGFGFYNPYWLLDIANLA  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTC-SINFFRLVWRT  373
            I +HL+GAYQVFCQPLF+FVE   +QRW  S+FIT EYE ++P  G+   +N FRLVWRT
Sbjct  363  IVVHLVGAYQVFCQPLFAFVEKWSAQRWDKSEFITHEYEAHLPLVGSSYKLNLFRLVWRT  422

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             +V+VT +++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KI ++S RW+ L++LS
Sbjct  423  IFVVVTTLISMLMPFFNDVVGILGAIGFWPLTVYFPVEMYIVQKKIRRWSARWVGLRLLS  482

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +TCLVVSL AA GS+ G+  D+K+Y+PFK+
Sbjct  483  FTCLVVSLAAACGSVAGVVLDLKSYRPFKS  512



>emb|CDY53832.1| BnaA09g57240D [Brassica napus]
Length=1054

 Score =   298 bits (763),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 169/209 (81%), Gaps = 1/209 (0%)
 Frame = -1

Query  729   PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
             PPENKVMKKAS   V+TTT FY+LCGC+GYA FGN APG+FLT FGFYEP+WLIDFAN C
Sbjct  843   PPENKVMKKASLAAVSTTTAFYILCGCIGYATFGNQAPGDFLTDFGFYEPYWLIDFANAC  902

Query  549   IAIHLIGAYQ-VFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRT  373
             IA+HLIGAYQ VF QP+F FVE +C+Q WP+S FIT E+ +N+P  G C INFFRLVWRT
Sbjct  903   IAVHLIGAYQQVFAQPIFQFVEKKCNQAWPESNFITKEHSMNIPLLGKCRINFFRLVWRT  962

Query  372   GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
              YVI + VVAMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q K+ KYS RWI LK+L 
Sbjct  963   TYVIFSTVVAMIFPFFNAILGLIGAVAFWPLTVYFPVEMHISQKKVKKYSVRWIVLKLLV  1022

Query  192   WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
               CL+VSL+AA GSI GL   VK YKPF 
Sbjct  1023  LVCLIVSLLAAIGSIVGLISSVKAYKPFH  1051


 Score =   292 bits (747),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 161/207 (78%), Gaps = 1/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN VMKKAS VGV+T T FY+LC C+GYA FG+ APG+ LT FGFYEP+WLIDFAN C
Sbjct  293  PPENIVMKKASLVGVSTATAFYILCACMGYATFGSQAPGDLLTDFGFYEPYWLIDFANAC  352

Query  549  IAIHLIGAYQ-VFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRT  373
            IA+HLIG YQ V  QP+F FVE +C++ WP+S FIT E+ +N+P  G C INFFRLVWRT
Sbjct  353  IAVHLIGVYQQVIAQPIFQFVEKKCNKAWPESNFITKEHSMNIPLLGKCRINFFRLVWRT  412

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             YVI + V+AMIFPFFN  LGLIGA +F+PLTVYFP+EMHI+Q KI KY+ RWI LK+L 
Sbjct  413  IYVIFSTVIAMIFPFFNAVLGLIGAVAFWPLTVYFPVEMHISQKKIKKYTMRWIGLKLLV  472

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKP  112
              CL+VSL+AA GSI GL   +   K 
Sbjct  473  LVCLIVSLLAAVGSIVGLISSLIRRKE  499



>ref|XP_004496860.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=468

 Score =   285 bits (730),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/210 (62%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+ MKK++ VG+T TT FY LCG LGY AFGN APGNFLTGFGFYEPFWL+D  N+ 
Sbjct  259  PPENQAMKKSNVVGITVTTFFYALCGLLGYEAFGNKAPGNFLTGFGFYEPFWLVDIGNLL  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QP+FS VES  S+ WP+SK +T EY + +P  G   IN FR++WRT 
Sbjct  319  IIIHLVGAYQVFAQPVFSLVESWGSKCWPESKLMTKEYYIKIPLVGIYRINIFRVIWRTM  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T V+AMIFPFFN  +GL+GA SF+PLTVYFP EM++ Q K+PK+S  WI +K+LS 
Sbjct  379  YVIFTTVMAMIFPFFNSVVGLLGAISFFPLTVYFPTEMYLTQAKVPKFSPIWIGMKMLSV  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             C +V+LVAA GS++G+  D+KTYKPF+  
Sbjct  439  FCFIVTLVAAVGSVEGIISDLKTYKPFQTN  468



>gb|ABR18002.1| unknown [Picea sitchensis]
Length=492

 Score =   285 bits (730),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKA+ +GV+ TTLFY L GC GYAAFGN+APGN LTGFGFY PFWL+DFAN C
Sbjct  282  PAENKTMKKATVLGVSVTTLFYTLSGCFGYAAFGNSAPGNLLTGFGFYNPFWLVDFANAC  341

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            + +HL+GAYQVF QPLF+F+E  CS +WP S+FI   Y +N+P +G    N FRLVWRT 
Sbjct  342  VVVHLVGAYQVFVQPLFAFIEEWCSHKWPRSQFIHKSYNINIPGYGLYKANLFRLVWRTC  401

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI T +++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI +++ +W+ L+ LS 
Sbjct  402  FVISTTLISMLLPFFNDVVGILGAVGFWPLTVYFPVEMYIAQKKIRRFTTKWMLLQTLSV  461

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
               +VSL AAAGSI+G+  D+K+YKPF+
Sbjct  462  VSFIVSLAAAAGSIEGIIQDLKSYKPFR  489



>ref|XP_004289864.1| PREDICTED: amino acid permease 4-like [Fragaria vesca subsp. 
vesca]
Length=512

 Score =   286 bits (731),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 127/208 (61%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+   +T TT+FY+LCGC GYAAFG+ APGN LTGFGFY P+WL+D ANV 
Sbjct  302  PAEHKTMKKATVFSITVTTVFYMLCGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GA+QVFCQPLF+FVE   +Q+WP S F+TAEY++ +P +G   +N FRLVWRT 
Sbjct  362  IVVHLVGAFQVFCQPLFAFVEKWSAQKWPKSDFVTAEYDIPIPFYGVYQLNLFRLVWRTL  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T +++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI K+S RW+ L++LS 
Sbjct  422  FVILTTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIEKWSSRWLGLQMLSM  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CLVVS+VAA GS  G+  D+K+YKPFK
Sbjct  482  SCLVVSIVAAVGSFAGVVLDLKSYKPFK  509



>emb|CDO96925.1| unnamed protein product [Coffea canephora]
Length=512

 Score =   285 bits (729),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + + TTT+FY+LCGC+GYAAFG++APGN LTGFGFY P+WL+D ANV 
Sbjct  302  PAEYKTMKKATLISIATTTVFYLLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLLDIANVA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQPLF+FVE   +QRW +  F+TAEY++ +P +G   +NFFRL WRT 
Sbjct  362  IVIHLVGAYQVYCQPLFAFVEKWSAQRWSNGDFVTAEYDIPIPFYGVYQLNFFRLSWRTA  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIVT ++AM+ PFFND +G++GA  F+PLTVYFPIE+++AQ KI +++ +WI L+ILS 
Sbjct  422  FVIVTTIIAMLVPFFNDVVGILGALGFWPLTVYFPIEIYVAQKKIGRWTTQWIGLQILSA  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL AA GS+ G+  ++KTYKPFK
Sbjct  482  ACLLVSLSAAIGSVAGVVLELKTYKPFK  509



>ref|XP_004515440.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=468

 Score =   284 bits (726),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+ MKK++ +G+T TT FY LCG LGY AFGN APGNFLTGFGFYEPFWL+D  N+ 
Sbjct  260  PPENQAMKKSNVIGITVTTFFYALCGLLGYEAFGNKAPGNFLTGFGFYEPFWLVDIGNLF  319

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QP+FS VES  S+RWP+SK +T EY V +P  G   +N FRL+WRT 
Sbjct  320  IIIHLVGAYQVFAQPIFSLVESWGSKRWPESKLMTKEYYVKIPLVGIWRMNMFRLIWRTL  379

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T + AMIFPFFN  +GL+GA SF+PL+VYFP EM++ Q+K+ KYS  WI +K LS 
Sbjct  380  YVIFTTLFAMIFPFFNSIVGLVGAMSFFPLSVYFPTEMYLVQSKVTKYSPMWIGMKSLSG  439

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CL+V+LVAA GSI+G+  ++KTYKPF
Sbjct  440  FCLIVTLVAAVGSIEGIISELKTYKPF  466



>ref|XP_010025744.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 ref|XP_010025745.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW62473.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
 gb|KCW62474.1| hypothetical protein EUGRSUZ_H05115 [Eucalyptus grandis]
Length=494

 Score =   283 bits (725),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ +    TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  284  PSEAKTMKKATFLSTAVTTTFYMLCGCMGYAAFGDAAPGNLLTGFGFYNPFWLLDIANAA  343

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQP+F+FVE + +QRWPDS+FI  E ++ VP  G  ++N FRLVWRT 
Sbjct  344  IVIHLVGAYQVYCQPIFAFVEKQAAQRWPDSEFIAREIKIPVPGLGQYNMNLFRLVWRTI  403

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V +T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q +IP++S RW+ L++LS 
Sbjct  404  FVTLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIKQKQIPRWSTRWLCLQVLSM  463

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+S++AAAGSI G+  D+K+Y+PFK
Sbjct  464  ACLVISIMAAAGSIAGVMLDLKSYQPFK  491



>ref|XP_002312967.2| hypothetical protein POPTR_0009s13610g [Populus trichocarpa]
 gb|EEE86922.2| hypothetical protein POPTR_0009s13610g [Populus trichocarpa]
Length=414

 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 168/210 (80%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   +  TT+FY+LCGC+GYAAFG+ APGN LTGFGFY P+WL+D ANV 
Sbjct  204  PAEYKTMKKATLFSIIITTIFYLLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVA  263

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   +++WP S F+TAEYEV +P +G   +NFFRLVWRT 
Sbjct  264  IVVHLVGAYQVYCQPLFAFVEKWSARKWPKSDFVTAEYEVPIPFYGVYQLNFFRLVWRTI  323

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +GL+G+  F+PLTV+FPIEM+I+Q KI +++ +WI L+ILS 
Sbjct  324  FVMLTTLIAMLMPFFNDVVGLLGSMGFWPLTVFFPIEMYISQKKIGRWTSQWIGLQILSM  383

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            TCL++++ AA GS+ G+  D+KTYKPFK  
Sbjct  384  TCLMITIAAAVGSVAGVVLDLKTYKPFKTS  413



