BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038E13

Length=531
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610279.1|  PREDICTED: probable rhamnose biosynthetic en...    155   5e-41   Nicotiana tomentosiformis
ref|XP_004248232.1|  PREDICTED: probable rhamnose biosynthetic en...    153   4e-40   Solanum lycopersicum
ref|XP_004303854.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    153   5e-40   Fragaria vesca subsp. vesca
ref|XP_011098163.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    152   7e-40   Sesamum indicum [beniseed]
gb|KJB61502.1|  hypothetical protein B456_009G362500                    152   7e-40   Gossypium raimondii
ref|XP_006477360.1|  PREDICTED: probable rhamnose biosynthetic en...    148   8e-40   Citrus sinensis [apfelsine]
emb|CBI20105.3|  unnamed protein product                                145   8e-40   Vitis vinifera
gb|KHG29785.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    152   8e-40   Gossypium arboreum [tree cotton]
gb|ADB24773.1|  rhamnose synthase                                       152   8e-40   Gossypium hirsutum [American cotton]
gb|KHN18614.1|  Putative rhamnose biosynthetic enzyme 1                 149   1e-39   Glycine soja [wild soybean]
ref|XP_009776312.1|  PREDICTED: probable rhamnose biosynthetic en...    152   1e-39   Nicotiana sylvestris
ref|XP_009421279.1|  PREDICTED: probable rhamnose biosynthetic en...    152   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009590265.1|  PREDICTED: probable rhamnose biosynthetic en...    152   1e-39   Nicotiana tomentosiformis
ref|XP_010671686.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    151   2e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|AAC32137.1|  hypothetical protein                                    146   2e-39   Picea mariana [black spruce]
gb|EMT23371.1|  Putative rhamnose biosynthetic enzyme 1                 151   3e-39   
gb|EMS59810.1|  putative rhamnose biosynthetic enzyme 1                 151   3e-39   Triticum urartu
ref|XP_006440508.1|  hypothetical protein CICLE_v10021340mg             146   3e-39   Citrus clementina [clementine]
dbj|BAJ97692.1|  predicted protein                                      150   4e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009783771.1|  PREDICTED: probable rhamnose biosynthetic en...    150   4e-39   Nicotiana sylvestris
ref|XP_008342373.1|  PREDICTED: probable rhamnose biosynthetic en...    150   4e-39   Malus domestica [apple tree]
ref|XP_008356500.1|  PREDICTED: probable rhamnose biosynthetic en...    140   4e-39   
ref|XP_004137224.1|  PREDICTED: probable rhamnose biosynthetic en...    150   6e-39   Cucumis sativus [cucumbers]
ref|XP_008451740.1|  PREDICTED: probable rhamnose biosynthetic en...    150   6e-39   Cucumis melo [Oriental melon]
ref|XP_009376726.1|  PREDICTED: probable rhamnose biosynthetic en...    150   6e-39   Pyrus x bretschneideri [bai li]
ref|XP_003571828.1|  PREDICTED: probable rhamnose biosynthetic en...    150   8e-39   Brachypodium distachyon [annual false brome]
gb|ABK22031.1|  unknown                                                 145   8e-39   Picea sitchensis
gb|KHG07031.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    150   8e-39   Gossypium arboreum [tree cotton]
ref|XP_010924680.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    150   8e-39   Elaeis guineensis
ref|XP_008792282.1|  PREDICTED: probable rhamnose biosynthetic en...    150   8e-39   Phoenix dactylifera
gb|KHG05296.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    145   9e-39   Gossypium arboreum [tree cotton]
gb|ADB24772.1|  rhamnose synthase                                       149   9e-39   Gossypium hirsutum [American cotton]
gb|KDO49287.1|  hypothetical protein CISIN_1g005941mg                   149   9e-39   Citrus sinensis [apfelsine]
ref|XP_003546628.1|  PREDICTED: probable rhamnose biosynthetic en...    149   9e-39   Glycine max [soybeans]
gb|ACJ11713.1|  UDP-L-rhamnose synthase                                 145   9e-39   Gossypium hirsutum [American cotton]
ref|XP_010675264.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    149   9e-39   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB20764.1|  hypothetical protein B456_003G163300                    145   9e-39   Gossypium raimondii
ref|XP_006360030.1|  PREDICTED: probable rhamnose biosynthetic en...    149   1e-38   Solanum tuberosum [potatoes]
ref|XP_006442344.1|  hypothetical protein CICLE_v10019182mg             149   1e-38   Citrus clementina [clementine]
ref|XP_010675265.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    149   1e-38   Beta vulgaris subsp. vulgaris [field beet]
gb|ADB24764.1|  UDP-L-rhamnose synthase                                 144   1e-38   Gossypium hirsutum [American cotton]
emb|CDY71423.1|  BnaCnng72830D                                          147   1e-38   Brassica napus [oilseed rape]
ref|XP_009377674.1|  PREDICTED: probable rhamnose biosynthetic en...    149   1e-38   Pyrus x bretschneideri [bai li]
ref|XP_010537694.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    149   1e-38   Tarenaya hassleriana [spider flower]
ref|XP_004244296.1|  PREDICTED: probable rhamnose biosynthetic en...    149   2e-38   Solanum lycopersicum
ref|XP_001781616.1|  predicted protein                                  144   2e-38   
ref|XP_002454480.1|  hypothetical protein SORBIDRAFT_04g031900          144   2e-38   Sorghum bicolor [broomcorn]
ref|XP_010473526.1|  PREDICTED: probable rhamnose biosynthetic en...    144   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_007215006.1|  hypothetical protein PRUPE_ppa002417mg             149   2e-38   Prunus persica
ref|XP_008229395.1|  PREDICTED: probable rhamnose biosynthetic en...    149   2e-38   Prunus mume [ume]
ref|XP_008380229.1|  PREDICTED: probable rhamnose biosynthetic en...    149   2e-38   Malus domestica [apple tree]
gb|KHN29165.1|  Putative rhamnose biosynthetic enzyme 1                 148   2e-38   Glycine soja [wild soybean]
ref|XP_009356652.1|  PREDICTED: probable rhamnose biosynthetic en...    149   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_003549868.1|  PREDICTED: probable rhamnose biosynthetic en...    144   2e-38   Glycine max [soybeans]
ref|XP_006477818.1|  PREDICTED: probable rhamnose biosynthetic en...    149   2e-38   Citrus sinensis [apfelsine]
ref|XP_003531412.1|  PREDICTED: probable rhamnose biosynthetic en...    148   2e-38   Glycine max [soybeans]
emb|CDP06058.1|  unnamed protein product                                148   2e-38   Coffea canephora [robusta coffee]
ref|XP_011082806.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    148   2e-38   Sesamum indicum [beniseed]
ref|XP_002282339.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    144   2e-38   Vitis vinifera
gb|KHN36936.1|  Putative rhamnose biosynthetic enzyme 1                 148   3e-38   Glycine soja [wild soybean]
ref|XP_006585327.1|  PREDICTED: probable rhamnose biosynthetic en...    149   3e-38   
ref|XP_003543185.1|  PREDICTED: probable rhamnose biosynthetic en...    148   3e-38   Glycine max [soybeans]
ref|XP_006585326.1|  PREDICTED: probable rhamnose biosynthetic en...    149   3e-38   Glycine max [soybeans]
ref|XP_006647099.1|  PREDICTED: probable rhamnose biosynthetic en...    148   3e-38   Oryza brachyantha
ref|XP_006389974.1|  hypothetical protein EUTSA_v10018232mg             148   3e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010417456.1|  PREDICTED: probable rhamnose biosynthetic en...    148   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010429684.1|  PREDICTED: probable rhamnose biosynthetic en...    148   3e-38   
ref|XP_004298763.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    144   3e-38   Fragaria vesca subsp. vesca
ref|XP_009106565.1|  PREDICTED: probable rhamnose biosynthetic en...    148   3e-38   Brassica rapa
gb|KJB45831.1|  hypothetical protein B456_007G332000                    148   4e-38   Gossypium raimondii
ref|XP_004953442.1|  PREDICTED: probable rhamnose biosynthetic en...    144   4e-38   Setaria italica
ref|XP_010533730.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    143   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_010430376.1|  PREDICTED: probable rhamnose biosynthetic en...    143   5e-38   Camelina sativa [gold-of-pleasure]
emb|CDX88455.1|  BnaC06g38990D                                          148   5e-38   
emb|CAN79484.1|  hypothetical protein VITISV_006441                     144   5e-38   Vitis vinifera
ref|XP_002887744.1|  RHM1/ROL1                                          147   5e-38   
ref|XP_004294169.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    147   6e-38   Fragaria vesca subsp. vesca
ref|XP_004169238.1|  PREDICTED: probable rhamnose biosynthetic en...    144   6e-38   
gb|KFK43526.1|  hypothetical protein AALP_AA1G137100                    143   6e-38   Arabis alpina [alpine rockcress]
emb|CDY45969.1|  BnaA09g12970D                                          143   6e-38   Brassica napus [oilseed rape]
ref|XP_010062770.1|  PREDICTED: probable rhamnose biosynthetic en...    147   6e-38   Eucalyptus grandis [rose gum]
emb|CDY45471.1|  BnaC09g12890D                                          143   6e-38   Brassica napus [oilseed rape]
ref|XP_011072055.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    143   7e-38   Sesamum indicum [beniseed]
ref|XP_002887985.1|  hypothetical protein ARALYDRAFT_893174             143   7e-38   Arabidopsis lyrata subsp. lyrata
gb|AAM65668.1|  unknown                                                 142   7e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391796.1|  hypothetical protein EUTSA_v10023613mg             142   7e-38   Eutrema salsugineum [saltwater cress]
ref|XP_010108054.1|  putative rhamnose biosynthetic enzyme 1            142   8e-38   Morus notabilis
ref|XP_010418304.1|  PREDICTED: probable rhamnose biosynthetic en...    142   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006857961.1|  hypothetical protein AMTR_s00069p00173700          142   8e-38   Amborella trichopoda
ref|NP_564806.1|  UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-re...    142   8e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62450.1|AF387005_1  Unknown protein                               142   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010273412.1|  PREDICTED: probable rhamnose biosynthetic en...    147   8e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006348335.1|  PREDICTED: probable rhamnose biosynthetic en...    147   9e-38   Solanum tuberosum [potatoes]
gb|ACG28244.1|  dTDP-4-dehydrorhamnose reductase                        142   9e-38   Zea mays [maize]
ref|XP_004488984.1|  PREDICTED: probable rhamnose biosynthetic en...    147   9e-38   
ref|XP_004143938.1|  PREDICTED: probable rhamnose biosynthetic en...    142   9e-38   Cucumis sativus [cucumbers]
ref|XP_007213598.1|  hypothetical protein PRUPE_ppa002453mg             147   9e-38   Prunus persica
gb|ADB24774.1|  rhamnose synthase                                       147   1e-37   Gossypium hirsutum [American cotton]
ref|XP_006647684.1|  PREDICTED: probable rhamnose biosynthetic en...    142   1e-37   Oryza brachyantha