>gb|KEH43994.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=470

 Score =   283 bits (723),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/203 (65%), Positives = 158/203 (78%), Gaps = 0/203 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKK++  G+  TT FY LCG LGY AFGN APGNFLTGFGFYEPFWL+D  N+ 
Sbjct  263  PPENKVMKKSAFTGILITTFFYALCGLLGYEAFGNKAPGNFLTGFGFYEPFWLVDIGNLF  322

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QP+FS VES  ++RWP SKF+T EY VN+P  G   +N FRL+WRT 
Sbjct  323  IIIHLVGAYQVFAQPIFSIVESWGNKRWPQSKFMTKEYHVNIPLVGIWRMNMFRLIWRTM  382

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T V+A+I PFFN  +GL+GA SF+PLTVYFP EM++ Q K+PKYS  WI +K+LS 
Sbjct  383  YVIFTTVIAIILPFFNSIVGLLGAISFFPLTVYFPTEMYLKQAKVPKYSSIWIGMKLLSG  442

Query  189  TCLVVSLVAAAGSIQGLXXDVKT  121
             CL+V+LVAA GSI G+  D+KT
Sbjct  443  FCLIVTLVAAVGSIVGIITDLKT  465



>ref|XP_004497265.1| PREDICTED: amino acid permease 6-like [Cicer arietinum]
Length=467

 Score =   282 bits (721),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 159/207 (77%), Gaps = 0/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+ MKK+   G+T TT FY LCG LGY AFGN APGNFLTGFGFYEPFWL+D  N+ 
Sbjct  259  PPENQAMKKSVFTGITVTTFFYALCGLLGYEAFGNKAPGNFLTGFGFYEPFWLVDIGNIF  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVF QP+FS VES  S+RWP+SK +T EY V +P  G   +N FRL+WRT 
Sbjct  319  IVIHLVGAYQVFAQPVFSLVESWGSKRWPESKLMTKEYYVKIPLVGIWRMNMFRLIWRTL  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI T + AMIFPFFN  +GL+GA SF+PLTVYFP EM++ Q+K+ KYS  WI +K LS 
Sbjct  379  YVIFTTLFAMIFPFFNSIVGLLGAMSFFPLTVYFPTEMYLVQSKVTKYSPMWIGMKSLSG  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             CL+V+LVA  GSI+G+  ++KTYKPF
Sbjct  439  FCLIVTLVAGVGSIEGIISELKTYKPF  465



>gb|EYU37943.1| hypothetical protein MIMGU_mgv1a004721mg [Erythranthe guttata]
Length=513

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT+FY+LCGC+GYAAFG+ APGN LTGFGF++P+WL+D ANV 
Sbjct  303  PAEHKTMKKATSISIAVTTIFYLLCGCMGYAAFGDQAPGNLLTGFGFFDPYWLLDIANVS  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   + +W  S F+TAEY++ VP FG   +NFFR+VWRT 
Sbjct  363  IVVHLVGAYQVYCQPLFAFVEKWSAAKWSRSNFVTAEYDIPVPFFGVYQLNFFRVVWRTC  422

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFP+EM+IA+ KI K++ RWI L++LS 
Sbjct  423  FVVLTTLIAMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAKNKIGKWTSRWIGLQMLSM  482

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS+ AA GS+ G+  D++TYKPFK
Sbjct  483  ACLLVSVAAAVGSVAGVVLDLQTYKPFK  510



>ref|XP_011046334.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
 ref|XP_011046342.1| PREDICTED: amino acid permease 3-like [Populus euphratica]
Length=511

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 169/208 (81%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   + TTT+FY+LCGC+GYAAFG+ APGN LTGFGFY P+WL+D ANV 
Sbjct  301  PAEYKTMKKATLFSIITTTIFYLLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVA  360

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   +++WP S F+TAEYEV +P +G   +NFFRLVWRT 
Sbjct  361  IFVHLVGAYQVYCQPLFAFVEKWSARKWPQSNFVTAEYEVPIPFYGVYQLNFFRLVWRTI  420

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +GL+GA  F+PLTV+FPIEM+I+Q KI +++ +WI L+ILS 
Sbjct  421  FVMLTTLIAMLMPFFNDVVGLLGALGFWPLTVFFPIEMYISQKKIGRWTNQWIGLQILSM  480

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            TCLV+++ AA GS+ G+  D+KTY+PFK
Sbjct  481  TCLVITIAAAVGSVAGVVLDLKTYRPFK  508



>ref|XP_008236004.1| PREDICTED: amino acid permease 3-like [Prunus mume]
Length=511

 Score =   283 bits (723),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+   +  TT+FY+LCGC GYAAFG+ APGN LTGFGFY P+WL+D ANV 
Sbjct  301  PAEHKTMKKATVFSIALTTVFYLLCGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVA  360

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GA+QV+CQPLF+FVE   +QRWP S F+TAEY++ +P  G   +N FRLVWRT 
Sbjct  361  IVVHLVGAFQVYCQPLFAFVEKWSAQRWPKSDFVTAEYDIPIPFHGVYQLNLFRLVWRTI  420

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T +++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI K+S RW+ LK+LS 
Sbjct  421  FVIITTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIGKWSSRWVGLKMLSI  480

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL+V++ AA GS+ G+  D+KTYKPFK
Sbjct  481  SCLLVTIAAAVGSVAGVVLDLKTYKPFK  508



>ref|XP_010920126.1| PREDICTED: amino acid permease 4-like [Elaeis guineensis]
Length=513

 Score =   282 bits (722),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 168/210 (80%), Gaps = 1/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK M+KA+ + +  TTLFY+LCGC+GYAAFG++APGN LTGFGFY P+WL+D AN+ 
Sbjct  302  PAENKTMRKATLLSIAVTTLFYLLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLLDIANLA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTC-SINFFRLVWRT  373
            I +HL+GAYQV+CQPLF+FVE   +QRWP S+F++ EYE  +P   T   +N FR++WRT
Sbjct  362  IVVHLVGAYQVYCQPLFAFVEKWSAQRWPKSEFVSREYEARIPVMETTYKLNLFRVIWRT  421

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             +V+VT  ++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI ++S  W+ L++LS
Sbjct  422  IFVVVTTTISMLMPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKIRRWSAPWVGLRLLS  481

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
            +TCLVVS+ AA GS+ G+  D+K+Y+PFKA
Sbjct  482  FTCLVVSVAAACGSVAGVVLDLKSYRPFKA  511



>ref|XP_002278086.1| PREDICTED: amino acid permease 3 [Vitis vinifera]
 emb|CBI37884.3| unnamed protein product [Vitis vinifera]
Length=512

 Score =   282 bits (721),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K M+KA+ + +  TT FY+LCGC GYAAFG+ APGN LTGFGFY+P+WL+D AN+ 
Sbjct  302  PAEYKTMRKATVLSIAVTTAFYMLCGCFGYAAFGDLAPGNLLTGFGFYDPYWLLDIANIA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   + +WP S F+T EY++ +PC+G   +NFFRLVWRT 
Sbjct  362  IIVHLVGAYQVYCQPLFAFVEKWSAHKWPKSDFVTEEYDLPIPCYGVYQLNFFRLVWRTI  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFP+EM+I+Q KI +++ RW+ L+ILS+
Sbjct  422  FVVLTTLIAMLLPFFNDVVGILGAFGFWPLTVYFPVEMYISQKKIGRWTSRWVALQILSF  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++SL AA GS+ G+  D+KTYKPFK
Sbjct  482  ACLLISLAAAVGSVAGVVLDLKTYKPFK  509



>ref|XP_009764610.1| PREDICTED: amino acid permease 3-like isoform X2 [Nicotiana sylvestris]
Length=414

 Score =   278 bits (711),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKAS + +  TT+FY+LCGC+GYAAFGN+APGN LTGFGF++P+WL+D AN  
Sbjct  204  PAEHKTMKKASMLSIGVTTIFYLLCGCIGYAAFGNDAPGNLLTGFGFFDPYWLLDIANAA  263

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQPLF+FVE   +++W  S F+TAE+++ +P  G   +NFFR++WRT 
Sbjct  264  IVIHLVGAYQVYCQPLFAFVEKWSAKKWSKSNFVTAEHDIPIPFVGVYQLNFFRVIWRTI  323

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T ++AM+ PFFND +GL+GA  F+PLTVYFPIEM+I Q KI +++ +WI L++LS 
Sbjct  324  FVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQKKIGRWTNQWIGLEMLSA  383

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL VS+ AA GSI G+  D+KTYKPFK
Sbjct  384  ACLFVSIAAAVGSIAGVVLDLKTYKPFK  411



>ref|XP_008377748.1| PREDICTED: amino acid permease 3-like [Malus domestica]
Length=514

 Score =   281 bits (718),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+   +  TT+FY+LCGC GYAAFG+ APGN LTGFGFY P+WL+D ANV 
Sbjct  304  PXEHKTMKKATVFSIAITTVFYLLCGCFGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVA  363

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GA+QVFCQPLF+FVE   ++RWP+S F+TAEYE+ +P +G   +N FRLVWRT 
Sbjct  364  IVVHLVGAFQVFCQPLFAFVEKWSAKRWPNSDFVTAEYEIPIPFYGVYQLNLFRLVWRTI  423

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T +++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI K+S +W+ L++LS 
Sbjct  424  FVIITTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQEKIRKWSSKWVGLQMLSV  483

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL VS+ AA GS+ G+  D++TYKPFK
Sbjct  484  SCLFVSIAAAVGSVAGVVLDLQTYKPFK  511



>ref|XP_008781630.1| PREDICTED: amino acid permease 3 [Phoenix dactylifera]
Length=492

 Score =   280 bits (716),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 162/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E KVMKKA+ + +  TT FY+LCGC+GYAAFG++APGN LTGFGFY PFWL+D AN  
Sbjct  282  PSEAKVMKKATMLSLAVTTFFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPFWLLDIANAA  341

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVFCQPLF+FVE    Q WP S FIT E  + +    + ++N FRLVWR+ 
Sbjct  342  IVIHLVGAYQVFCQPLFAFVEKWARQTWPKSTFITKETRIPLSSARSYNLNLFRLVWRSA  401

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +GL+GA  F+PLTVYFPIEM+IAQ K+PK+S RW+ L++LS 
Sbjct  402  FVVLTTIISMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIAQKKVPKWSTRWVSLQMLSI  461