gb|KJB75445.1|  hypothetical protein B456_012G042300                    147   1e-37   Gossypium raimondii
ref|XP_006302532.1|  hypothetical protein CARUB_v10020632mg             142   1e-37   
emb|CAN62061.1|  hypothetical protein VITISV_001928                     146   1e-37   Vitis vinifera
ref|XP_009400458.1|  PREDICTED: probable rhamnose biosynthetic en...    142   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU36941.1|  hypothetical protein MIMGU_mgv1a010842mg                142   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_006484833.1|  PREDICTED: probable rhamnose biosynthetic en...    146   1e-37   Citrus sinensis [apfelsine]
gb|KHN19477.1|  Putative rhamnose biosynthetic enzyme 1                 146   1e-37   Glycine soja [wild soybean]
ref|XP_003540514.1|  PREDICTED: probable rhamnose biosynthetic en...    146   1e-37   Glycine max [soybeans]
ref|XP_010272587.1|  PREDICTED: probable rhamnose biosynthetic en...    142   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009113029.1|  PREDICTED: probable rhamnose biosynthetic en...    142   1e-37   Brassica rapa
emb|CDP09826.1|  unnamed protein product                                142   1e-37   Coffea canephora [robusta coffee]
ref|XP_008437195.1|  PREDICTED: probable rhamnose biosynthetic en...    142   1e-37   Cucumis melo [Oriental melon]
ref|NP_001152718.1|  LOC100286359                                       142   2e-37   Zea mays [maize]
emb|CDY57072.1|  BnaCnng31530D                                          142   2e-37   Brassica napus [oilseed rape]
ref|XP_008226345.1|  PREDICTED: probable rhamnose biosynthetic en...    146   2e-37   Prunus mume [ume]
ref|XP_009620292.1|  PREDICTED: probable rhamnose biosynthetic en...    141   2e-37   Nicotiana tomentosiformis
gb|KDP30504.1|  hypothetical protein JCGZ_17141                         146   2e-37   Jatropha curcas
ref|XP_010933908.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    142   2e-37   
ref|XP_007155573.1|  hypothetical protein PHAVU_003G213400g             141   2e-37   Phaseolus vulgaris [French bean]
ref|XP_002271970.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    145   2e-37   Vitis vinifera
ref|XP_006306947.1|  hypothetical protein CARUB_v10008513mg             146   2e-37   Capsella rubella
ref|XP_009766426.1|  PREDICTED: probable rhamnose biosynthetic en...    141   2e-37   Nicotiana sylvestris
ref|XP_010035897.1|  PREDICTED: probable rhamnose biosynthetic en...    146   2e-37   Eucalyptus grandis [rose gum]
ref|XP_010109352.1|  putative rhamnose biosynthetic enzyme 1            146   2e-37   Morus notabilis
ref|XP_006301908.1|  hypothetical protein CARUB_v10022384mg             145   2e-37   Capsella rubella
ref|NP_177978.1|  UDP-L-rhamnose synthase                               145   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010552134.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    145   2e-37   Tarenaya hassleriana [spider flower]
gb|KHN09737.1|  Putative rhamnose biosynthetic enzyme 1                 144   3e-37   Glycine soja [wild soybean]
ref|XP_002440852.1|  hypothetical protein SORBIDRAFT_09g008220          145   3e-37   
ref|XP_002509687.1|  NAD dependent epimerase/dehydratase, putative      141   3e-37   Ricinus communis
gb|KJB27003.1|  hypothetical protein B456_004G271200                    145   3e-37   Gossypium raimondii
gb|ACJ11756.1|  rhamnose synthase                                       145   3e-37   Gossypium hirsutum [American cotton]
gb|KJB12934.1|  hypothetical protein B456_002G046200                    145   3e-37   Gossypium raimondii
ref|XP_009148579.1|  PREDICTED: probable rhamnose biosynthetic en...    141   3e-37   Brassica rapa
ref|XP_007149511.1|  hypothetical protein PHAVU_005G076400g             145   3e-37   Phaseolus vulgaris [French bean]
ref|XP_007209407.1|  hypothetical protein PRUPE_ppa009264mg             141   3e-37   Prunus persica
emb|CDY40003.1|  BnaC05g13120D                                          145   3e-37   Brassica napus [oilseed rape]
ref|XP_010255576.1|  PREDICTED: probable rhamnose biosynthetic en...    141   4e-37   Nelumbo nucifera [Indian lotus]
ref|XP_010933909.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    141   4e-37   
ref|NP_001130297.1|  uncharacterized protein LOC100191391               145   4e-37   Zea mays [maize]
ref|XP_006437200.1|  hypothetical protein CICLE_v10030887mg             145   4e-37   
gb|ACG33666.1|  RHM1                                                    145   4e-37   Zea mays [maize]
gb|EEC73782.1|  hypothetical protein OsI_08465                          141   4e-37   Oryza sativa Indica Group [Indian rice]
ref|NP_001173114.1|  Os02g0678400                                       141   4e-37   
gb|KDP25530.1|  hypothetical protein JCGZ_20686                         140   4e-37   Jatropha curcas
ref|XP_002285634.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    145   5e-37   Vitis vinifera
ref|XP_009362849.1|  PREDICTED: probable rhamnose biosynthetic en...    139   5e-37   Pyrus x bretschneideri [bai li]
ref|XP_010535018.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    145   5e-37   Tarenaya hassleriana [spider flower]
gb|KFK40550.1|  hypothetical protein AALP_AA2G010500                    140   5e-37   Arabis alpina [alpine rockcress]
gb|ACU23112.1|  unknown                                                 140   5e-37   Glycine max [soybeans]
ref|XP_006407044.1|  hypothetical protein EUTSA_v10020227mg             145   5e-37   
ref|XP_008381928.1|  PREDICTED: probable rhamnose biosynthetic en...    140   5e-37   
ref|XP_008348787.1|  PREDICTED: probable rhamnose biosynthetic en...    140   6e-37   
ref|XP_009395981.1|  PREDICTED: probable rhamnose biosynthetic en...    144   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010093448.1|  putative rhamnose biosynthetic enzyme 1            144   6e-37   Morus notabilis
gb|KDO60921.1|  hypothetical protein CISIN_1g005818mg                   144   6e-37   Citrus sinensis [apfelsine]
ref|NP_001049724.1|  Os03g0278200                                       144   7e-37   
emb|CDX98494.1|  BnaC05g38810D                                          144   7e-37   
gb|KCW77625.1|  hypothetical protein EUGRSUZ_D01934                     140   7e-37   Eucalyptus grandis [rose gum]
emb|CDP05404.1|  unnamed protein product                                136   7e-37   Coffea canephora [robusta coffee]
ref|XP_010915435.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    144   7e-37   Elaeis guineensis
ref|XP_010501002.1|  PREDICTED: probable rhamnose biosynthetic en...    144   8e-37   Camelina sativa [gold-of-pleasure]
ref|XP_004984748.1|  PREDICTED: probable rhamnose biosynthetic en...    144   8e-37   Setaria italica
ref|XP_001775697.1|  predicted protein                                  144   8e-37   
ref|XP_010553490.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    140   9e-37   Tarenaya hassleriana [spider flower]
ref|XP_009389578.1|  PREDICTED: probable rhamnose biosynthetic en...    140   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001766894.1|  predicted protein                                  144   9e-37   
ref|XP_004138882.1|  PREDICTED: probable rhamnose biosynthetic en...    144   9e-37   
gb|AAK82539.1|  At1g53500/F22G10_13                                     143   9e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791880.1|  PREDICTED: probable rhamnose biosynthetic en...    144   9e-37   Phoenix dactylifera
ref|XP_009394841.1|  PREDICTED: probable rhamnose biosynthetic en...    144   9e-37   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY35137.1|  BnaA06g11470D                                          144   9e-37   Brassica napus [oilseed rape]
ref|XP_009346674.1|  PREDICTED: probable rhamnose biosynthetic en...    139   1e-36   
emb|CDP22060.1|  unnamed protein product                                141   1e-36   Coffea canephora [robusta coffee]
gb|EYU26294.1|  hypothetical protein MIMGU_mgv1a002474mg                144   1e-36   Erythranthe guttata [common monkey flower]
ref|XP_010053354.1|  PREDICTED: probable rhamnose biosynthetic en...    139   1e-36   Eucalyptus grandis [rose gum]
ref|XP_009149137.1|  PREDICTED: probable rhamnose biosynthetic en...    144   1e-36   Brassica rapa
ref|XP_006370064.1|  hypothetical protein POPTR_0001s39210g             144   1e-36   Populus trichocarpa [western balsam poplar]
ref|XP_002531238.1|  NAD dependent epimerase/dehydratase, putative      143   1e-36   
emb|CDP18722.1|  unnamed protein product                                144   1e-36   Coffea canephora [robusta coffee]
gb|KHG22077.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    144   1e-36   Gossypium arboreum [tree cotton]
ref|NP_564633.2|  putative NDP-L-rhamnose synthase                      144   1e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002468080.1|  hypothetical protein SORBIDRAFT_01g039220          144   1e-36   Sorghum bicolor [broomcorn]
ref|XP_010502125.1|  PREDICTED: probable rhamnose biosynthetic en...    144   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010465388.1|  PREDICTED: probable rhamnose biosynthetic en...    144   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002317559.2|  NAD-dependent epimerase/dehydratase family p...    144   1e-36   
ref|XP_010479911.1|  PREDICTED: probable rhamnose biosynthetic en...    144   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010487282.1|  PREDICTED: probable rhamnose biosynthetic en...    143   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010462242.1|  PREDICTED: probable rhamnose biosynthetic en...    144   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007158451.1|  hypothetical protein PHAVU_002G153500g             139   1e-36   Phaseolus vulgaris [French bean]
emb|CDX97601.1|  BnaA05g24780D                                          143   2e-36   
emb|CDY20084.1|  BnaA01g29180D                                          143   2e-36   Brassica napus [oilseed rape]
ref|XP_011029152.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    139   2e-36   Populus euphratica
ref|XP_011006811.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    143   2e-36   Populus euphratica
ref|XP_010676576.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    139   2e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009394163.1|  PREDICTED: probable rhamnose biosynthetic en...    143   2e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009146324.1|  PREDICTED: probable rhamnose biosynthetic en...    143   2e-36   Brassica rapa
gb|KEH38548.1|  rhamnose biosynthetic-like enzyme                       143   2e-36   Medicago truncatula
ref|XP_008238760.1|  PREDICTED: probable rhamnose biosynthetic en...    141   2e-36   
ref|XP_002299567.1|  hypothetical protein POPTR_0001s08570g             139   2e-36   Populus trichocarpa [western balsam poplar]
ref|XP_003570100.1|  PREDICTED: probable rhamnose biosynthetic en...    139   2e-36   Brachypodium distachyon [annual false brome]
ref|XP_002882893.1|  hypothetical protein ARALYDRAFT_478892             143   2e-36   
ref|XP_004984749.1|  PREDICTED: probable rhamnose biosynthetic en...    143   2e-36   Setaria italica