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS+ AAAGSI G+  D+K Y+PFK
Sbjct  462  ACLIVSISAAAGSIAGVVTDLKVYRPFK  489



>ref|XP_008654977.1| PREDICTED: amino acid carrier isoform X1 [Zea mays]
 gb|AFW81885.1| amino acid carrier [Zea mays]
Length=478

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 125/211 (59%), Positives = 165/211 (78%), Gaps = 4/211 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVM++A+ V V  TT FY+LCGC+GYAAFG+NAPGN LTGFGFYEPFWL+D AN  
Sbjct  264  PSESKVMRRATVVSVAVTTFFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWLLDVANAA  323

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVP---CFGTC-SINFFRLV  382
            IA+HL+GAYQV+CQPLF+FVE    QRWP S++IT E +V +P     G C  ++ FRL 
Sbjct  324  IAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPLGTAGGRCYKLSLFRLT  383

Query  381  WRTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLK  202
            WRT +V+ T VV+M+ PFFND +GL+GA  F+PLTVYFP+EM+I Q K+P++S RW+ L+
Sbjct  384  WRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTRWVCLQ  443

Query  201  ILSWTCLVVSLVAAAGSIQGLXXDVKTYKPF  109
            +LS  CLV+++ +AAGS+ G+  D+K YKPF
Sbjct  444  LLSVACLVITVASAAGSVAGIVSDLKVYKPF  474



>ref|XP_010095435.1| hypothetical protein L484_013392 [Morus notabilis]
 gb|EXB60127.1| hypothetical protein L484_013392 [Morus notabilis]
Length=482

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 169/210 (80%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + V+ TTLFY+LCGC+GYAAFG+ +PGN LTGFGFY P+WL+D AN  
Sbjct  272  PSEAKTMKKATLISVSVTTLFYMLCGCMGYAAFGDMSPGNLLTGFGFYNPYWLLDIANAA  331

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQPLF+FVE + +QR+PDS+FIT +  + +P     ++N FRLVWRT 
Sbjct  332  IVIHLVGAYQVYCQPLFAFVEKQAAQRFPDSEFITRDIRIPLPGSRFYNLNLFRLVWRTI  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T +++M+ PFFND +GL+GA  F+PLTVY+P+EM+IAQ +IPK+S +W+ L+ILS+
Sbjct  392  FVILTTLISMLLPFFNDIVGLLGALGFWPLTVYYPVEMYIAQKRIPKWSTKWLCLQILSF  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL++++ AAAGSI G+  D+K+YKPFK  
Sbjct  452  ACLIITVAAAAGSIAGVILDLKSYKPFKTD  481



>ref|XP_004505788.1| PREDICTED: amino acid permease 2-like [Cicer arietinum]
Length=513

 Score =   280 bits (716),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT+FY+LCG +GYAAFG++ PGN LTGFGFY P+WL+D AN  
Sbjct  303  PSEHKTMKKATMLSIMITTVFYILCGSMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANFA  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGAYQVF QPLF+FVE   +++WP + F+TAEYE+ +PC G   +NFFRL+WRT 
Sbjct  363  IVVHLIGAYQVFSQPLFAFVEKWSARKWPKNNFVTAEYEIAIPCTGVYKLNFFRLIWRTI  422

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVYFPI+M+I+Q KI +++ +WI L++LS 
Sbjct  423  FVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYFPIDMYISQKKIGRWTNKWIGLQMLSV  482

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++SL+AA GSI G+  D+KTYKPFK
Sbjct  483  CCLIISLLAAVGSIAGVVLDLKTYKPFK  510



>ref|XP_004962032.1| PREDICTED: amino acid permease 3-like isoform X1 [Setaria italica]
 ref|XP_004962033.1| PREDICTED: amino acid permease 3-like isoform X2 [Setaria italica]
Length=494

 Score =   279 bits (714),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 164/211 (78%), Gaps = 4/211 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVM++A+ V V  TTLFY+LCGC+GYAAFG+NAPGN LTGFGFYEPFWL+D AN  
Sbjct  280  PSESKVMRRATVVSVAVTTLFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWLLDVANAA  339

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTC----SINFFRLV  382
            I +HL+GAYQV+CQPLF+FVE    Q+WP SK+IT E +V +   G+      +N FRL 
Sbjct  340  IVVHLVGAYQVYCQPLFAFVEKWAKQKWPKSKYITGEVDVPLSLSGSAGRCYKLNLFRLT  399

Query  381  WRTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLK  202
            WRT +V+ T V++M+ PFFND +GL+GA  F+PLTVYFP+EM+I Q K+P++S RW+ L+
Sbjct  400  WRTAFVVATTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTRWVCLQ  459

Query  201  ILSWTCLVVSLVAAAGSIQGLXXDVKTYKPF  109
            +LS  CL++++ +AAGS+ G+  D+K YKPF
Sbjct  460  MLSLACLIITVASAAGSVAGIISDLKVYKPF  490



>ref|XP_009604405.1| PREDICTED: amino acid permease 4-like [Nicotiana tomentosiformis]
Length=512

 Score =   280 bits (715),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKAS + +  TT+FY+LCGC+GYAAFG++APGN LTGFGF++P+WL+D AN  
Sbjct  302  PAEHKTMKKASMLSIGITTIFYLLCGCMGYAAFGDDAPGNLLTGFGFFDPYWLLDIANAA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHLIGAYQV+CQPLF+FVE   +++W +S F+TAE+ + +P FG   +NFFR++WRT 
Sbjct  362  IVIHLIGAYQVYCQPLFAFVEKWSAKKWSNSNFVTAEHGIRIPLFGVYQLNFFRVIWRTI  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T ++AM+ PFFND +GL+GA  F+PLTVYFPIEM+I Q KI +++ +WI L++LS 
Sbjct  422  FVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQKKIGRWTNQWIGLQMLSA  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL VS+ AA GSI G+  D+KTYKPF 
Sbjct  482  ACLFVSIAAAVGSIAGVVLDLKTYKPFN  509



>ref|XP_007198986.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
 gb|EMJ00185.1| hypothetical protein PRUPE_ppa020916mg [Prunus persica]
Length=511

 Score =   279 bits (714),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+   +  TT+FY+ CGC GYAAFG+ APGN LTGFGFY+P+WL+D ANV 
Sbjct  301  PAEHKTMKKATVFSIALTTVFYLFCGCFGYAAFGDLAPGNLLTGFGFYKPYWLLDIANVA  360

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GA+QV+CQPLF+FVE   +QRWP   F+TAEY++ +P +G   +N FRLVWRT 
Sbjct  361  IVVHLVGAFQVYCQPLFAFVEKWSAQRWPKRDFVTAEYDIPIPFYGVYQLNLFRLVWRTI  420

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI K+S RW+ LK+LS 
Sbjct  421  FVMITTLISMLLPFFNDVVGILGAFGFWPLTVYFPVEMYIAQQKIGKWSSRWVGLKMLSI  480

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            +CL+V++ AA GS+ G+  D+KTYKPFK
Sbjct  481  SCLLVTIAAAVGSVAGVVLDLKTYKPFK  508



>gb|KHN23179.1| Amino acid permease 6, partial [Glycine soja]
Length=436

 Score =   276 bits (707),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 161/208 (77%), Gaps = 5/208 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+ MKKA+  G + T+LFY+LCG LGYAAFGN APGNFLTGFGFYEP+WL+D  NV 
Sbjct  234  PPENQAMKKATLAGCSITSLFYMLCGLLGYAAFGNKAPGNFLTGFGFYEPYWLVDIGNVF  293

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            + +HL+GAYQVF QP+F  VE+  ++RWP+S F+  EY V     G    N FR++WRT 
Sbjct  294  VFVHLVGAYQVFTQPVFQLVETWVAKRWPESNFMGKEYRV-----GKFRFNGFRMIWRTV  348

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI TAVVAMI PFFN  +GL+GA SF+PLTVYFP EM++ Q K+PK+S  WI +KILS 
Sbjct  349  YVIFTAVVAMILPFFNSIVGLLGAISFFPLTVYFPTEMYLVQAKVPKFSLVWIGVKILSG  408

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+V+LVAAAGSIQG+  D+K Y+PFK
Sbjct  409  FCLIVTLVAAAGSIQGIIADLKIYEPFK  436



>ref|XP_009764609.1| PREDICTED: amino acid permease 4-like isoform X1 [Nicotiana sylvestris]
Length=513

 Score =   279 bits (713),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 166/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKAS + +  TT+FY+LCGC+GYAAFGN+APGN LTGFGF++P+WL+D AN  
Sbjct  303  PAEHKTMKKASMLSIGVTTIFYLLCGCIGYAAFGNDAPGNLLTGFGFFDPYWLLDIANAA  362

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQPLF+FVE   +++W  S F+TAE+++ +P  G   +NFFR++WRT 
Sbjct  363  IVIHLVGAYQVYCQPLFAFVEKWSAKKWSKSNFVTAEHDIPIPFVGVYQLNFFRVIWRTI  422

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T ++AM+ PFFND +GL+GA  F+PLTVYFPIEM+I Q KI +++ +WI L++LS 
Sbjct  423  FVILTTIIAMLLPFFNDVVGLLGALGFWPLTVYFPIEMYIKQKKIGRWTNQWIGLEMLSA  482

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL VS+ AA GSI G+  D+KTYKPFK
Sbjct  483  ACLFVSIAAAVGSIAGVVLDLKTYKPFK  510



>ref|XP_010912574.1| PREDICTED: amino acid permease 3-like [Elaeis guineensis]
Length=488

 Score =   278 bits (710),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 161/208 (77%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E KVMKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  278  PSEAKVMKKATLLSIVVTTFFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPFWLLDIANTA  337

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGAYQVFCQPLF+F+E    Q WP S FIT E  +++    + ++N FRLVWR+ 
Sbjct  338  IVVHLIGAYQVFCQPLFAFIEKWALQTWPKSTFITKEMRISLTSTKSYNLNLFRLVWRSA  397

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +GL+GA SF+PLTVYFPIEM++ Q K+P++S RW+ L+ILS 
Sbjct  398  FVVLTTIISMLLPFFNDIVGLLGALSFWPLTVYFPIEMYVVQKKVPRWSTRWVCLQILSV  457

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VS+ AA GSI G+  D+K Y+PFK
Sbjct  458  ACLIVSIAAATGSIAGVVTDLKVYRPFK  485