ref|XP_008445073.1|  PREDICTED: probable rhamnose biosynthetic en...    143   2e-36   Cucumis melo [Oriental melon]
gb|KHG15836.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    143   3e-36   Gossypium arboreum [tree cotton]
ref|XP_007022008.1|  Rhamnose biosynthesis 1                            143   3e-36   Theobroma cacao [chocolate]
ref|XP_008373757.1|  PREDICTED: probable rhamnose biosynthetic en...    138   3e-36   
ref|XP_006297150.1|  hypothetical protein CARUB_v10013153mg             142   4e-36   Capsella rubella
ref|XP_008776517.1|  PREDICTED: probable rhamnose biosynthetic en...    138   4e-36   Phoenix dactylifera
emb|CDY32340.1|  BnaC01g36590D                                          142   4e-36   Brassica napus [oilseed rape]
ref|XP_004960685.1|  PREDICTED: probable rhamnose biosynthetic en...    142   4e-36   Setaria italica
ref|XP_002894444.1|  mucilage-modified 4                                142   4e-36   
ref|XP_007040092.1|  Nucleotide-rhamnose synthase/epimerase-reduc...    138   4e-36   
ref|XP_002303557.1|  hypothetical protein POPTR_0003s12000g             138   4e-36   Populus trichocarpa [western balsam poplar]
ref|XP_011033826.1|  PREDICTED: bifunctional dTDP-4-dehydrorhamno...    138   5e-36   Populus euphratica
ref|XP_006358852.1|  PREDICTED: probable rhamnose biosynthetic en...    138   5e-36   Solanum tuberosum [potatoes]
ref|XP_004498563.1|  PREDICTED: probable rhamnose biosynthetic en...    142   5e-36   Cicer arietinum [garbanzo]
gb|EYU38237.1|  hypothetical protein MIMGU_mgv1a002436mg                142   5e-36   Erythranthe guttata [common monkey flower]
ref|XP_006845495.1|  hypothetical protein AMTR_s00019p00150410          142   6e-36   Amborella trichopoda
ref|XP_003588651.1|  Rhamnose synthase                                  142   6e-36   Medicago truncatula
ref|XP_008776518.1|  PREDICTED: probable rhamnose biosynthetic en...    137   6e-36   
ref|NP_188097.1|  rhamnose biosynthetic enzyme 3                        142   6e-36   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98052.1|  BnaA06g08030D                                          138   6e-36   
ref|XP_010268536.1|  PREDICTED: probable rhamnose biosynthetic en...    142   7e-36   Nelumbo nucifera [Indian lotus]
ref|XP_002468088.1|  hypothetical protein SORBIDRAFT_01g039340          142   7e-36   Sorghum bicolor [broomcorn]
gb|EMT13548.1|  Putative rhamnose biosynthetic enzyme 1                 137   8e-36   
gb|EMS50143.1|  putative rhamnose biosynthetic enzyme 1                 137   8e-36   Triticum urartu
gb|KEH17189.1|  rhamnose biosynthetic-like enzyme                       142   8e-36   Medicago truncatula
ref|XP_011045548.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    141   9e-36   Populus euphratica
gb|EPS68271.1|  hypothetical protein M569_06499                         137   9e-36   Genlisea aurea
ref|XP_006392784.1|  hypothetical protein EUTSA_v10011290mg             141   1e-35   Eutrema salsugineum [saltwater cress]
dbj|BAJ95321.1|  predicted protein                                      137   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008380346.1|  PREDICTED: probable rhamnose biosynthetic en...    141   1e-35   Malus domestica [apple tree]
ref|XP_006649857.1|  PREDICTED: probable rhamnose biosynthetic en...    141   1e-35   Oryza brachyantha
ref|XP_001775602.1|  predicted protein                                  140   2e-35   
ref|XP_004509959.1|  PREDICTED: probable rhamnose biosynthetic en...    140   2e-35   Cicer arietinum [garbanzo]
ref|XP_010060763.1|  PREDICTED: probable rhamnose biosynthetic en...    140   2e-35   Eucalyptus grandis [rose gum]
ref|XP_007011619.1|  Rhamnose biosynthesis 1                            140   2e-35   
emb|CDY45116.1|  BnaC06g06370D                                          140   2e-35   Brassica napus [oilseed rape]
emb|CDY24092.1|  BnaA06g00900D                                          140   2e-35   Brassica napus [oilseed rape]
ref|XP_008365831.1|  PREDICTED: probable rhamnose biosynthetic en...    137   2e-35   
ref|XP_007048831.1|  Rhamnose biosynthesis 1 isoform 1                  140   2e-35   
ref|XP_001779703.1|  predicted protein                                  140   3e-35   
gb|AFK41450.1|  unknown                                                 136   3e-35   Medicago truncatula
ref|NP_001151455.1|  RHM1                                               140   3e-35   Zea mays [maize]
gb|EMS45937.1|  putative rhamnose biosynthetic enzyme 1                 140   4e-35   Triticum urartu
dbj|BAJ86835.1|  predicted protein                                      140   4e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009356708.1|  PREDICTED: probable rhamnose biosynthetic en...    140   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_009586858.1|  PREDICTED: probable rhamnose biosynthetic en...    139   5e-35   Nicotiana tomentosiformis
ref|XP_009803668.1|  PREDICTED: probable rhamnose biosynthetic en...    139   5e-35   Nicotiana sylvestris
ref|XP_004515790.1|  PREDICTED: probable rhamnose biosynthetic en...    134   1e-34   Cicer arietinum [garbanzo]
ref|XP_008220004.1|  PREDICTED: probable rhamnose biosynthetic en...    138   1e-34   Prunus mume [ume]
ref|XP_008393937.1|  PREDICTED: probable rhamnose biosynthetic en...    138   1e-34   
ref|XP_009363628.1|  PREDICTED: probable rhamnose biosynthetic en...    138   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_009144768.1|  PREDICTED: probable rhamnose biosynthetic en...    138   1e-34   Brassica rapa
emb|CDY60210.1|  BnaCnng35880D                                          138   1e-34   Brassica napus [oilseed rape]
ref|XP_004245662.1|  PREDICTED: probable rhamnose biosynthetic en...    134   2e-34   Solanum lycopersicum
ref|XP_008654228.1|  PREDICTED: probable rhamnose biosynthetic en...    138   2e-34   
ref|XP_006355193.1|  PREDICTED: probable rhamnose biosynthetic en...    137   2e-34   Solanum tuberosum [potatoes]
ref|XP_002965630.1|  hypothetical protein SELMODRAFT_439393             134   2e-34   Selaginella moellendorffii
ref|XP_010916151.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    137   2e-34   Elaeis guineensis
gb|EPS62084.1|  hypothetical protein M569_12709                         137   3e-34   Genlisea aurea
ref|XP_011031381.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    137   4e-34   Populus euphratica
ref|XP_007161328.1|  hypothetical protein PHAVU_001G060400g             136   6e-34   Phaseolus vulgaris [French bean]
ref|XP_004292875.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    136   8e-34   Fragaria vesca subsp. vesca
ref|XP_009147602.1|  PREDICTED: probable rhamnose biosynthetic en...    136   9e-34   Brassica rapa
ref|XP_007225132.1|  hypothetical protein PRUPE_ppa002547mg             135   9e-34   Prunus persica
ref|XP_003545554.1|  PREDICTED: probable rhamnose biosynthetic en...    135   1e-33   Glycine max [soybeans]
ref|XP_006382137.1|  hypothetical protein POPTR_0006s28750g             135   1e-33   Populus trichocarpa [western balsam poplar]
emb|CBI24007.3|  unnamed protein product                                135   3e-33   Vitis vinifera
ref|XP_003551160.1|  PREDICTED: probable rhamnose biosynthetic en...    134   4e-33   
gb|KHN30780.1|  Putative rhamnose biosynthetic enzyme 1                 134   4e-33   Glycine soja [wild soybean]
ref|XP_010325193.1|  PREDICTED: probable rhamnose biosynthetic en...    133   9e-33   
ref|XP_008812156.1|  PREDICTED: probable rhamnose biosynthetic en...    133   1e-32   Phoenix dactylifera
ref|XP_006450198.1|  hypothetical protein CICLE_v10010306mg             132   2e-32   
gb|KDO67325.1|  hypothetical protein CISIN_1g035631mg                   132   2e-32   Citrus sinensis [apfelsine]
ref|XP_006483733.1|  PREDICTED: probable rhamnose biosynthetic en...    130   9e-32   
gb|AAL74389.1|AF359121_1  putative dTDP-glucose 4,6-dehydratase         117   1e-30   Pinus sylvestris [Scotch pine]
ref|XP_001695032.1|  predicted protein                                  122   7e-30   Chlamydomonas reinhardtii
ref|XP_002955639.1|  hypothetical protein VOLCADRAFT_76853              121   1e-29   Volvox carteri f. nagariensis
gb|KIZ02088.1|  putative rhamnose biosynthetic enzyme 1                 121   1e-29   
ref|XP_011395817.1|  putative rhamnose biosynthetic enzyme 1            119   7e-29   
ref|XP_002964674.1|  hypothetical protein SELMODRAFT_266803             122   8e-29   
ref|XP_002989472.1|  hypothetical protein SELMODRAFT_129972             121   1e-28   
ref|XP_009776239.1|  PREDICTED: probable rhamnose biosynthetic en...    115   1e-28   
ref|XP_010497682.1|  PREDICTED: probable rhamnose biosynthetic en...    110   2e-27   
gb|KHN18103.1|  Putative rhamnose biosynthetic enzyme 1                 117   4e-27   
ref|XP_003551914.1|  PREDICTED: probable rhamnose biosynthetic en...    117   4e-27   
gb|KDD74838.1|  hypothetical protein H632_c1041p0                       114   5e-27   
ref|XP_005851985.1|  hypothetical protein CHLNCDRAFT_132889             113   8e-27   
emb|CDX81794.1|  BnaC08g38070D                                          111   9e-26   
ref|XP_005648979.1|  NAD-dependent epimerase/dehydratase                108   6e-25   
gb|ACF82647.1|  unknown                                                 102   6e-25   
emb|CDY72469.1|  BnaCnng77810D                                          102   3e-24   
emb|CDY25708.1|  BnaC03g69670D                                          103   5e-24   
ref|XP_007146360.1|  hypothetical protein PHAVU_006G034000g             108   6e-24   
gb|KHM99622.1|  Putative rhamnose biosynthetic enzyme 1                 106   3e-23   
ref|XP_007514013.1|  predicted protein                                  104   2e-22   
gb|EMT06313.1|  hypothetical protein F775_00857                       99.4    4e-22   
ref|XP_007508076.1|  predicted protein                                  102   6e-22   
ref|XP_003057320.1|  predicted protein                                  102   6e-22   
ref|XP_003084264.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose s...    102   8e-22   
emb|CEG01892.1|  NAD-dependent epimerase/dehydratase                    102   1e-21   
ref|XP_002500589.1|  predicted protein                                  102   1e-21   
dbj|BAD95054.1|  dTDP-glucose 4,6-dehydratase                         93.2    3e-21   
ref|WP_038308628.1|  hypothetical protein                             97.1    9e-21   
ref|XP_006579608.1|  PREDICTED: probable rhamnose biosynthetic en...  94.7    2e-20   
gb|KHN34442.1|  Putative rhamnose biosynthetic enzyme 1               94.7    2e-20   
ref|XP_002184144.1|  predicted protein                                90.9    1e-18   
ref|XP_009039633.1|  hypothetical protein AURANDRAFT_38303            90.9    1e-18   
gb|EJK71347.1|  hypothetical protein THAOC_07228                      90.1    2e-18   
ref|XP_004255825.1|  NAD dependent epimerase/dehydratase, putative    90.1    2e-18   
emb|CBK21796.2|  unnamed protein product                              89.7    3e-18   
emb|CCG81053.1|  Putative uncharacterized protein                     89.4    4e-18   
ref|XP_002290334.1|  hypothetical protein THAPSDRAFT_40788            89.0    6e-18   