>dbj|BAJ93107.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=526

 Score =   279 bits (713),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 164/210 (78%), Gaps = 3/210 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK M+KA+ +GV+TTT FY+LCGCLGY+AFGN+APGN LTGFGFYEPFWLIDF NVC
Sbjct  319  PAENKTMRKANLMGVSTTTAFYMLCGCLGYSAFGNDAPGNMLTGFGFYEPFWLIDFTNVC  378

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQP+++ VES  + RWP+S+F+  +Y    P  GT S+N FRLVWRT 
Sbjct  379  IVVHLVGAYQVYCQPIYAAVESWAAGRWPNSEFVVRQYH---PFSGTFSLNMFRLVWRTA  435

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIV+ V+A+  PFFND LGL+GA  F+PLTVYFP+EM+I+Q+K+ KYS +W+ L+ LS+
Sbjct  436  FVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFPVEMYISQSKMKKYSRKWVALQTLSF  495

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             C  V++     SIQG+   +K Y PFK +
Sbjct  496  ACFAVTVAVTVASIQGITQSLKNYVPFKTK  525



>ref|XP_010028716.1| PREDICTED: amino acid permease 4-like [Eucalyptus grandis]
 gb|KCW55513.1| hypothetical protein EUGRSUZ_I01405 [Eucalyptus grandis]
Length=512

 Score =   278 bits (712),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 167/210 (80%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +T TT+FY+LCGC+GYAAFG+ APGN LTGFGFY+P+WL+D AN  
Sbjct  302  PAEHKTMKKATLLSITVTTVFYMLCGCMGYAAFGDLAPGNILTGFGFYDPYWLLDIANAA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQPLF+FVE   +Q+W  S F+TAEY++ +P  G   +NFFRLVWRT 
Sbjct  362  IVIHLVGAYQVYCQPLFAFVEKWSAQKWSTSDFVTAEYDIPIPFCGMYQLNFFRLVWRTL  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V+AM+ PFFND +G++GA  F+PLTVYFP+EM+I+  +I +++  W+ L+ILS 
Sbjct  422  FVILTTVIAMLMPFFNDVVGILGAFGFWPLTVYFPVEMYISSRRIKRWTTMWVGLQILSM  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            TCL++S+ AA GS+ G+  D+KTYKPFK  
Sbjct  482  TCLLISIAAAVGSVAGVVLDLKTYKPFKTS  511



>ref|XP_003535676.1| PREDICTED: amino acid permease 6-like [Glycine max]
Length=462

 Score =   277 bits (708),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 161/208 (77%), Gaps = 5/208 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+ MKKA+  G + T+LFY+LCG LGYAAFGN APGNFLTGFGFYEP+WL+D  NV 
Sbjct  260  PPENQAMKKATLAGCSITSLFYMLCGLLGYAAFGNKAPGNFLTGFGFYEPYWLVDIGNVF  319

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            + +HL+GAYQVF QP+F  VE+  ++RWP+S F+  EY V     G    N FR++WRT 
Sbjct  320  VFVHLVGAYQVFTQPVFQLVETWVAKRWPESNFMGKEYRV-----GKFRFNGFRMIWRTV  374

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI TAVVAMI PFFN  +GL+GA SF+PLTVYFP EM++ Q K+PK+S  WI +KILS 
Sbjct  375  YVIFTAVVAMILPFFNSIVGLLGAISFFPLTVYFPTEMYLVQAKVPKFSLVWIGVKILSG  434

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+V+LVAAAGSIQG+  D+K Y+PFK
Sbjct  435  FCLIVTLVAAAGSIQGIIADLKIYEPFK  462



>ref|NP_001149036.1| amino acid carrier [Zea mays]
 gb|ACG33909.1| amino acid carrier [Zea mays]
Length=478

 Score =   277 bits (708),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 164/211 (78%), Gaps = 4/211 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVM++A+ V V  TT  Y+LCGC+GYAAFG+NAPGN LTGFGFYEPFWL+D AN  
Sbjct  264  PSESKVMRRATVVSVAVTTFXYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWLLDVANAA  323

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVP---CFGTC-SINFFRLV  382
            IA+HL+GAYQV+CQPLF+FVE    QRWP S++IT E +V +P     G C  ++ FRL 
Sbjct  324  IAVHLVGAYQVYCQPLFAFVEKWARQRWPKSRYITGEVDVPLPLGTAGGRCYKLSLFRLT  383

Query  381  WRTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLK  202
            WRT +V+ T VV+M+ PFFND +GL+GA  F+PLTVYFP+EM+I Q K+P++S RW+ L+
Sbjct  384  WRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTRWVCLQ  443

Query  201  ILSWTCLVVSLVAAAGSIQGLXXDVKTYKPF  109
            +LS  CLV+++ +AAGS+ G+  D+K YKPF
Sbjct  444  LLSVACLVITVASAAGSVAGIVSDLKVYKPF  474



>gb|KDO57534.1| hypothetical protein CISIN_1g015342mg [Citrus sinensis]
Length=408

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  198  PAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANAA  257

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE + ++ WPDS F++ E+++ VP      +N FRLVWR+ 
Sbjct  258  IVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLFRLVWRSC  317

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI K+S RW+ L++LS 
Sbjct  318  FVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSM  377

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+S++A AGSI G+  DVK Y PFK
Sbjct  378  ACLVLSIIAGAGSIVGVVNDVKAYTPFK  405



>gb|KDP29639.1| hypothetical protein JCGZ_18801 [Jatropha curcas]
Length=522

 Score =   278 bits (710),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 165/208 (79%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   +  TT+FY+LCGC+GYAAFG++APGN LTGFGFY P+WL+D AN+ 
Sbjct  312  PAEYKTMKKATTFSIAVTTIFYLLCGCMGYAAFGDSAPGNLLTGFGFYNPYWLLDIANIA  371

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   + +WP + F+TAEYE+ +P  G   +NFFR+VWR+ 
Sbjct  372  IIVHLVGAYQVYCQPLFAFVEKWSAHKWPKNDFVTAEYEIPIPHCGVYRLNFFRIVWRSI  431

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIVT ++AM+ PFFND +GL+GA  F+PLTVYFPIEM+I+Q KI +++ RWI L+ILS 
Sbjct  432  FVIVTTLIAMLMPFFNDIVGLLGALGFWPLTVYFPIEMYISQKKIGQWTSRWIALQILSV  491

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL +++ AA GS+ G+  D+KTYKPFK
Sbjct  492  CCLFITIAAAVGSVAGVVLDLKTYKPFK  519



>gb|EYU20407.1| hypothetical protein MIMGU_mgv1a018639mg [Erythranthe guttata]
Length=480

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 163/212 (77%), Gaps = 2/212 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKA+ V V+TTT FY++CGC GYAAFGNNAPGN LTGFGFYEPFWL+D AN C
Sbjct  268  PPENQVMKKANIVAVSTTTAFYMMCGCFGYAAFGNNAPGNLLTGFGFYEPFWLVDLANAC  327

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGT--CSINFFRLVWR  376
            I +HL+GAYQVF QP+FS VE R +++WP S FIT EY++ +        S+N  RL+WR
Sbjct  328  IVLHLVGAYQVFAQPVFSAVELRANKKWPKSNFITREYKIGIGKNRNKFTSVNLMRLIWR  387

Query  375  TGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKIL  196
            + +VI+  + A+I PFFND L  +GA  ++PLTVYFPIEM+IA+ KI K+S RW+ L+++
Sbjct  388  SSFVILATLFALILPFFNDILAFLGAMGYWPLTVYFPIEMYIAKNKIKKWSRRWLGLQLI  447

Query  195  SWTCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            +  CL+V++ A  GSIQGL   +KTYKPF+ +
Sbjct  448  NSVCLLVAVAAGCGSIQGLNKALKTYKPFQVK  479



>ref|XP_007048506.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 ref|XP_007048507.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92663.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
 gb|EOX92664.1| Amino acid permease 2 isoform 1 [Theobroma cacao]
Length=485

 Score =   276 bits (706),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 162/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + +  TT FY+LCGC+GYA+FG+ APGN LTGFGFY PFWL+D AN  
Sbjct  275  PAEAKTMKKATKLSIAITTAFYMLCGCMGYASFGDFAPGNLLTGFGFYNPFWLLDVANAA  334

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVFCQP+F+F+E   +QRW +S FIT E+++ +P +    +N FRLVWRT 
Sbjct  335  IVIHLVGAYQVFCQPIFAFIEKWATQRWAESNFITKEFKIPIPGYHPYKLNLFRLVWRTA  394

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KI K+S RWI LK+LS 
Sbjct  395  FVILTTVISMLIPFFNDVMGIMGAFGFWPLTVYFPLEMYIQQKKILKWSTRWICLKMLSM  454

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++++VA AGSI G+  D+K YKPFK
Sbjct  455  ACLLITIVAGAGSIAGVMLDLKVYKPFK  482



>ref|XP_011081743.1| PREDICTED: amino acid permease 8-like isoform X2 [Sesamum indicum]
Length=481

 Score =   276 bits (705),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKA+ V V+TTT FY++CGC GYAAFGN+APGN LTGFGFYEPFWL+D AN C
Sbjct  271  PPENQVMKKANVVAVSTTTAFYLMCGCFGYAAFGNSAPGNLLTGFGFYEPFWLVDLANCC  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVF QP+FS VES   ++WP S F+ AEY +        S+NF RL+WR+ 
Sbjct  331  IVLHLVGAYQVFAQPVFSAVESWAKRKWPKSNFVNAEYSIGFCRSQRLSVNFLRLIWRSS  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+  VVA++ PFFND L  +GA  ++PLTVYFPIE++IA+ KI ++S RW+ L++++ 
Sbjct  391  FVILATVVALVMPFFNDILAFLGAMGYWPLTVYFPIEIYIAKNKIRRWSRRWLGLQLINA  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+V++ AA GSIQGL   +KTYKPF+ +
Sbjct  451  VCLLVAVAAACGSIQGLNKALKTYKPFEVK  480



>ref|XP_002534252.1| amino acid transporter, putative [Ricinus communis]
 gb|EEF28130.1| amino acid transporter, putative [Ricinus communis]
Length=484