ref|XP_009036108.1|  hypothetical protein AURANDRAFT_25417            87.8    2e-17   
ref|XP_005535009.1|  similar to dTDP-4-dehydrorhamnose reductase      87.0    2e-17   
ref|XP_005537979.1|  similar to dTDP-4-dehydrorhamnose reductase      87.0    2e-17   
ref|XP_004350645.1|  3,5-epimerase/4-reductase                        86.7    3e-17   
ref|XP_005537191.1|  similar to dTDP-4-dehydrorhamnose reductase      87.4    4e-17   
ref|XP_005536684.1|  similar to dTDP-4-dehydrorhamnose reductase      87.4    4e-17   
emb|CBN77585.1|  conserved unknown protein                            84.7    2e-16   
gb|EME44168.1|  hypothetical protein DOTSEDRAFT_80011                 86.7    2e-16   
ref|XP_003290007.1|  hypothetical protein DICPUDRAFT_92411            82.0    2e-16   
ref|XP_005707655.1|  dTDP-4-dehydrorhamnose reductase                 84.0    3e-16   
dbj|GAM19914.1|  hypothetical protein SAMD00019534_030890             82.8    8e-16   
gb|EWM28830.1|  epimerase 4-reductase                                 82.4    1e-15   
ref|XP_001738724.1|  NAD dependent epimerase/dehydratase              82.0    1e-15   
ref|XP_655810.1|  hypothetical protein                                81.6    2e-15   
ref|XP_004337383.1|  NAD dependent epimerase/dehydratase              81.3    2e-15   
ref|XP_008714317.1|  hypothetical protein HMPREF1541_01738            79.7    1e-14   
gb|EPQ67692.1|  hypothetical protein BGT96224_2262                    79.3    1e-14   
ref|XP_007297111.1|  NAD dependent epimerase/dehydratase              78.6    2e-14   
ref|XP_001740296.1|  NAD dependent epimerase/dehydratase              77.4    4e-14   
emb|CCU81848.1|  oxidoreductase                                       77.4    5e-14   
gb|KIM94722.1|  hypothetical protein OIDMADRAFT_45649                 77.0    7e-14   
ref|XP_008080873.1|  NAD(P)-binding Rossmann-fold containing protein  76.6    1e-13   
gb|KDB11056.1|  epimerase hydratase                                   76.6    1e-13   
gb|KIN02359.1|  hypothetical protein OIDMADRAFT_162496                75.5    2e-13   
gb|ELR09735.1|  hypothetical protein GMDG_04221                       75.9    2e-13   
gb|KFZ06505.1|  hypothetical protein V501_07336                       75.5    2e-13   
gb|EFX02264.1|  NAD dependent epimerase                               75.5    3e-13   
ref|XP_002836423.1|  hypothetical protein                             75.5    3e-13   
gb|KFY36191.1|  hypothetical protein V494_05248                       75.1    3e-13   
ref|XP_009316561.1|  putative NAD dependent epimerase/dehydratase     73.9    3e-13   
gb|KFY09897.1|  hypothetical protein V492_05296                       75.1    3e-13   
gb|KFY97158.1|  hypothetical protein V498_02227                       75.1    3e-13   
gb|KFY19093.1|  hypothetical protein V493_08151                       75.1    3e-13   
dbj|GAM88309.1|  hypothetical protein ANO11243_063420                 75.1    4e-13   
ref|XP_001560439.1|  conserved hypothetical protein                   74.7    5e-13   
emb|CCF32593.1|  NAD dependent epimerase/dehydratase                  74.7    5e-13   
ref|XP_001596309.1|  hypothetical protein SS1G_02529                  74.7    5e-13   
ref|XP_003852439.1|  hypothetical protein MYCGRDRAFT_42346            74.7    5e-13   
gb|ESZ91842.1|  NAD dependent epimerase/dehydratase                   74.3    6e-13   
ref|XP_007600700.1|  NAD dependent epimerase/dehydratase              74.3    7e-13   
dbj|GAM86456.1|  hypothetical protein ANO11243_044700                 74.3    7e-13   
gb|KHJ31736.1|  putative nad dependent epimerase dehydratase          73.9    8e-13   
ref|XP_011109886.1|  hypothetical protein H072_3926                   73.9    1e-12   
ref|XP_007677597.1|  hypothetical protein BAUCODRAFT_72815            73.9    1e-12   
gb|ERT00514.1|  hypothetical protein HMPREF1624_03887                 73.2    2e-12   
ref|XP_007287733.1|  nrs er                                           73.2    2e-12   
gb|KIH91052.1|  NAD dependent epimerase                               73.2    2e-12   
gb|EMF10916.1|  NAD(P)-binding protein                                75.5    2e-12   
gb|ENH87674.1|  NRS/ER protein                                        73.2    2e-12   
gb|EPE08529.1|  nad dependent epimerase dehydratase                   73.2    2e-12   
gb|ESL08135.1|  hypothetical protein TRSC58_04167                     73.6    2e-12   
ref|XP_011117055.1|  hypothetical protein AOL_s00004g103              73.2    2e-12   
gb|KFY72535.1|  hypothetical protein V499_07319                       75.5    2e-12   
gb|KFZ00250.1|  hypothetical protein V500_01119                       75.5    2e-12   
gb|EGU73824.1|  hypothetical protein FOXB_15664                       72.8    2e-12   
gb|KFY47503.1|  hypothetical protein V496_10620                       75.5    2e-12   
gb|EFQ31859.1|  NAD dependent epimerase/dehydratase                   73.2    2e-12   
gb|KFZ25372.1|  hypothetical protein V502_00138                       75.5    2e-12   
gb|KDN67016.1|  putative NAD dependent epimerase/dehydratase          72.8    2e-12   
gb|EWG55514.1|  dTDP-glucose 4,6-dehydratase                          73.2    2e-12   
gb|KFY00697.1|  hypothetical protein O988_03147                       75.1    2e-12   
gb|KFX89483.1|  hypothetical protein V490_06984                       75.1    2e-12   
gb|EQB44511.1|  NAD dependent epimerase/dehydratase                   72.8    2e-12   
emb|CEJ87406.1|  Putative NAD(P)-binding Rossmann-fold containing...  72.8    3e-12   
ref|XP_005826217.1|  hypothetical protein GUITHDRAFT_89166            72.8    3e-12   
gb|KEZ41460.1|  hypothetical protein SAPIO_CDS7601                    72.4    3e-12   
gb|KEQ68917.1|  UDP-4-keto-6-deoxy-glucose-3,5-epimerase/ UDP-4-k...  72.4    3e-12   
ref|XP_644280.1|  hypothetical protein DDB_G0274991                   70.9    4e-12   
gb|EKG05279.1|  hypothetical protein TCSYLVIO_003649                  72.0    4e-12   
ref|XP_007912887.1|  putative nad dependent epimerase dehydratase...  72.4    4e-12   
ref|XP_009226599.1|  hypothetical protein GGTG_10462                  72.0    4e-12   
ref|XP_003345125.1|  hypothetical protein SMAC_07414                  70.9    5e-12   
ref|XP_009853280.1|  hypothetical protein NEUTE1DRAFT_85761           71.6    9e-12   
ref|XP_809019.1|  hypothetical protein                                71.2    9e-12   
ref|XP_001905352.1|  hypothetical protein                             70.9    1e-11   
gb|KEQ63324.1|  NAD(P)-binding protein                                70.9    1e-11   
ref|XP_007833569.1|  hypothetical protein PFICI_06797                 70.9    1e-11   
ref|XP_006695147.1|  hypothetical protein CTHT_0047820                70.9    1e-11   
gb|EQL02571.1|  nrs/er                                                70.5    1e-11   
gb|EFA81899.1|  nucleoporin 133                                       73.2    1e-11   
gb|EKF33998.1|  hypothetical protein MOQ_002402                       70.9    1e-11   
ref|XP_003709861.1|  hypothetical protein MGG_09238                   70.5    2e-11   
ref|XP_009657319.1|  NRS/ER protein                                   70.5    2e-11   
ref|XP_003002732.1|  NRS/ER                                           70.5    2e-11   
gb|EYU36944.1|  hypothetical protein MIMGU_mgv1a018499mg              69.3    2e-11   
gb|KFK23178.1|  hypothetical protein AALP_AAs48438U000100             67.4    2e-11   
ref|XP_007790279.1|  putative nad dependent epimerase dehydratase...  69.7    2e-11   
ref|XP_003044390.1|  hypothetical protein NECHADRAFT_45826            71.6    3e-11   
gb|EXA35094.1|  dTDP-glucose 4,6-dehydratase                          69.7    3e-11   
ref|XP_001728253.1|  NRS/ER                                           69.7    3e-11   
gb|ENH75980.1|  Putative rhamnose biosynthetic enzyme 1               69.7    4e-11   
ref|XP_811455.1|  hypothetical protein                                69.7    4e-11   
gb|EGU75305.1|  hypothetical protein FOXB_14184                       69.7    4e-11   
gb|EHK39821.1|  hypothetical protein TRIATDRAFT_91570                 69.3    5e-11   
gb|EHK25374.1|  hypothetical protein TRIVIDRAFT_31920                 68.9    5e-11   
ref|XP_006966750.1|  predicted protein                                68.9    5e-11   
gb|EXK76106.1|  dTDP-glucose 4,6-dehydratase                          68.6    7e-11   
gb|EXK77723.1|  dTDP-glucose 4,6-dehydratase                          68.6    9e-11   
ref|XP_003665385.1|  epimerase/hydratase                              67.8    1e-10   
ref|XP_001226132.1|  hypothetical protein CHGG_10865                  67.8    2e-10   
gb|KEQ94116.1|  hypothetical protein AUEXF2481DRAFT_30662             67.4    2e-10   
ref|XP_003654153.1|  hypothetical protein THITE_2049831               67.0    3e-10   
gb|EWZ30417.1|  dTDP-glucose 4,6-dehydratase                          66.6    3e-10   
ref|XP_001762762.1|  predicted protein                                63.2    3e-10   
gb|EWY82942.1|  dTDP-glucose 4,6-dehydratase                          67.0    3e-10   
gb|EXL51745.1|  dTDP-glucose 4,6-dehydratase                          67.0    4e-10   
ref|XP_011320564.1|  hypothetical protein FGSG_13414                  66.2    4e-10   
gb|KEQ81263.1|  NAD(P)-binding protein                                65.5    5e-10   
gb|EYB25340.1|  hypothetical protein FG05_13414                       65.9    6e-10   
gb|EXK35798.1|  dTDP-glucose 4,6-dehydratase                          65.9    1e-09   
ref|XP_007929610.1|  hypothetical protein MYCFIDRAFT_34055            65.5    2e-09   
gb|EMD97212.1|  hypothetical protein COCHEDRAFT_1150873               64.7    2e-09   
ref|XP_007682126.1|  hypothetical protein COCMIDRAFT_31392            64.3    3e-09   
dbj|GAA90292.1|  NRS/ER                                               63.5    3e-09   
dbj|GAD98334.1|  hypothetical protein PVAR5_7026                      63.9    4e-09   
gb|KFK24330.1|  hypothetical protein AALP_AAs39635U000100             60.5    5e-09   
ref|XP_009260961.1|  hypothetical protein FPSE_09569                  61.2    3e-08   
gb|KHN44082.1|  Putative rhamnose biosynthetic enzyme 1               61.2    5e-08   
gb|EQK99925.1|  NRS/ER protein                                        60.8    5e-08   
ref|YP_003987312.1|  uncharacterized dTDP-4-dehydrorhamnose reduc...  58.2    3e-07   
ref|XP_008610981.1|  hypothetical protein, variant                    57.4    3e-07   
gb|KDO16909.1|  hypothetical protein SPRG_17627                       58.2    4e-07   
gb|KDO24436.1|  hypothetical protein SPRG_09826                       57.4    6e-07   
ref|XP_008610980.1|  hypothetical protein SDRG_06946                  57.0    9e-07   
ref|XP_007806273.1|  hypothetical protein EPUS_08498                  53.9    1e-05   
ref|XP_007795746.1|  putative nrs er protein                          51.2    1e-05   
ref|XP_003663944.1|  epimerase/hydratase                              50.8    2e-04   
gb|EYE93584.1|  hypothetical protein EURHEDRAFT_404003                49.7    3e-04   
gb|EKD94030.1|  hypothetical protein ACD_28C00004G0011                48.9    5e-04   



>ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=674

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/91 (84%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DPAF WANF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKKYIDPAFTWANFTLEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLPIKESLIKYVFEPNKKT  672



>ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
 ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
Length=674

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 80/91 (88%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DPAF +ANF++EEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDPAFTYANFTVEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLSIKESLIKYVFEPNKKT  672



>ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Fragaria vesca subsp. vesca]
Length=679

 Score =   153 bits (387),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYKKY+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SVEMAKRNLKGIWNFTNPGVVSHNEILEMYKKYIDPSFKWVNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLSIKESLIKYVFEPNKKT  672



>ref|XP_011098163.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
 ref|XP_011098164.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
Length=675

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDPDFKWANFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELLSIK+S IKYV EPNRK
Sbjct  642  MDASKLKKEFPELLSIKDSLIKYVFEPNRK  671



>gb|KJB61502.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=667

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKKYIDPKFQWANFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN++T
Sbjct  637  MDASKLKKEFPELLPIKESLIKYVFEPNKRT  667



>ref|XP_006477360.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
 gb|KDO63611.1| hypothetical protein CISIN_1g022112mg [Citrus sinensis]
Length=302

 Score =   148 bits (373),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRQYIDPNFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  269  LDASKLKTEFPELLSIKESLIKYVFEPNKKT  299



>emb|CBI20105.3| unnamed protein product [Vitis vinifera]
Length=192

 Score =   145 bits (365),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMYK Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  99   SIEMAKRNCRGIWNFTNPGVVSHNEILEMYKSYIDPNFKWANFTLEEQAKVIVAARSNNE  158

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELL IK+S IKYV EPN+K+
Sbjct  159  MDASKLKNEFPELLPIKDSLIKYVFEPNQKS  189



>gb|KHG29785.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKKYIDPKFQWANFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN++T
Sbjct  637  MDASKLKKEFPELLPIKESLIKYVFEPNKRT  667



>gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   152 bits (385),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKKYIDPKFQWANFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN++T
Sbjct  637  MDASKLKKEFPELLPIKESLIKYVFEPNKRT  667



>gb|KHN18614.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=353

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  263  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYIDPNFKWANFTLEEQAKVIVAPRSNNE  322

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  323  MDASKLKTEFPELLSIKESLIKYVFEPNKKT  353



>ref|XP_009776312.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=671

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F WANF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYKKYINPDFTWANFTLEEQAKVIVAARSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES +KYV EPNRKT
Sbjct  639  MDASKLKKEFPELLPIKESLVKYVFEPNRKT  669



>ref|XP_009421279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=678

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMYKKY+DP+F WANF+LEEQAKVIVA RSNNE
Sbjct  581  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYKKYIDPSFKWANFTLEEQAKVIVAPRSNNE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPEL SIKES IKYV EPNRK
Sbjct  641  MDASKLKKEFPELCSIKESLIKYVFEPNRK  670



>ref|XP_009590265.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009590274.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=671

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F WANF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFTWANFTLEEQAKVIVAARSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES +KYV EPNRKT
Sbjct  639  MDASKLKKEFPELLPIKESLVKYVFEPNRKT  669



>ref|XP_010671686.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=675

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK YMDP F WANF+LEEQAKVIVA RSNNE
Sbjct  581  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYMDPNFSWANFTLEEQAKVIVAPRSNNE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IK+S IKYV EPN+KT
Sbjct  641  MDASKLKKEFPELLHIKDSLIKYVFEPNKKT  671



>gb|AAC32137.1| hypothetical protein [Picea mariana]
Length=271

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP++ W NF+LEEQAKVIVA RSNNE
Sbjct  178  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPSYTWRNFTLEEQAKVIVAARSNNE  237

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELL IKES +KYV EPN+K
Sbjct  238  MDASKLKKEFPELLPIKESLVKYVFEPNQK  267



>gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=667

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYKKYMDP++ W NF+LEEQAKVIVA RSNNE
Sbjct  574  SVEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYMDPSYKWTNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK+EFPELLSIK+S IKYV EPNRK
Sbjct  634  MDATKLKREFPELLSIKDSLIKYVFEPNRK  663



>gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=667

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYKKYMDP++ W NF+LEEQAKVIVA RSNNE
Sbjct  574  SVEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYMDPSYKWTNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK+EFPELLSIK+S IKYV EPNRK
Sbjct  634  MDATKLKREFPELLSIKDSLIKYVFEPNRK  663



>ref|XP_006440508.1| hypothetical protein CICLE_v10021340mg [Citrus clementina]
 gb|ESR53748.1| hypothetical protein CICLE_v10021340mg [Citrus clementina]
Length=302

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI E+Y++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEIYRQYIDPNFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  269  LDASKLKTEFPELLSIKESLIKYVFEPNKKT  299



>dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYKKYMDP++ W NF+LEEQAKVIVA RSNNE
Sbjct  574  SVEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYMDPSYKWTNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK+EFPELLSIK+S IKYV EPNRK
Sbjct  634  MDAAKLKREFPELLSIKDSLIKYVFEPNRK  663



>ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=674

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F WANF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYKKYINPEFTWANFTLEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLPIKESLIKYVFEPNKKT  672



>ref|XP_008342373.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   150 bits (380),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYKKY+DP+F W NF++EEQAKVIVA RSNNE
Sbjct  582  SVEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDPSFKWTNFTVEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLPIKESLIKYVFEPNKKT  672



>ref|XP_008356500.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=104

 Score =   140 bits (353),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL G +NFT  GVV HNEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  11   SIEMAKRNLTGTYNFTNPGVVSHNEILEMYKEYIDPSFSYKNFTLEEQAKVIVAPRSNNE  70

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V +PN+KT
Sbjct  71   LDASKLKKEFPELLSIKESLIKNVFKPNQKT  101



>ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus]
Length=670

 Score =   150 bits (379),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDPEFKWANFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPE+L IKES IKYV EPN+KT
Sbjct  638  MDASKLKNEFPEMLGIKESLIKYVFEPNKKT  668



>ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
Length=670

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDPEFKWANFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPE+L IKES IKYV EPN+KT
Sbjct  638  MDASKLKNEFPEMLGIKESLIKYVFEPNKKT  668



>ref|XP_009376726.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009376727.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Pyrus x bretschneideri]
Length=668

 Score =   150 bits (378),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKQYIDPKFTWANFTLEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+K 
Sbjct  638  MDASKLKKEFPELLPIKESLIKYVFEPNKKV  668



>ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
 ref|XP_010234080.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=667

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYKKY+DP++ W NF+LEEQAKVIVA RSNNE
Sbjct  574  SVEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYLDPSYKWTNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLKKEFPELLSIK+S +KYV EPNRK
Sbjct  634  MDATKLKKEFPELLSIKDSLVKYVFEPNRK  663



>gb|ABK22031.1| unknown [Picea sitchensis]
Length=300

 Score =   145 bits (366),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP++ W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPSYTWRNFTLEEQAKVIVAARSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES +KYV EPN+K 
Sbjct  267  MDASKLKKEFPELLPIKESLVKYVFEPNQKV  297



>gb|KHG07031.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKTYIDPKFKWENFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPNR+T
Sbjct  637  MDASKLKKEFPELLSIKESLIKYAFEPNRRT  667



>ref|XP_010924680.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Elaeis guineensis]
Length=673

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRN  GIWNFT  G V HNEI EMYKKY+DP+F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SVEMAKRNCRGIWNFTNPGAVSHNEILEMYKKYIDPSFTWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIKES IKYV EPNRK
Sbjct  640  MDASKLKSEFPELLSIKESLIKYVFEPNRK  669



>ref|XP_008792282.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRN  GIWNFT  G V HNEI EMYKKYMDP+F W NF+LEEQAKVIVA RSNNE
Sbjct  580  SVEMAKRNCRGIWNFTNPGAVSHNEILEMYKKYMDPSFAWVNFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPNRK 
Sbjct  640  MDASKLKSEFPELLSIKESLIKYVFEPNRKV  670



>gb|KHG05296.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=300

 Score =   145 bits (366),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMGKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFTWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPELLSIKES IKYV EPN+KT
Sbjct  267  LDATKLKTEFPELLSIKESLIKYVFEPNKKT  297



>gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKTYIDPKFKWENFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPNR+T
Sbjct  637  MDASKLKKEFPELLSIKESLIKYAFEPNRRT  667



>gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
 gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
Length=668

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIK+S IKYV EPN+KT
Sbjct  638  MDASKLKKEFPELLSIKDSLIKYVFEPNKKT  668



>ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
 ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=668

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYRDYIDPNFKWANFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  638  MDASKLKTEFPELLSIKESLIKYVFEPNKKT  668



>gb|ACJ11713.1| UDP-L-rhamnose synthase [Gossypium hirsutum]
Length=300

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMGKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFTWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPELLSIKES IKYV EPN+KT
Sbjct  267  LDATKLKTEFPELLSIKESLIKYVFEPNKKT  297



>ref|XP_010675264.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   149 bits (377),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK YMDP F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYMDPNFSWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKL KEFPELL IK+S IKYV EPN+KT
Sbjct  640  MDASKLNKEFPELLHIKDSLIKYVFEPNKKT  670



>gb|KJB20764.1| hypothetical protein B456_003G163300 [Gossypium raimondii]
Length=300

 Score =   145 bits (365),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMGKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFTWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPELLSIKES IKYV EPN+KT
Sbjct  267  LDATKLKTEFPELLSIKESLIKYVFEPNKKT  297



>ref|XP_006360030.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360031.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DPAF +ANF++EEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDPAFTYANFTVEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IK V EPN+KT
Sbjct  642  MDASKLKKEFPELLSIKESLIKNVFEPNKKT  672



>ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
Length=668

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIK+S IKYV EPN+KT
Sbjct  638  MDASKLKKEFPELLSIKDSLIKYVFEPNKKT  668



>ref|XP_010675265.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675266.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675267.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   149 bits (377),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK YMDP F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYMDPNFSWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKL KEFPELL IK+S IKYV EPN+KT
Sbjct  640  MDASKLNKEFPELLHIKDSLIKYVFEPNKKT  670



>gb|ADB24764.1| UDP-L-rhamnose synthase [Gossypium hirsutum]
Length=300

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMGKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFTWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPELLSIKES +KYV EPN+KT
Sbjct  267  LDATKLKTEFPELLSIKESLVKYVFEPNKKT  297



>emb|CDY71423.1| BnaCnng72830D, partial [Brassica napus]
Length=431

 Score =   147 bits (371),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  341  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNE  400

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  401  MDASKLKKEFPELLSIKESLIKYAFEPNKKT  431



>ref|XP_009377674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP+F W NF++EEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIDPSFKWTNFTVEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLPIKESLIKYVFEPNKKT  672



>ref|XP_010537694.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=670

 Score =   149 bits (376),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ YMDP+F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLKGIWNFTNPGAVSHNEILEMYRDYMDPSFEWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+ T
Sbjct  640  MDASKLKGEFPELLSIKESLIKYVFEPNKTT  670



>ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=674

 Score =   149 bits (376),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/91 (81%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKKYINPEFKWSNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IK V EPNRKT
Sbjct  642  MDASKLKKEFPELLSIKESLIKNVFEPNRKT  672



>ref|XP_001781616.1| predicted protein [Physcomitrella patens]
 ref|XP_001781618.1| predicted protein [Physcomitrella patens]
 gb|EDQ53572.1| predicted protein [Physcomitrella patens]
 gb|EDQ53574.1| predicted protein [Physcomitrella patens]
Length=300

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKEYVDPSFTYKNFTLEEQAKVIVAARSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKL KEFPE+L IKES IKYV EPN+KT
Sbjct  267  LDASKLSKEFPEMLPIKESLIKYVFEPNKKT  297



>ref|XP_002454480.1| hypothetical protein SORBIDRAFT_04g031900 [Sorghum bicolor]
 gb|EES07456.1| hypothetical protein SORBIDRAFT_04g031900 [Sorghum bicolor]
Length=307