 Score =   276 bits (705),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   +  TT FY+LCGC GYAAFG+NAPGN LTGFGFY P+WL+D ANV 
Sbjct  274  PAEYKTMKKATAFSIAVTTFFYLLCGCFGYAAFGDNAPGNILTGFGFYNPYWLLDIANVA  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQPLF+F+E   +++WP+S F+TAEYE+ +   G   +NFFR+VWRT 
Sbjct  334  IIVHLVGAYQVFCQPLFAFIEKWSARKWPNSDFVTAEYEIRILFSGVYQLNFFRIVWRTI  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIVT ++AM+ PFFND +G++GA  F+PLTVYFPIEM+I+Q +I + + +W+ L+ILS 
Sbjct  394  FVIVTTLIAMLMPFFNDVVGILGAMGFWPLTVYFPIEMYISQKRIGRRTSQWLALQILSV  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL +++ AA GS+ G+  D+KTYKPFK
Sbjct  454  CCLFITIAAAVGSVAGVVLDLKTYKPFK  481



>ref|XP_011081742.1| PREDICTED: amino acid permease 8-like isoform X1 [Sesamum indicum]
Length=503

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 163/210 (78%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPEN+VMKKA+ V V+TTT FY++CGC GYAAFGN+APGN LTGFGFYEPFWL+D AN C
Sbjct  293  PPENQVMKKANVVAVSTTTAFYLMCGCFGYAAFGNSAPGNLLTGFGFYEPFWLVDLANCC  352

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVF QP+FS VES   ++WP S F+ AEY +        S+NF RL+WR+ 
Sbjct  353  IVLHLVGAYQVFAQPVFSAVESWAKRKWPKSNFVNAEYSIGFCRSQRLSVNFLRLIWRSS  412

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+  VVA++ PFFND L  +GA  ++PLTVYFPIE++IA+ KI ++S RW+ L++++ 
Sbjct  413  FVILATVVALVMPFFNDILAFLGAMGYWPLTVYFPIEIYIAKNKIRRWSRRWLGLQLINA  472

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CL+V++ AA GSIQGL   +KTYKPF+ +
Sbjct  473  VCLLVAVAAACGSIQGLNKALKTYKPFEVK  502



>ref|XP_006387142.1| hypothetical protein POPTR_1711s00200g, partial [Populus trichocarpa]
 gb|ERP46056.1| hypothetical protein POPTR_1711s00200g, partial [Populus trichocarpa]
Length=172

 Score =   265 bits (677),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/157 (79%), Positives = 140/157 (89%), Gaps = 0/157 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MK+AS VG+ TTT FY+LCGCLGYAAFGN+APGNFLTGFGFYEPF LID ANVC
Sbjct  16   PPENKAMKRASFVGILTTTTFYILCGCLGYAAFGNDAPGNFLTGFGFYEPFVLIDIANVC  75

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            IAIHLIGAYQVFCQP+FSFVESRC +RWPDSKFIT+E+ +N+P +G   +N FRLVWRT 
Sbjct  76   IAIHLIGAYQVFCQPIFSFVESRCHRRWPDSKFITSEHAINIPFYGVYYLNLFRLVWRTL  135

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIE  259
            YVIVTAV+AMI PFFNDFL L+GA SF+PLTVYFP+E
Sbjct  136  YVIVTAVLAMILPFFNDFLALLGAISFWPLTVYFPVE  172



>gb|KDO68036.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=273

 Score =   268 bits (686),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 161/210 (77%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   +  TT FY+LCGC+GYAAFG+ AP N LTGFGFY P+WLID AN  
Sbjct  63   PAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGFYNPYWLIDIANAA  122

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQPLF+FVE   +++WP S  +TAEYE+ +P +G   +N FRLVWRT 
Sbjct  123  IVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGVYQLNLFRLVWRTL  182

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +G++GA  F+PLTVYFPIEM+ AQ KI + + RW+ L+IL+ 
Sbjct  183  FVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNV  242

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            +C  ++LVAA GS+ G+  D+KTYKPFK +
Sbjct  243  SCFFITLVAAIGSVAGVVLDLKTYKPFKTR  272



>ref|XP_003563762.1| PREDICTED: amino acid permease 3-like [Brachypodium distachyon]
Length=492

 Score =   275 bits (704),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/214 (60%), Positives = 164/214 (77%), Gaps = 5/214 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKA+ +GV+TTT FY+LCGCLGYAAFGN A GN LTGFGFYEP+WLIDFANVC
Sbjct  279  PAENKTMKKATLLGVSTTTAFYMLCGCLGYAAFGNGAKGNILTGFGFYEPYWLIDFANVC  338

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEV----NVPCFGTCSINFFRLV  382
            I +HL+GAYQVFCQP+F+ VE+  + RWP++ FI  E+ V    N   FG  S+NFFRL 
Sbjct  339  IVVHLVGAYQVFCQPIFAAVETYAAARWPNAGFIVREHRVSAAGNNKRFG-FSLNFFRLT  397

Query  381  WRTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLK  202
            WRT +V+V+ V+A++ PFFND LG +GA  F+PLTVYFP+EM+I Q +I KY+ RW+ L+
Sbjct  398  WRTAFVVVSTVLAILMPFFNDILGFLGAIGFWPLTVYFPVEMYIRQRRIHKYTTRWVALQ  457

Query  201  ILSWTCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             LS+ C +VSL AA  SI+G+   +K Y PFK +
Sbjct  458  TLSFLCFLVSLAAAVASIEGVTESLKNYVPFKTK  491



>gb|KGN54767.1| hypothetical protein Csa_4G470690 [Cucumis sativus]
Length=312

 Score =   269 bits (688),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 119/209 (57%), Positives = 159/209 (76%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+G  +T TT+FY+LCGC+GYAAFGN APGN LTGFGFY PFWL+D ANV 
Sbjct  101  PSETKTMKKAAGFSITLTTIFYMLCGCMGYAAFGNTAPGNLLTGFGFYNPFWLLDIANVS  160

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNV-PCFGTCSINFFRLVWRT  373
            I +HL+GAYQVF QP+++FVE +  Q WPD+ F T EY++++     + ++N FRLVWRT
Sbjct  161  IVVHLVGAYQVFSQPVYAFVEKKVVQTWPDTPFFTKEYKLSLFSSRSSYNVNLFRLVWRT  220

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
             +V  T +VAM+ PFFND +G IGA  F+P+TVYFP++M++ Q K+PK+S +WI ++ +S
Sbjct  221  LFVCFTTIVAMLLPFFNDIVGFIGALQFWPMTVYFPVQMYVVQKKVPKWSVKWICVQTMS  280

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
              CL++SL AA GSI G+  D+  YKPFK
Sbjct  281  MGCLLISLAAAVGSISGIMLDLNVYKPFK  309



>ref|XP_002439825.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
 gb|EES18255.1| hypothetical protein SORBIDRAFT_09g020790 [Sorghum bicolor]
Length=485

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 161/211 (76%), Gaps = 4/211 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVM++A+ V V  TTLFY+LCGC+GYAAFG+NAPGN LTGFGFYEPFWL+D AN  
Sbjct  271  PSESKVMRRATIVSVAVTTLFYMLCGCMGYAAFGDNAPGNLLTGFGFYEPFWLLDVANAA  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTC----SINFFRLV  382
            I +HL+GAYQV+CQPLF+FVE    QRWP S +IT E +V +   G       +N FRL 
Sbjct  331  IVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSYITGEVDVPLSLAGAAGRCYKLNLFRLT  390

Query  381  WRTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLK  202
            WRT +V+ T VV+M+ PFFND +GL+GA  F+PLTVYFP+EM+I Q K+P++S  W+ L+
Sbjct  391  WRTAFVVATTVVSMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIVQKKVPRWSTLWVCLQ  450

Query  201  ILSWTCLVVSLVAAAGSIQGLXXDVKTYKPF  109
            +LS  CL++++ +AAGS+ G+  D+K YKPF
Sbjct  451  LLSLGCLIITVASAAGSVAGIISDLKVYKPF  481



>ref|XP_010090330.1| hypothetical protein L484_024995 [Morus notabilis]
 gb|EXB39300.1| hypothetical protein L484_024995 [Morus notabilis]
Length=511

 Score =   275 bits (704),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + VT TT+FY+LCG  GYAAFG+ +PGN LTGFGFY P+WL+D ANV 
Sbjct  301  PAEHKTMKKATVLSVTVTTVFYMLCGSFGYAAFGDESPGNLLTGFGFYNPYWLLDIANVA  360

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQPLF+FVE   +Q+WP S F+TAEY++ +P +G   +NFFRLVWRT 
Sbjct  361  IVVHLVGAYQVFCQPLFAFVEKWSAQKWPKSDFVTAEYDIPIPFYGVYQVNFFRLVWRTI  420

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T V+AM+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI +++ RW+ L+ILS 
Sbjct  421  FVMLTTVIAMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIAQKKIGRWTGRWLGLQILSV  480

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            TCL VS+ AA GS  G+  D+KTYKPFK
Sbjct  481  TCLFVSIAAAVGSFAGVVLDLKTYKPFK  508



>ref|XP_006656161.1| PREDICTED: amino acid permease 1-like [Oryza brachyantha]
Length=468

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/213 (60%), Positives = 161/213 (76%), Gaps = 5/213 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MK+A+ +GV+TTT FY+LCGCLGYAAFGN APGN LTGFGFYEP+WLIDFANVC
Sbjct  257  PAENKTMKRATLLGVSTTTAFYMLCGCLGYAAFGNAAPGNMLTGFGFYEPYWLIDFANVC  316

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEV---NVPCFGTCSINFFRLVW  379
            I IHL+GAYQVFCQP+FS VE+  ++RWP S FI  E+ V     PC    S+N FRL W
Sbjct  317  IVIHLVGAYQVFCQPIFSAVETYAARRWPSSDFIAREHPVLAAGKPC--RFSVNMFRLTW  374

Query  378  RTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKI  199
            RT +V+ + V+A++ PFFND LG +GA  F+PLTVY+P+EM+I Q +I +Y+ RW+ L+ 
Sbjct  375  RTAFVVASTVLAIVMPFFNDILGFLGAVGFWPLTVYYPVEMYIRQRRIERYTPRWVALQT  434

Query  198  LSWTCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            LS  C +VSL AA  SI+G+   +K Y PFK +
Sbjct  435  LSLLCFLVSLAAAVASIEGVSESLKHYVPFKTK  467



>gb|AFW86930.1| hypothetical protein ZEAMMB73_950309 [Zea mays]
Length=338

 Score =   270 bits (689),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 119/210 (57%), Positives = 162/210 (77%), Gaps = 3/210 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKA+ +GVTTTT FY+L GCLGY+AFGN APGN LTGFGFYEP+WLIDFANVC
Sbjct  131  PAENKTMKKATLMGVTTTTAFYMLAGCLGYSAFGNAAPGNILTGFGFYEPYWLIDFANVC  190

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVF QP+F+ +E+  ++RWP+++F+T E+ +     G   +N  RL WRT 
Sbjct  191  IVVHLVGAYQVFSQPIFAALETAAAKRWPNARFVTREHPL---VAGRFHVNLLRLTWRTA  247

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V+V+ V+A++ PFFND LG +GA  F+PLTVY+P+EM+I Q +I KY+ RW+ L++LS+
Sbjct  248  FVVVSTVLAIVLPFFNDILGFLGAIGFWPLTVYYPVEMYIRQRRIQKYTSRWVALQLLSF  307

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             C +VSL +A  SI+G+   +K Y PFK +
Sbjct  308  LCFLVSLASAVASIEGVTESLKHYVPFKTK  337



>ref|XP_009767545.1| PREDICTED: amino acid permease 3-like [Nicotiana sylvestris]
Length=480

 Score =   274 bits (701),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 161/208 (77%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + V  TT+FY+LCGC GYAAFG+ +PGN LTGFGFY P+WL+D ANV 
Sbjct  270  PSEAKTMKKATLLSVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANVA  329

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE    + +P +KFIT E +V +P F    +N FRLVWRT 
Sbjct  330  IVVHLVGAYQVYCQPLFAFVEKTAFEWYPSNKFITKELDVPIPGFKPFKLNLFRLVWRTI  389

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KIPK+S RWI L+ILS 
Sbjct  390  FVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKKIPKWSARWISLQILSG  449

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+S+ AAAGS  G+  D+K Y+PFK
Sbjct  450  ACLVISIAAAAGSFAGVVSDLKVYRPFK  477



>ref|XP_006654425.1| PREDICTED: amino acid permease 3-like [Oryza brachyantha]
Length=495

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 163/217 (75%), Gaps = 13/217 (6%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVM++A+ V V  TTLFY+LCGC GYAAFG+ APGN LTGFGFYEPFWL+D AN  
Sbjct  278  PSESKVMRRATIVSVAVTTLFYMLCGCSGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAA  337

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVP----------CFGTCSI  400
            I +HL+GAYQV+CQPLF+FVE    QRWP S++IT E +V +P          CF    +
Sbjct  338  IVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSRYITGEIDVPLPLPSSSGAGRRCF---RL  394

Query  399  NFFRLVWRTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSF  220
            N FRL WR+ +V+VT VV+M+ PFFND +G +GA  F+PLTVYFP+EM+I Q +IPK+S 
Sbjct  395  NLFRLTWRSAFVVVTTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKRIPKWST  454

Query  219  RWIWLKILSWTCLVVSLVAAAGSIQGLXXDVKTYKPF  109
            RW+ L++LS  CL++++ +AAGS+ G+  D+K YKPF
Sbjct  455  RWVCLQLLSLACLIITVASAAGSVAGIISDLKVYKPF  491



>emb|CAC51425.1| amino acid permease AAP4 [Vicia faba var. minor]
Length=481

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 161/208 (77%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + V  TT FY+LCGC GYAAFGN++PGN LTGFGFY PFWL+D AN  
Sbjct  271  PSESKTMKKATLISVIVTTFFYMLCGCFGYAAFGNSSPGNLLTGFGFYNPFWLLDIANAA  330

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHLIGAYQV+CQPLF+FVE+  ++R+PDS F+  + ++ +P      +N FRLVWRT 
Sbjct  331  IVIHLIGAYQVYCQPLFAFVENYTAKRFPDSDFVNKDVKIPIPGLDRYKLNLFRLVWRTV  390

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            YVI+T +++M+ PFFND +GL+GA  F+PLTVYFP+EM+I Q KIPK+S +WI L++LS 
Sbjct  391  YVILTTLISMLLPFFNDIVGLLGAIGFWPLTVYFPVEMYIIQKKIPKWSTKWICLQLLSG  450

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++++ A  GSI GL  D+K +KPFK
Sbjct  451  ACLIITIAATIGSIAGLILDLKVFKPFK  478



>ref|XP_006464914.1| PREDICTED: amino acid permease 2-like [Citrus sinensis]
Length=485

 Score =   274 bits (701),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  275  PAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANSA  334

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE + ++ WPDS F++ E+++ VP      +N FRLVWR+ 
Sbjct  335  IVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLFRLVWRSC  394

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI K+S RW+ L++LS 
Sbjct  395  FVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSM  454

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+S++A AGSI G+  DVK Y PFK
Sbjct  455  ACLVLSIIAGAGSIVGVVNDVKAYTPFK  482



>ref|XP_011074825.1| PREDICTED: amino acid permease 3-like [Sesamum indicum]
Length=484

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/208 (61%), Positives = 160/208 (77%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + V  TT+FY+ CGC GYAAFG+ +PGN LTGFGFY P+WL+D ANV 
Sbjct  274  PSEYKTMKKATLLSVAVTTIFYMSCGCFGYAAFGDMSPGNLLTGFGFYNPYWLLDIANVA  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHLIGAYQVFCQPLF+F+E    + +PDSKFIT E  + +P F    +N FRLVWRT 
Sbjct  334  IVIHLIGAYQVFCQPLFAFIEKTALEWFPDSKFITKEIAIPIPGFRAYKLNLFRLVWRTI  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIVT +++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q +IPK+S RW+ L+ILS 
Sbjct  394  FVIVTTIISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIKQKRIPKWSTRWVSLQILSV  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+S+ AAAGS  G+  D+K YKPFK
Sbjct  454  ACLVISVAAAAGSFAGVVSDLKVYKPFK  481



>ref|XP_006432100.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
 gb|ESR45340.1| hypothetical protein CICLE_v10000986mg [Citrus clementina]
Length=483

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 163/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ + +  TT FY+LCGC+GYAAFG+ APGN LTGFGFY PFWL+D AN  
Sbjct  273  PAESKTMKKAAKLSIAVTTAFYMLCGCMGYAAFGDFAPGNLLTGFGFYNPFWLLDIANSA  332

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+FVE + ++ WPDS F++ E+++ VP      +N FRLVWR+ 
Sbjct  333  IVVHLVGAYQVFCQPIFAFVEKQVAESWPDSYFLSKEFKIPVPGLLPYKLNLFRLVWRSC  392

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+IAQ KI K+S RW+ L++LS 
Sbjct  393  FVILTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIAQKKITKWSTRWMCLQMLSM  452

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+S++A AGSI G+  DVK Y PFK
Sbjct  453  ACLVLSIIAGAGSIVGVVNDVKAYTPFK  480



>ref|NP_001057853.1| Os06g0556000 [Oryza sativa Japonica Group]
 dbj|BAD53554.1| putative amino acid transporter [Oryza sativa Japonica Group]
 dbj|BAF19767.1| Os06g0556000 [Oryza sativa Japonica Group]
 gb|EAZ01325.1| hypothetical protein OsI_23356 [Oryza sativa Indica Group]
 gb|EAZ37338.1| hypothetical protein OsJ_21679 [Oryza sativa Japonica Group]
 dbj|BAG95706.1| unnamed protein product [Oryza sativa Japonica Group]
Length=487

 Score =   273 bits (699),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 162/210 (77%), Gaps = 2/210 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK MKKA+ +GV+TTT FY+LCGCLGYAAFGN APGN LTGFGFYEP+WLIDFANVC
Sbjct  279  PAENKTMKKATLLGVSTTTAFYMLCGCLGYAAFGNAAPGNMLTGFGFYEPYWLIDFANVC  338

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQP+F+ VE+  ++RWP S+FIT E  V      + S+N FRL WRT 
Sbjct  339  IVVHLVGAYQVFCQPIFAAVETFAARRWPGSEFITRERPVVAG--RSFSVNMFRLTWRTA  396

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V+V+ V+A++ PFFND LG +GA  F+PLTVY+P+EM+I Q +I +Y+ RW+ L+ LS 
Sbjct  397  FVVVSTVLAIVMPFFNDILGFLGAVGFWPLTVYYPVEMYIRQRRIQRYTSRWVALQTLSL  456

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             C +VSL +A  SI+G+   +K Y PFK +
Sbjct  457  LCFLVSLASAVASIEGVSESLKHYVPFKTK  486



>ref|XP_002968812.1| hypothetical protein SELMODRAFT_90661 [Selaginella moellendorffii]
 gb|EFJ29928.1| hypothetical protein SELMODRAFT_90661 [Selaginella moellendorffii]
Length=470

 Score =   273 bits (698),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 156/209 (75%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENK MKKA+ VGV TTT FY+  GC GYAAFGNNAPGN LTGFGFYEPFWLIDFAN C
Sbjct  262  PPENKTMKKATLVGVVTTTAFYMSVGCFGYAAFGNNAPGNLLTGFGFYEPFWLIDFANAC  321

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQP+F++VE     RWP +KF++  + + +P  G        LVWR+ 
Sbjct  322  IVIHLVGAYQVYCQPVFAYVEGHARSRWPKNKFVSHYFRIPIPLLGCYKFTLLTLVWRSA  381

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V+VT +V+M+ PFFND LGL+GA SF+PLTVYFPIEM+I Q  I ++S +WI LK L  
Sbjct  382  FVVVTTIVSMLLPFFNDVLGLLGAISFWPLTVYFPIEMYIKQRSIVRWSPKWIGLKALDL  441

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CL+VS+ A  GS++G+   +K Y PFK+
Sbjct  442  GCLLVSVAATLGSVEGIALSLKEYAPFKS  470



>ref|XP_009421017.1| PREDICTED: amino acid permease 3-like [Musa acuminata subsp. 
malaccensis]
Length=418

 Score =   271 bits (693),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 162/208 (78%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E KVMKKA+ V V  TT+FY+LCG +GYAAFG+ APGN LTGFGFYEP+WL+D AN  
Sbjct  211  PSEAKVMKKATLVSVAVTTIFYMLCGFMGYAAFGDLAPGNLLTGFGFYEPYWLLDIANTA  270

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQVFCQPLF+FVE   ++ WP+S+F+T E +V +    +  +N FRL WR  
Sbjct  271  IVIHLVGAYQVFCQPLFAFVEKWAARAWPNSEFVTREIQVPIASGTSYKLNLFRLTWRAV  330

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIVT V++M+ PFFND +G +GA  F+PLTVYFPIEM+I QTK+PK+S RW+ L++LS+
Sbjct  331  FVIVTTVISMLLPFFNDVVGFLGAIGFWPLTVYFPIEMYIVQTKVPKWSTRWVCLQLLSF  390