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  214  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPSFSWKNFNLEEQAKVIVAPRSNNE  273

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK+EFPELLSIKES IKYV EPN KT
Sbjct  274  LDQTKLKREFPELLSIKESLIKYVFEPNCKT  304



>ref|XP_010473526.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=304

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  210  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  269

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IKYV EPN+KT
Sbjct  270  LDATKLKTEFPELMSIKESLIKYVFEPNKKT  300



>ref|XP_007215006.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
 gb|EMJ16205.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
Length=675

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL G+WNFT  GVV HNEI EMYKKY+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SVEMAKRNLRGLWNFTNPGVVSHNEILEMYKKYIDPSFKWTNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELL IKES IKYV EPN+K
Sbjct  642  MDASKLKKEFPELLPIKESLIKYVFEPNKK  671



>ref|XP_008229395.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=669

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL G+WNFT  GVV HNEI EMYKKY+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  576  SVEMAKRNLRGLWNFTNPGVVSHNEILEMYKKYIDPSFKWTNFTLEEQAKVIVAPRSNNE  635

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELL IKES IKYV EPN+K
Sbjct  636  MDASKLKKEFPELLPIKESLIKYVFEPNKK  665



>ref|XP_008380229.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYK Y+DP+F W NF++EEQAKVIVA RSNNE
Sbjct  582  SVEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIDPSFKWTNFTVEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLPIKESLIKYVFEPNKKT  672



>gb|KHN29165.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=584

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W+NF+LEEQAKVIVA RSNNE
Sbjct  494  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNE  553

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  554  MDASKLKTEFPELLSIKESLIKYVFEPNKKT  584



>ref|XP_009356652.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYK Y+DP+F W NF++EEQAKVIVA RSNNE
Sbjct  582  SVEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIDPSFKWTNFTVEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+KT
Sbjct  642  MDASKLKKEFPELLPIKESLIKYVFEPNKKT  672



>ref|XP_003549868.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=302

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  208  SIEMGKRNLTGIWNFTNPGVVSHNEILEMYRDYVDPNFTWNNFTLEEQAKVIVAPRSNNE  267

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLKKEFPELLSIK+S IKYV EPN+K
Sbjct  268  LDAAKLKKEFPELLSIKDSLIKYVFEPNQK  297



>ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Citrus sinensis]
Length=668

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F W NF+L+EQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYINPEFKWVNFTLDEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIK+S IKYV EPN+KT
Sbjct  638  MDASKLKKEFPELLSIKDSLIKYVFEPNKKT  668



>ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X4 [Glycine max]
 ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X5 [Glycine max]
 ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X6 [Glycine max]
Length=668

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W+NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  638  MDASKLKTEFPELLSIKESLIKYVFEPNKKT  668



>emb|CDP06058.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  561  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDPEFKWANFTLEEQAKVIVAARSNNE  620

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDA+KLK EFPELL IKES IKYV EPN+ T
Sbjct  621  MDATKLKTEFPELLPIKESLIKYVFEPNKNT  651



>ref|XP_011082806.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Sesamum indicum]
Length=671

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYREYIDPQFKWTNFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IK+V  PNRKT
Sbjct  638  MDASKLKKEFPELLSIKESLIKFVFGPNRKT  668



>ref|XP_002282339.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Vitis vinifera]
Length=302

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFAWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DASKLKKEFPEL+SIKES IKYV +PN+K
Sbjct  269  LDASKLKKEFPELMSIKESLIKYVFKPNQK  298



>gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP+F WANF+LEEQAKVI+A RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYRDYIDPSFKWANFNLEEQAKVIIAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  638  MDASKLKNEFPELLSIKESLIKYVFEPNKKT  668



>ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=690

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W+NF+LEEQAKVIVA RSNNE
Sbjct  600  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNE  659

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  660  MDASKLKTEFPELLSIKESLIKYVFEPNKKT  690



>ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP+F WANF+LEEQAKVI+A RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYRDYIDPSFKWANFNLEEQAKVIIAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  638  MDASKLKNEFPELLSIKESLIKYVFEPNKKT  668



>ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=691

 Score =   149 bits (375),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W+NF+LEEQAKVIVA RSNNE
Sbjct  601  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYIDPNFKWSNFTLEEQAKVIVAPRSNNE  660

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  661  MDASKLKTEFPELLSIKESLIKYVFEPNKKT  691



>ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza 
brachyantha]
Length=667

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GV+ HNEI EMYKKY+DP+F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SVEMAKRNLRGIWNFTNPGVISHNEILEMYKKYIDPSFKWSNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MD +KLK EFPELLSIKES +KYV EPNRK
Sbjct  634  MDGTKLKDEFPELLSIKESLVKYVFEPNRK  663



>ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
 gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
Length=669

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYREYINPEFKWANFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  639  MDASKLKKEFPELLSIKESLIKYAFEPNKKT  669



>ref|XP_010417456.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Camelina sativa]
 ref|XP_010417457.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Camelina sativa]
 ref|XP_010417458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X3 
[Camelina sativa]
Length=671

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  581  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  641  MDASKLKKEFPELLSIKESLIKYAFEPNKKT  671



>ref|XP_010429684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472689.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472690.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=670

 Score =   148 bits (374),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  640  MDASKLKKEFPELLSIKESLIKYAFEPNKKT  670



>ref|XP_004298763.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Fragaria vesca subsp. vesca]
Length=300

 Score =   144 bits (362),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYK+Y+DP++ W NF+LEEQAKVIVA RSNNE
Sbjct  208  SVEMAKRNLTGIWNFTNPGVVSHNEILEMYKQYIDPSYTWKNFNLEEQAKVIVAPRSNNE  267

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V +PN+KT
Sbjct  268  LDASKLKKEFPELLSIKESLIKNVFKPNQKT  298



>ref|XP_009106565.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
 ref|XP_009106567.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=670

 Score =   148 bits (373),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  640  MDASKLKKEFPELLSIKESLIKYAFEPNKKT  670



>gb|KJB45831.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=667

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  K+NL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKKNLRGIWNFTNPGVVSHNEILEMYKTYIDPKFKWENFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPNR+T
Sbjct  637  MDASKLKKEFPELLSIKESLIKYAFEPNRRT  667



>ref|XP_004953442.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=307

 Score =   144 bits (362),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+  +DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  214  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDCIDPSFSWKNFNLEEQAKVIVAPRSNNE  273

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLSIKES IKYV EPNRKT
Sbjct  274  LDQTKLKNEFPELLSIKESLIKYVFEPNRKT  304



>ref|XP_010533730.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=300

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP+F W NF++EEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKEYIDPSFTWKNFTVEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPE++SIKES +K+V EPN+KT
Sbjct  266  LDATKLKAEFPEMMSIKESLVKFVFEPNKKT  296



>ref|XP_010430376.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=303

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPNFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IKYV EPN+KT
Sbjct  269  LDATKLKTEFPELMSIKESLIKYVFEPNKKT  299



>emb|CDX88455.1| BnaC06g38990D [Brassica napus]
Length=707

 Score =   148 bits (373),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  617  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYINPDFKWANFTLEEQAKVIVAPRSNNE  676

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  677  MDASKLKKEFPELLSIKESLIKYAFEPNKKT  707



>emb|CAN79484.1| hypothetical protein VITISV_006441 [Vitis vinifera]
Length=360

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMYK Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  267  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYKSYIDPNFKWANFTLEEQAKVIVAARSNNE  326

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELL IK+S IKYV EPN+K+
Sbjct  327  MDASKLKNEFPELLPIKDSLIKYVFEPNQKS  357



>ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   147 bits (372),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  579  SVEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  639  MDASKLKKEFPELLSIKESLIKYAFEPNKKT  669



>ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
 ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
Length=671

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 79/91 (87%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP+F ++NF++EEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKQYIDPSFKYSNFTIEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES IKYV EPN+KT
Sbjct  638  MDASKLKKEFPELLPIKESLIKYVFEPNKKT  668



>ref|XP_004169238.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like, partial 
[Cucumis sativus]
Length=338

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMYKKY+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  248  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYKKYIDPKFKWENFNLEEQAKVIVAPRSNNE  307

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES +KYV E N+KT
Sbjct  308  LDASKLKKEFPELLSIKESILKYVFEANKKT  338



>gb|KFK43526.1| hypothetical protein AALP_AA1G137100 [Arabis alpina]
Length=296

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY++Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SLEMAKRNLTGIWNFTNPGVVSHNEILEMYREYVDPSFTWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLK EFPELLSIKES +K+V EPN+K
Sbjct  266  LDATKLKTEFPELLSIKESLVKFVFEPNKK  295



>emb|CDY45969.1| BnaA09g12970D [Brassica napus]
Length=297

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY++Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  203  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYREYIDPSFTWKNFTLEEQAKVIVAPRSNNE  262

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPE+LSIKES IK+V EPN+KT
Sbjct  263  LDATKLKSEFPEMLSIKESLIKFVFEPNKKT  293



>ref|XP_010062770.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 ref|XP_010062771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW69901.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
 gb|KCW69902.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
Length=671

 Score =   147 bits (371),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/90 (79%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  581  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKQYIDPQFKWMNFTLEEQAKVIVAPRSNNE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLKKEFP+LL IKES IKYV EPNRK
Sbjct  641  MDATKLKKEFPDLLPIKESLIKYVFEPNRK  670



>emb|CDY45471.1| BnaC09g12890D [Brassica napus]
Length=297

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY++Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  203  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYREYIDPSFTWKNFTLEEQAKVIVAPRSNNE  262

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPE+LSIKES IK+V EPN+KT
Sbjct  263  LDATKLKTEFPEMLSIKESLIKFVFEPNKKT  293



>ref|XP_011072055.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Sesamum indicum]
Length=300

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVI+A RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYREYIDPNFTWTNFTLEEQAKVIIAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK+EFPELLSIK+S I++V +PNRKT
Sbjct  267  LDATKLKQEFPELLSIKDSLIEHVFKPNRKT  297



>ref|XP_002887985.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64244.1| hypothetical protein ARALYDRAFT_893174 [Arabidopsis lyrata subsp. 
lyrata]
Length=300

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IK+V EPN+KT
Sbjct  266  LDATKLKTEFPELMSIKESLIKFVFEPNKKT  296



>gb|AAM65668.1| unknown [Arabidopsis thaliana]
Length=300

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IK+V EPN+KT
Sbjct  266  LDATKLKTEFPELMSIKESLIKFVFEPNKKT  296



>ref|XP_006391796.1| hypothetical protein EUTSA_v10023613mg [Eutrema salsugineum]
 gb|ESQ29082.1| hypothetical protein EUTSA_v10023613mg [Eutrema salsugineum]
Length=297

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  203  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  262

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPE+LSIKES IK+V EPN+KT
Sbjct  263  LDATKLKTEFPEMLSIKESLIKFVFEPNKKT  293



>ref|XP_010108054.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC17786.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=300

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY  Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYHDYIDPNFTWKNFTLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KL KEFPELL IKES IKYV EPN+KT
Sbjct  267  LDATKLNKEFPELLPIKESLIKYVFEPNQKT  297



>ref|XP_010418304.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=304

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  210  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  269

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IK+V EPN+KT
Sbjct  270  LDATKLKTEFPELMSIKESLIKFVFEPNKKT  300



>ref|XP_006857961.1| hypothetical protein AMTR_s00069p00173700 [Amborella trichopoda]
 gb|ERN19428.1| hypothetical protein AMTR_s00069p00173700 [Amborella trichopoda]
Length=300