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++++ +AAGSI G+  D+K Y+PF 
Sbjct  391  ACLIITIASAAGSIAGVVSDLKVYRPFN  418



>ref|XP_006365537.1| PREDICTED: amino acid permease 3-like [Solanum tuberosum]
Length=473

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 162/209 (78%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MK+A+ + V  TT+FY+LCGC GYAAFG+ +PGN LTGFGFY P+WL+D ANV 
Sbjct  265  PAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANVA  324

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   ++ +PDSK IT E +V +P F    +N FRLVWRT 
Sbjct  325  IVVHLVGAYQVYCQPLFAFVEKTATEWYPDSKIITKEIDVPIPGFKPFKLNLFRLVWRTI  384

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q +I K+S RWI L+ILS 
Sbjct  385  FVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSGRWICLQILSG  444

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CLV+S+ AAAGS  G+  D+K Y+PF++
Sbjct  445  ACLVISIAAAAGSFAGVASDLKVYRPFQS  473



>gb|EMT07264.1| hypothetical protein F775_06597 [Aegilops tauschii]
Length=455

 Score =   272 bits (696),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 165/210 (79%), Gaps = 3/210 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P ENK M+KA+ +GV+TTT FY+LCGCLGY+AFGN+APGN LTGFGFYEP+WLIDFANVC
Sbjct  248  PAENKTMRKANLMGVSTTTAFYMLCGCLGYSAFGNDAPGNMLTGFGFYEPYWLIDFANVC  307

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQP+++ VES  + RWP+S+F+  +Y    P  G  S+N FRLVWRT 
Sbjct  308  IVVHLVGAYQVYCQPIYAAVESWAAGRWPNSEFVVRQYH---PFSGKFSLNMFRLVWRTA  364

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIV+ V+A+  PFFND LGL+GA  F+PLTVYFP+EM+I+Q+K+ KYS +W+ L+ LS+
Sbjct  365  FVIVSTVLAISLPFFNDILGLLGALGFWPLTVYFPVEMYISQSKMKKYSRKWVALQTLSF  424

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             C VV++     SIQG+   +K Y PFK +
Sbjct  425  ACFVVTVAVTVASIQGITQSLKNYVPFKTK  454



>gb|KDP34177.1| hypothetical protein JCGZ_07748 [Jatropha curcas]
Length=313

 Score =   268 bits (684),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 161/211 (76%), Gaps = 3/211 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            PPENKVMKKAS + V T+T FY++CGCLGYAAFGNNAPGN LTGFGFYEPFWLID AN+C
Sbjct  102  PPENKVMKKASAIAVFTSTSFYMMCGCLGYAAFGNNAPGNMLTGFGFYEPFWLIDLANLC  161

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPC-FGTC--SINFFRLVW  379
            I +HL+GAYQV  QP++S VES  S++WP+SK ++ EY +++      C  SIN  R++W
Sbjct  162  IVVHLLGAYQVLAQPVYSTVESWASKKWPNSKIVSKEYPLSLRIGKKDCNFSINLLRIIW  221

Query  378  RTGYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKI  199
            RT +V +  ++AM  PFFND L L+GA S++P+TVYFP+EM IAQ KI   S RW+ L++
Sbjct  222  RTTFVAIATLLAMALPFFNDILALLGAVSYWPMTVYFPVEMCIAQKKIRPQSLRWLGLEL  281

Query  198  LSWTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
            L+  C ++++V A  +IQGL   +KTYKPFK
Sbjct  282  LNLVCFLITIVVACSAIQGLNQGLKTYKPFK  312



>ref|XP_003568418.2| PREDICTED: amino acid permease 3-like isoform X1 [Brachypodium 
distachyon]
Length=488

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 160/208 (77%), Gaps = 4/208 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVM++A+ V V TTTLFY+LCGC+GYAAFG+ APGN LTGFGFYEPFWL+D AN  
Sbjct  282  PSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAA  341

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE    QRWP S FI  E EV+   FG   +N FRL WR+ 
Sbjct  342  IVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVS---FG-FKVNLFRLTWRSA  397

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V+ T VV+M+ PFFND +G +GA  F+PLTVYFP+EM+I Q KIP++  +W+ L++LS 
Sbjct  398  FVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKKIPRWGSQWVCLQLLSL  457

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+++ +AAGS+ G+  D+K YKPF 
Sbjct  458  ACLVITVASAAGSVAGIMSDLKVYKPFS  485



>gb|KEH30491.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   274 bits (700),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ V +  TT+FY+LCG +GYAAFG++ PGN LTGFGFY P+WL+D AN+ 
Sbjct  302  PSEHKTMKKATLVSIMVTTVFYLLCGGMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGAYQVF QP F+FVE   +++WP + F+TAE+E+ +PC G   +NFFRL+WRT 
Sbjct  362  IVVHLIGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIPCIGVYQLNFFRLIWRTL  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVY+PI+M+I+Q KI +++ +W+ L++LS 
Sbjct  422  FVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQMLSG  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++S++AA GSI G+  D+KTYKPFK
Sbjct  482  CCLIISILAAVGSIAGVVLDLKTYKPFK  509



>ref|XP_010231354.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
 ref|XP_010231355.1| PREDICTED: amino acid permease 3-like isoform X2 [Brachypodium 
distachyon]
Length=482

 Score =   273 bits (698),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 160/208 (77%), Gaps = 4/208 (2%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+KVM++A+ V V TTTLFY+LCGC+GYAAFG+ APGN LTGFGFYEPFWL+D AN  
Sbjct  276  PSESKVMRRATVVSVATTTLFYMLCGCMGYAAFGDEAPGNLLTGFGFYEPFWLLDVANAA  335

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE    QRWP S FI  E EV+   FG   +N FRL WR+ 
Sbjct  336  IVVHLVGAYQVYCQPLFAFVEKWAQQRWPKSSFIVGEIEVS---FG-FKVNLFRLTWRSA  391

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V+ T VV+M+ PFFND +G +GA  F+PLTVYFP+EM+I Q KIP++  +W+ L++LS 
Sbjct  392  FVVATTVVSMLLPFFNDVVGFLGALGFWPLTVYFPVEMYIVQKKIPRWGSQWVCLQLLSL  451

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CLV+++ +AAGS+ G+  D+K YKPF 
Sbjct  452  ACLVITVASAAGSVAGIMSDLKVYKPFS  479



>gb|KEH30492.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=512

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 167/208 (80%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E+K MKKA+ V +  TT+FY+LCG +GYAAFG++ PGN LTGFGFY P+WL+D AN+ 
Sbjct  302  PSEHKTMKKATLVSIMVTTVFYLLCGGMGYAAFGDHVPGNLLTGFGFYNPYWLLDIANLA  361

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HLIGAYQVF QP F+FVE   +++WP + F+TAE+E+ +PC G   +NFFRL+WRT 
Sbjct  362  IVVHLIGAYQVFSQPFFAFVEKWSARKWPKNNFVTAEHEIPIPCIGVYQLNFFRLIWRTL  421

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T ++AM+ PFFND +G++GA  F+PLTVY+PI+M+I+Q KI +++ +W+ L++LS 
Sbjct  422  FVLLTTIIAMLLPFFNDVVGILGAFGFWPLTVYYPIDMYISQKKIGRWTKKWLALQMLSG  481

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++S++AA GSI G+  D+KTYKPFK
Sbjct  482  CCLIISILAAVGSIAGVVLDLKTYKPFK  509



>ref|XP_011458812.1| PREDICTED: amino acid permease 3-like isoform X1 [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + V  TTLFY+LCGC+GYAAFG+ APGN LTGFGFY P+WL+D ANV 
Sbjct  276  PSEAKTMKKATTISVAVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVA  335

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   ++++PDS+FI+ E ++ VP  G C++N FRLVWRT 
Sbjct  336  IVVHLVGAYQVYCQPLFAFVEKAAAKKYPDSEFISREIKIPVPGLGHCNLNLFRLVWRTA  395

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIVT V++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IPK+S RW+ L+ILS 
Sbjct  396  FVIVTTVISMLLPFFNDVVGLLGAVGFWPLTVYFPVEMYIAQKRIPKWSTRWLCLQILSV  455

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++++ AAAGSI G+  D+KTYKPFK
Sbjct  456  ACLIITIAAAAGSIAGVISDLKTYKPFK  483



>ref|XP_004290907.1| PREDICTED: amino acid permease 3-like isoform X2 [Fragaria vesca 
subsp. vesca]
Length=484

 Score =   273 bits (698),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + V  TTLFY+LCGC+GYAAFG+ APGN LTGFGFY P+WL+D ANV 
Sbjct  274  PSEAKTMKKATTISVAVTTLFYMLCGCMGYAAFGDLAPGNLLTGFGFYNPYWLLDIANVA  333

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   ++++PDS+FI+ E ++ VP  G C++N FRLVWRT 
Sbjct  334  IVVHLVGAYQVYCQPLFAFVEKAAAKKYPDSEFISREIKIPVPGLGHCNLNLFRLVWRTA  393

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VIVT V++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IPK+S RW+ L+ILS 
Sbjct  394  FVIVTTVISMLLPFFNDVVGLLGAVGFWPLTVYFPVEMYIAQKRIPKWSTRWLCLQILSV  453

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL++++ AAAGSI G+  D+KTYKPFK
Sbjct  454  ACLIITIAAAAGSIAGVISDLKTYKPFK  481



>ref|XP_008442267.1| PREDICTED: amino acid permease 4-like [Cucumis melo]
Length=466

 Score =   272 bits (696),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 157/208 (75%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   +  TTLFY+LCGC+GYAAFGNNAPGN LTGFGFY PFWLID ANV 
Sbjct  256  PSEAKTMKKATTFSIILTTLFYLLCGCMGYAAFGNNAPGNLLTGFGFYNPFWLIDIANVA  315

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV  QP+F+FVE + +Q WPDS FI  +Y++++      +IN FRL WRT 
Sbjct  316  IVVHLVGAYQVLSQPIFAFVEKKAAQAWPDSPFINKDYKLSISSSRLYNINLFRLFWRTL  375

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V  T  +AM+ PFFND +G+IGA  F+PLTVYFPI+M+I Q KIP++S +WI ++ +S 
Sbjct  376  FVCFTTTIAMLIPFFNDIVGIIGALQFWPLTVYFPIQMYIVQKKIPQWSVKWICVQTMSV  435

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             CL+VSL AA GSI G+  D+K YKPFK
Sbjct  436  GCLLVSLAAAVGSISGVMLDLKVYKPFK  463