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  K+NL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKKNLTGIWNFTNPGVVSHNEILEMYRDYIDPYFSWKNFTLEEQAKVIVAQRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKK+FP+LLSIKES IKYV  PN KT
Sbjct  267  LDASKLKKQFPQLLSIKESLIKYVFGPNHKT  297



>ref|NP_564806.1| UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-reductase 1 [Arabidopsis 
thaliana]
 sp|Q9LQ04.1|RMLCD_ARATH RecName: Full=Bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase; AltName: Full=dTDP-L-rhamnose 
synthase [Arabidopsis thaliana]
 gb|AAF75813.1|AC011000_16 Contains weak similarity to 5-epimerase from Saccharopolyspora 
erythraea gb|L37354. ESTs gb|T41773, gb|R29767, gb|T88368, 
gb|F13963 come from this gene [Arabidopsis thaliana]
 gb|AAG48808.1|AF332445_1 unknown protein [Arabidopsis thaliana]
 gb|AAR99502.1| 3,5-epimerase/4-reductase [Arabidopsis thaliana]
 gb|AEE34035.1| UDP-4-keto-6-deoxy-d-glucose-3,5-epimerase-4-reductase 1 [Arabidopsis 
thaliana]
Length=301

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IK+V EPN+KT
Sbjct  267  LDATKLKTEFPELMSIKESLIKFVFEPNKKT  297



>gb|AAK62450.1|AF387005_1 Unknown protein [Arabidopsis thaliana]
Length=301

 Score =   142 bits (359),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IK+V EPN+KT
Sbjct  267  LDATKLKTEFPELMSIKESLIKFVFEPNKKT  297



>ref|XP_010273412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=676

 Score =   147 bits (371),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMYKKY+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYKKYIDPDFKWVNFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELL IKES IKYV EPN+K
Sbjct  640  MDASKLKKEFPELLHIKESLIKYVFEPNKK  669



>ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=674

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY++P F W+NF+L+EQAKV+VA RSNNE
Sbjct  582  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKKYINPEFKWSNFTLDEQAKVLVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IK V EPNRKT
Sbjct  642  MDASKLKKEFPELLSIKESLIKNVFEPNRKT  672



>gb|ACG28244.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
Length=309

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  216  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPGFSWKNFNLEEQAKVIVAPRSNNE  275

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +D +KLK+EFPELLSIKES IKYV EPN K
Sbjct  276  LDQTKLKREFPELLSIKESLIKYVFEPNCK  305



>ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYRDYIDPNFKWANFTLEEQAKVIVAARSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+K+
Sbjct  639  MDASKLKNEFPELLSIKESLIKYVFEPNKKS  669



>ref|XP_004143938.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004159969.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN50154.1| hypothetical protein Csa_5G156140 [Cucumis sativus]
Length=300

 Score =   142 bits (359),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+++DP F W NF+L+EQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKQFIDPNFTWKNFTLDEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPELLSIK+S IKYV +PN+KT
Sbjct  267  LDATKLKNEFPELLSIKDSLIKYVFKPNQKT  297



>ref|XP_007213598.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 ref|XP_007213599.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14797.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14798.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
Length=671

 Score =   147 bits (370),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP F WANF++EEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKQYIDPKFTWANFTIEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNR  262
            MDASKLKKEFPELL +KES IKYV EPN+
Sbjct  638  MDASKLKKEFPELLPVKESLIKYVFEPNK  666



>gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum]
Length=681

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK Y+DP F W NFSL+EQAKVIVA RSNNE
Sbjct  584  SIEMAKRNLRGIWNFTNPGVVSHNEILQMYKDYIDPNFNWVNFSLQEQAKVIVAPRSNNE  643

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLK EFPELLSIK+S IKYV EPNRKT
Sbjct  644  LDASKLKNEFPELLSIKDSLIKYVFEPNRKT  674



>ref|XP_006647684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=307

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  214  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFSWKNFTLEEQAKVIVAPRSNNE  273

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLSIK+S IKYV +PN+KT
Sbjct  274  LDCTKLKTEFPELLSIKDSLIKYVFKPNQKT  304



>gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii]
Length=681

 Score =   147 bits (370),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK Y+DP F W NFSL+EQAKVIVA RSNNE
Sbjct  584  SIEMAKRNLRGIWNFTNPGVVSHNEILQMYKDYIDPNFNWVNFSLQEQAKVIVAPRSNNE  643

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLK EFPELLSIK+S IKYV EPNRKT
Sbjct  644  LDASKLKNEFPELLSIKDSLIKYVFEPNRKT  674



>ref|XP_006302532.1| hypothetical protein CARUB_v10020632mg, partial [Capsella rubella]
 gb|EOA35430.1| hypothetical protein CARUB_v10020632mg, partial [Capsella rubella]
Length=330

 Score =   142 bits (359),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  236  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIVAPRSNNE  295

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPEL+SIKES IK+V EPN+KT
Sbjct  296  LDATKLKTEFPELMSIKESLIKFVFEPNKKT  326



>emb|CAN62061.1| hypothetical protein VITISV_001928 [Vitis vinifera]
Length=619

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  529  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYRDYIDPGFEWVNFNLEEQAKVIVAPRSNNE  588

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IKYV EPN+K+
Sbjct  589  LDASKLKKEFPELLSIKESIIKYVFEPNKKS  619



>ref|XP_009400458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  213  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPKFTWKNFNLEEQAKVIVAPRSNNE  272

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELL IKES IKYV EPN+KT
Sbjct  273  LDTTKLKGEFPELLPIKESLIKYVFEPNKKT  303



>gb|EYU36941.1| hypothetical protein MIMGU_mgv1a010842mg [Erythranthe guttata]
Length=300

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYREYIDPSFTWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPE+L IKES I+ V +PNRKT
Sbjct  267  LDASKLKKEFPEMLGIKESLIENVFKPNRKT  297



>ref|XP_006484833.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=676

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V EPN+KT
Sbjct  639  LDASKLKKEFPELLSIKESLIKNVFEPNKKT  669



>gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP+F W NF+LEEQAKVI+A RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYRDYIDPSFKWTNFNLEEQAKVIIAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  638  MDASKLKNEFPELLSIKESLIKYVFEPNKKT  668



>ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP+F W NF+LEEQAKVI+A RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYRDYIDPSFKWTNFNLEEQAKVIIAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV EPN+KT
Sbjct  638  MDASKLKNEFPELLSIKESLIKYVFEPNKKT  668



>ref|XP_010272587.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=302

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVI+A RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFVWKNFTLEEQAKVIIAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLKKEFPELL IKES IKYV +PN+KT
Sbjct  269  LDTTKLKKEFPELLPIKESLIKYVFKPNQKT  299



>ref|XP_009113029.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=297

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SI+  KRNL GI+NFT  GVV HNEI EMY++Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  203  SIDMAKRNLTGIYNFTNPGVVSHNEILEMYREYIDPSFTWKNFTLEEQAKVIVAPRSNNE  262

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPE+LSIKES IK+V EPN+KT
Sbjct  263  LDATKLKTEFPEMLSIKESLIKFVFEPNKKT  293



>emb|CDP09826.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+L GIWNFT  GVV HNEI EMYK+Y+DP F W NF+L+EQAKVIVA RSNNE
Sbjct  208  SIEMAKRDLTGIWNFTNPGVVSHNEILEMYKEYIDPKFTWKNFTLDEQAKVIVAPRSNNE  267

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPELLSIKES +KYV +PN+KT
Sbjct  268  LDATKLKNEFPELLSIKESLLKYVFKPNQKT  298



>ref|XP_008437195.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Cucumis melo]
Length=300

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+++DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKQFIDPNFTWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPELLSIK+S +KYV +PN+KT
Sbjct  267  LDATKLKNEFPELLSIKDSLLKYVFKPNQKT  297



>ref|NP_001152718.1| LOC100286359 [Zea mays]
 gb|ACG49124.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
 gb|ACR38060.1| unknown [Zea mays]
 gb|AFW72796.1| dTDP-4-dehydrorhamnose reductase [Zea mays]
Length=307

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  214  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPGFSWKNFNLEEQAKVIVAPRSNNE  273

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +D +KLK+EFPELLSIKES +KYV EPN K
Sbjct  274  LDQTKLKREFPELLSIKESLVKYVFEPNCK  303



>emb|CDY57072.1| BnaCnng31530D [Brassica napus]
Length=323

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY++++DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  229  SLEMAKRNLTGIWNFTNPGVVSHNEILEMYREFVDPSFTWKNFTLEEQAKVIVAPRSNNE  288

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPE+LSIKES +K+V EPN+KT
Sbjct  289  LDATKLKTEFPEMLSIKESLVKFVFEPNKKT  319



>ref|XP_008226345.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=671

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP F WANF++EEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKHYIDPKFTWANFTIEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNR  262
            MDASKLKKEFPELL +KES IKYV EPN+
Sbjct  638  MDASKLKKEFPELLPVKESLIKYVFEPNK  666



>ref|XP_009620292.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=298

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  205  SLEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPSFSWKNFTLEEQAKVIVAPRSNNE  264

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKL KEFPE+ SIKES I+YV +PNRKT
Sbjct  265  LDASKLSKEFPEMKSIKESLIEYVFKPNRKT  295



>gb|KDP30504.1| hypothetical protein JCGZ_17141 [Jatropha curcas]
Length=671

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP+F W NF+L+EQAKVIVA RSNNE
Sbjct  581  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIDPSFKWVNFTLDEQAKVIVAPRSNNE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK+EFPELLSIK+S +KYV EPN+K
Sbjct  641  MDASKLKEEFPELLSIKDSLVKYVFEPNKK  670



>ref|XP_010933908.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase-like [Elaeis guineensis]
Length=302

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI E+Y+ Y+DP F W NFSLEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEIYRDYIDPNFTWKNFSLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLS+KES IKYV +PN+KT
Sbjct  269  LDTTKLKNEFPELLSVKESLIKYVFKPNQKT  299



>ref|XP_007155573.1| hypothetical protein PHAVU_003G213400g [Phaseolus vulgaris]
 gb|ESW27567.1| hypothetical protein PHAVU_003G213400g [Phaseolus vulgaris]
Length=300

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  208  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYREYVDPNFTWKNFTLEEQAKVIVAPRSNNE  267

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLK EFPELLSIK+S +KYV +PN+K
Sbjct  268  LDATKLKTEFPELLSIKDSLVKYVFQPNQK  297



>ref|XP_002271970.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
 ref|XP_010648843.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=657

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  567  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYRDYIDPGFEWVNFNLEEQAKVIVAPRSNNE  626

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IKYV EPN+K+
Sbjct  627  LDASKLKKEFPELLSIKESIIKYVFEPNKKS  657



>ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
 gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
Length=668

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIEPGFKWSNFTLEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIKES IKYV EPN++T
Sbjct  638  MDGSKLSKEFPEMLSIKESLIKYVFEPNKRT  668



>ref|XP_009766426.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=298

 Score =   141 bits (356),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  205  SLEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYVDPSFSWKNFTLEEQAKVIVAPRSNNE  264

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKL KEFPE+ SIKES I+YV +PNRKT
Sbjct  265  LDASKLSKEFPEMKSIKESLIEYVFKPNRKT  295



>ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=674

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  G V HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  581  SVEMAKRNLRGIWNFTNPGAVSHNEILEMYKAYIDPDFKWVNFTLEEQAKVIVAPRSNNE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK+EFPELLSIK+S IKYV EPN++T
Sbjct  641  MDASKLKREFPELLSIKDSLIKYVFEPNKRT  671



>ref|XP_010109352.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC21996.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=673