>gb|KJB75356.1| hypothetical protein B456_012G038000 [Gossypium raimondii]
Length=519

 Score =   274 bits (700),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 164/209 (78%), Gaps = 1/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + +  TT+FY+LCG +GYA+FG+ APGN LTGFGF+ PFWL+D AN  
Sbjct  308  PEEAKTMKKATKLSIAVTTVFYMLCGSMGYASFGDFAPGNLLTGFGFFNPFWLLDIANAA  367

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGT-CSINFFRLVWRT  373
            I IHL+GAYQVFCQP+F+F+E   +QRWP+S FIT E+++ VP +     +N FRLVWRT
Sbjct  368  IIIHLVGAYQVFCQPIFAFIEKWATQRWPESYFITKEFKIPVPGYRHPYKLNMFRLVWRT  427

Query  372  GYVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILS  193
            G+V++T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q KI K+S RWI LK+LS
Sbjct  428  GFVMLTTVISMLLPFFNDVVGILGALGFWPLTVYFPVEMYIQQKKISKWSSRWICLKMLS  487

Query  192  WTCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
              CL++S+VA AGSI G+  D+K YKPFK
Sbjct  488  MACLMISIVAGAGSIVGVILDLKVYKPFK  516



>ref|XP_009390075.1| PREDICTED: amino acid permease 4-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   273 bits (698),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E KVMKKAS   +  TT+FY+LCGC+GYAAFG+ APGN LTGFGFY P+WL+D AN  
Sbjct  285  PSEAKVMKKASLTSIAVTTIFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPYWLLDVANAA  344

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQPLF+F+E      WPDS FIT E  V +P      ++ FRLVWR+ 
Sbjct  345  IVVHLVGAYQVFCQPLFAFIEKWALTTWPDSAFITKEVAVPLPSTKRYRLSLFRLVWRSA  404

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T V++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IP++S RW+ L+ILS 
Sbjct  405  FVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKRIPRWSTRWVCLQILSL  464

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+++ AA GS+ G+  D++ Y+PFK+ 
Sbjct  465  ACLVITVAAAIGSVAGVVTDLEAYRPFKSS  494



>ref|XP_010322323.1| PREDICTED: amino acid transporter isoform X1 [Solanum lycopersicum]
Length=473

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 121/209 (58%), Positives = 162/209 (78%), Gaps = 0/209 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MK+A+ + V  TT+FY+LCGC GYAAFG+ +PGN LTGFGFY P+WL+D AN+ 
Sbjct  265  PAEAKTMKRATLISVAVTTVFYMLCGCFGYAAFGDQSPGNLLTGFGFYNPYWLLDIANIA  324

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQV+CQPLF+FVE   ++ +PDSK IT E +V +P F    +N FRLVWRT 
Sbjct  325  IVVHLVGAYQVYCQPLFAFVEKTAAEWYPDSKIITKEIDVPIPGFKPFKLNLFRLVWRTI  384

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI+T V++M+ PFFND +G++GA  F+PLTVYFP+EM+I Q +I K+S RWI L+ILS 
Sbjct  385  FVIITTVISMLMPFFNDVVGILGAFGFWPLTVYFPVEMYIVQKRITKWSARWICLQILSG  444

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKA  103
             CLV+S+ AAAGS  G+  D+K Y+PF++
Sbjct  445  ACLVISIAAAAGSFAGVVSDLKVYRPFQS  473



>ref|XP_003630316.1| Amino acid permease [Medicago truncatula]
 gb|AET04792.1| transmembrane amino acid transporter family protein [Medicago 
truncatula]
Length=475

 Score =   272 bits (696),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 161/210 (77%), Gaps = 3/210 (1%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+ + +  TT+FY+LCGC+GYAAFG++APGN LTGFGFY P+WLID AN  
Sbjct  268  PSEAKSMKKATKISIAVTTVFYMLCGCMGYAAFGDDAPGNLLTGFGFYNPYWLIDIANAA  327

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVF QP+F+FVE   +QRWP+   I  EY++ +PC     +N FR++WRT 
Sbjct  328  IVVHLVGAYQVFSQPIFAFVEKSATQRWPN---IEKEYKIELPCLPPYKLNLFRMLWRTV  384

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V +T V++M+ PFFND +G+IGA  F+PLTVYFP+EM+IAQ KIPK++ +WI L+I S+
Sbjct  385  FVTLTTVISMLLPFFNDIVGVIGALGFWPLTVYFPVEMYIAQKKIPKWNKKWICLQIFSF  444

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLVVS+ AA GSI G+  D+K Y PF++ 
Sbjct  445  ACLVVSIAAAVGSIAGVLVDLKKYTPFQSS  474



>gb|KDO68037.1| hypothetical protein CISIN_1g010376mg [Citrus sinensis]
Length=381

 Score =   270 bits (689),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 161/210 (77%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E K MKKA+   +  TT FY+LCGC+GYAAFG+ AP N LTGFGFY P+WLID AN  
Sbjct  171  PAEYKTMKKATLFSIIVTTTFYLLCGCMGYAAFGDLAPNNLLTGFGFYNPYWLIDIANAA  230

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQPLF+FVE   +++WP S  +TAEYE+ +P +G   +N FRLVWRT 
Sbjct  231  IVVHLVGAYQVFCQPLFAFVEKWSAKKWPKSDLVTAEYEIPIPFWGVYQLNLFRLVWRTL  290

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T +++M+ PFFND +G++GA  F+PLTVYFPIEM+ AQ KI + + RW+ L+IL+ 
Sbjct  291  FVVLTTLISMLLPFFNDVVGILGAMGFWPLTVYFPIEMYKAQKKIGRGTTRWLGLQILNV  350

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
            +C  ++LVAA GS+ G+  D+KTYKPFK +
Sbjct  351  SCFFITLVAAIGSVAGVVLDLKTYKPFKTR  380



>ref|XP_009390074.1| PREDICTED: amino acid permease 4-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=509

 Score =   273 bits (699),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 120/210 (57%), Positives = 160/210 (76%), Gaps = 0/210 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E KVMKKAS   +  TT+FY+LCGC+GYAAFG+ APGN LTGFGFY P+WL+D AN  
Sbjct  299  PSEAKVMKKASLTSIAVTTIFYMLCGCMGYAAFGDEAPGNLLTGFGFYNPYWLLDVANAA  358

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVFCQPLF+F+E      WPDS FIT E  V +P      ++ FRLVWR+ 
Sbjct  359  IVVHLVGAYQVFCQPLFAFIEKWALTTWPDSAFITKEVAVPLPSTKRYRLSLFRLVWRSA  418

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +V++T V++M+ PFFND +GL+GA  F+PLTVYFP+EM+IAQ +IP++S RW+ L+ILS 
Sbjct  419  FVVLTTVISMLLPFFNDVVGLLGALGFWPLTVYFPVEMYIAQKRIPRWSTRWVCLQILSL  478

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFKAQ  100
             CLV+++ AA GS+ G+  D++ Y+PFK+ 
Sbjct  479  ACLVITVAAAIGSVAGVVTDLEAYRPFKSS  508



>ref|XP_007143143.1| hypothetical protein PHAVU_007G047400g [Phaseolus vulgaris]
 gb|ESW15137.1| hypothetical protein PHAVU_007G047400g [Phaseolus vulgaris]
Length=466

 Score =   272 bits (695),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 158/208 (76%), Gaps = 0/208 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E   MKKA+  G++ TT FY+LCG LGY AFGN APGNFLTGFGFYEP+WL+D  NV 
Sbjct  259  PSERGAMKKATVTGISITTFFYLLCGLLGYEAFGNKAPGNFLTGFGFYEPYWLVDIGNVF  318

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I +HL+GAYQVF QP+F+ VES  + RWP+SK IT EY V +P  GT  +N FR++WRT 
Sbjct  319  IVVHLVGAYQVFSQPVFTLVESWSAGRWPESKIITKEYGVGIPLVGTFRLNVFRVIWRTV  378

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI T V+AMI PFFN  +GL+GA +F+PL VYFP  M++ Q ++PK+S  W  +K+L+ 
Sbjct  379  FVIFTVVIAMILPFFNSIVGLLGAIAFWPLAVYFPTHMYLVQAEVPKFSMVWNGIKLLNV  438

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPFK  106
             C +VSLVAAAGSIQG+  D+KTYKPF+
Sbjct  439  FCFIVSLVAAAGSIQGIITDLKTYKPFQ  466



>ref|XP_003542145.1| PREDICTED: amino acid permease 3 isoform X1 [Glycine max]
 ref|XP_006593825.1| PREDICTED: amino acid permease 3 isoform X2 [Glycine max]
 ref|XP_006593826.1| PREDICTED: amino acid permease 3 isoform X3 [Glycine max]
 gb|KHN05187.1| Amino acid permease 2 [Glycine soja]
Length=479

 Score =   272 bits (696),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = -1

Query  729  PPENKVMKKASGVGVTTTTLFYVLCGCLGYAAFGNNAPGNFLTGFGFYEPFWLIDFANVC  550
            P E++ M KA+ + V  TT+FY+LCGC GYA+FG+ +PGN LTGFGFY PFWLID AN  
Sbjct  269  PAESETMSKATLISVLVTTVFYMLCGCFGYASFGDASPGNLLTGFGFYNPFWLIDIANAG  328

Query  549  IAIHLIGAYQVFCQPLFSFVESRCSQRWPDSKFITAEYEVNVPCFGTCSINFFRLVWRTG  370
            I IHL+GAYQV+CQPLFSFVES  ++R+P+S F++ E+EV +P      +N FRLVWRT 
Sbjct  329  IVIHLVGAYQVYCQPLFSFVESNAAERFPNSDFMSREFEVPIPGCKPYKLNLFRLVWRTL  388

Query  369  YVIVTAVVAMIFPFFNDFLGLIGAASFYPLTVYFPIEMHIAQTKIPKYSFRWIWLKILSW  190
            +VI++ V+AM+ PFFND +GLIGA  F+PLTVY P+EM+I QTKIPK+  +WI L++LS 
Sbjct  389  FVILSTVIAMLLPFFNDIVGLIGAIGFWPLTVYLPVEMYITQTKIPKWGIKWIGLQMLSV  448

Query  189  TCLVVSLVAAAGSIQGLXXDVKTYKPF  109
             C V++++AAAGSI G+  D+K YKPF
Sbjct  449  ACFVITILAAAGSIAGVIDDLKVYKPF  475



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1313813971470