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRN  GIWNFT  GVV HNEI E+YKKY+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  581  SVEMVKRNCRGIWNFTNPGVVSHNEILELYKKYIDPSFKWVNFTLEEQAKVIVAPRSNNE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IK+S IKYV EPN+K+
Sbjct  641  MDASKLKKEFPELLPIKDSLIKYVFEPNKKS  671



>ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
 gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
Length=669

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL G+WNFT  GVV HNE+ EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNLRGVWNFTNPGVVSHNEVLEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IKY  EPN+KT
Sbjct  639  LDASKLKKEFPELLSIKESLIKYAFEPNKKT  669



>ref|NP_177978.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1; AltName: Full=Protein REPRESSOR OF LRX1 1; AltName: 
Full=Rhamnose biosynthetic enzyme 1; Short=AtRHM1; Includes: 
RecName: Full=UDP-glucose 4,6-dehydratase; Includes: 
RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AEE36122.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=669

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y++P F WANF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYRDYINPEFKWANFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY   PN+KT
Sbjct  639  MDASKLKKEFPELLSIKESLIKYAYGPNKKT  669



>ref|XP_010552134.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Tarenaya hassleriana]
Length=668

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DPAF W+NF+LEEQ+KVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIDPAFKWSNFTLEEQSKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPE+L IKES IK+V EPN++T
Sbjct  638  MDASKLKTEFPEMLPIKESLIKFVFEPNKRT  668



>gb|KHN09737.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=512

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  418  SIEMGKRNLTGIWNFTNPGVVSHNEILEMYRDYVDPNFTWNNFTLEEQAKVIVAPRSNNE  477

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLKKEFPELLSIK+S IKYV EPN+K
Sbjct  478  LDAAKLKKEFPELLSIKDSLIKYVFEPNQK  507



>ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
 gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
Length=666

 Score =   145 bits (367),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  573  SVEMAKRNLRGIYNFTNPGVVSHNEILEMYKQYIDPSFKWTNFTLEEQAKVIVAPRSNNE  632

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLKKEFPELLSIK+S IK+V EPNRK
Sbjct  633  MDATKLKKEFPELLSIKDSLIKFVFEPNRK  662



>ref|XP_002509687.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF51074.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=302

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYVDPNFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KL KEFPE+L IKES IKYV +PN+KT
Sbjct  269  LDATKLSKEFPEMLPIKESLIKYVFKPNQKT  299



>gb|KJB27003.1| hypothetical protein B456_004G271200 [Gossypium raimondii]
Length=571

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  K+NL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNN+
Sbjct  481  SIEMAKKNLRGIWNFTNPGVVSHNEILEMYKTYIDPNFEWMNFTLEEQAKVIVAPRSNNK  540

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELL IKES +KYV EPN++T
Sbjct  541  MDASKLKKEFPELLPIKESLVKYVFEPNKRT  571



>gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLNGIWNFTNPGVVSHNEILEMYKAYIDPKFQWVNFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFP+LL IKES IKYV EPN++T
Sbjct  637  MDASKLKNEFPDLLPIKESLIKYVFEPNKRT  667



>gb|KJB12934.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12935.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12936.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
Length=667

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLNGIWNFTNPGVVSHNEILEMYKAYIDPKFQWVNFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFP+LL IKES IKYV EPN++T
Sbjct  637  MDASKLKNEFPDLLPIKESLIKYVFEPNKRT  667



>ref|XP_009148579.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=321

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY++++DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  227  SLEMAKRNLTGIWNFTNPGVVSHNEILEMYREFVDPSFTWKNFTLEEQAKVIVAPRSNNE  286

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK EFPE+LSIKE+ +K+V EPN+KT
Sbjct  287  LDATKLKTEFPEMLSIKEALVKFVFEPNKKT  317



>ref|XP_007149511.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
 gb|ESW21505.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
Length=669

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYRDYIDPSFKWVNFNLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KLKKEFPELLSIK+S IKYV EPN+KT
Sbjct  638  MDGAKLKKEFPELLSIKDSLIKYVFEPNKKT  668



>ref|XP_007209407.1| hypothetical protein PRUPE_ppa009264mg [Prunus persica]
 gb|EMJ10606.1| hypothetical protein PRUPE_ppa009264mg [Prunus persica]
Length=299

 Score =   141 bits (355),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYKEYIDPSFTWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK+EFPELLSIKES IK V +PN+KT
Sbjct  266  LDATKLKQEFPELLSIKESLIKNVFKPNQKT  296



>emb|CDY40003.1| BnaC05g13120D [Brassica napus]
Length=670

 Score =   145 bits (366),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNE+ EMY+ Y+D  F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLKGIWNFTNPGVVSHNEVLEMYRDYIDSDFKWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIKES IKY  EPN++T
Sbjct  640  MDASKLKKEFPELLSIKESLIKYAFEPNKRT  670



>ref|XP_010255576.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=302

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLIGIWNFTNPGVVSHNEILEMYRDYIDPNFVWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLKKEFPELL IKES I+YV +PN+K
Sbjct  269  LDATKLKKEFPELLPIKESLIRYVFKPNQK  298



>ref|XP_010933909.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase-like [Elaeis guineensis]
Length=302

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NFSLEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFTWKNFSLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D ++LK EFPELLSIKES IKYV +PN+ T
Sbjct  269  LDTTQLKNEFPELLSIKESLIKYVFKPNQNT  299



>ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea mays]
 gb|ACF78472.1| unknown [Zea mays]
 gb|AFW77498.1| RHM1 [Zea mays]
Length=676

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  583  SVEMAKRNLRGIYNFTNPGVVSHNEILEMYKQYIDPSFKWTNFTLEEQAKVIVAPRSNNE  642

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK EFPELLSIK+S IKYV EPNRK
Sbjct  643  MDATKLKNEFPELLSIKDSLIKYVFEPNRK  672



>ref|XP_006437200.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
 gb|ESR50440.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
Length=676

 Score =   145 bits (366),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V EPN+K+
Sbjct  639  LDASKLKKEFPELLSIKESLIKNVFEPNKKS  669



>gb|ACG33666.1| RHM1 [Zea mays]
Length=666

 Score =   145 bits (365),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  573  SVEMAKRNLRGIYNFTNPGVVSHNEILEMYKQYIDPSFKWTNFTLEEQAKVIVAPRSNNE  632

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK EFPELLSIK+S IKYV EPNRK
Sbjct  633  MDATKLKNEFPELLSIKDSLIKYVFEPNRK  662



>gb|EEC73782.1| hypothetical protein OsI_08465 [Oryza sativa Indica Group]
Length=311

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  218  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFSWKNFTLEEQAKVIVAPRSNNE  277

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLSIK+S ++YV +PN+KT
Sbjct  278  LDCTKLKAEFPELLSIKDSLVRYVFKPNQKT  308



>ref|NP_001173114.1| Os02g0678400 [Oryza sativa Japonica Group]
 dbj|BAD29243.1| dTDP-D-glucose 4,6-dehydratase-like [Oryza sativa Japonica Group]
 dbj|BAD29369.1| dTDP-D-glucose 4,6-dehydratase-like [Oryza sativa Japonica Group]
 dbj|BAG92682.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57572.1| hypothetical protein OsJ_07924 [Oryza sativa Japonica Group]
 dbj|BAH91843.1| Os02g0678400 [Oryza sativa Japonica Group]
Length=311

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  218  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFSWKNFTLEEQAKVIVAPRSNNE  277

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLSIK+S ++YV +PN+KT
Sbjct  278  LDCTKLKAEFPELLSIKDSLVRYVFKPNQKT  308



>gb|KDP25530.1| hypothetical protein JCGZ_20686 [Jatropha curcas]
Length=303

 Score =   140 bits (354),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  210  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYKNYVDPNFTWKNFTLEEQAKVIVAPRSNNE  269

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKL KEFP +L IKES IKYV +PN+KT
Sbjct  270  LDASKLSKEFPGMLPIKESLIKYVFKPNQKT  300



>ref|XP_002285634.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=675

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMYK Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYKSYIDPNFKWANFTLEEQAKVIVAARSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELL IK+S IKYV EPN+K+
Sbjct  642  MDASKLKNEFPELLPIKDSLIKYVFEPNQKS  672



>ref|XP_009362849.1| PREDICTED: probable rhamnose biosynthetic enzyme 1, partial [Pyrus 
x bretschneideri]
Length=257

 Score =   139 bits (351),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  164  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYKEYIDPSFSYKNFTLEEQAKVIVAPRSNNE  223

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFP+LLSIKES IK V +PN+KT
Sbjct  224  LDASKLKKEFPKLLSIKESLIKNVFKPNQKT  254



>ref|XP_010535018.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Tarenaya hassleriana]
Length=667

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL G+WNFT  GVV HNEI EMYKKY++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLKGVWNFTNPGVVSHNEILEMYKKYIEPGFEWSNFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK+EFPE+L IKES ++YV EPN++T
Sbjct  637  MDASKLKEEFPEMLPIKESLVRYVFEPNKRT  667



>gb|KFK40550.1| hypothetical protein AALP_AA2G010500 [Arabis alpina]
Length=295

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVI+A RSNNE
Sbjct  203  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPSFTWKNFTLEEQAKVIIAPRSNNE  262

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLK EFPE+LSIKES IK+V EPN+K
Sbjct  263  LDATKLKTEFPEMLSIKESLIKFVFEPNKK  292



>gb|ACU23112.1| unknown [Glycine max]
Length=297

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI +MYK+Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SLEMAKRNLTGIWNFTNPGVVSHNEILQMYKEYVDPNFTWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DASKLK EFP+LLSIK+S +KYV +PN+K
Sbjct  266  LDASKLKNEFPQLLSIKDSLVKYVFQPNQK  295



>ref|XP_006407044.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 ref|XP_006407045.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48497.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48498.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
Length=664

 Score =   145 bits (365),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIK+S IKYV EPN++T
Sbjct  634  MDGSKLSKEFPEMLSIKDSLIKYVFEPNKRT  664



>ref|XP_008381928.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=299

 Score =   140 bits (353),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYKEYIDPSFTYKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V +PN+KT
Sbjct  266  LDASKLKKEFPELLSIKESLIKNVFKPNQKT  296



>ref|XP_008348787.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
 ref|XP_009377895.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009377904.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=299

 Score =   140 bits (353),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYKEYIDPSFTYKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V +PN+KT
Sbjct  266  LDASKLKKEFPELLSIKESLIKNVFKPNQKT  296



>ref|XP_009395981.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  GVV HNEI EMYK Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRSCRGIWNFTNPGVVSHNEILEMYKSYIDPSFKWTNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK+EFPELLSIK+S IKYV EPN+K
Sbjct  639  MDASKLKREFPELLSIKDSIIKYVFEPNKK  668



>ref|XP_010093448.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=671

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYKKY+D  F W NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKKYIDLDFSWENFTLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKLKKEFPELL IKES IKYV EPN+KT
Sbjct  638  MDTSKLKKEFPELLPIKESLIKYVFEPNKKT  668



>gb|KDO60921.1| hypothetical protein CISIN_1g005818mg [Citrus sinensis]
Length=676

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SVEMAKRNLSGIWNFTNPGVVSHNEILEMYKAYIDPGFKWTNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DASKLKKEFPELLSIKES IK V EPN+K
Sbjct  639  LDASKLKKEFPELLSIKESLIKNVFEPNKK  668



>ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group]
 gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group]
 gb|AJB98437.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=675

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  GVV HNEI EMYKKY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRDCRGIWNFTNPGVVSHNEILEMYKKYLNPDFKWTNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIK+S +KYV EPNRK
Sbjct  642  MDASKLKSEFPELLSIKDSLVKYVFEPNRK  671



>emb|CDX98494.1| BnaC05g38810D [Brassica napus]
Length=646

 Score =   144 bits (363),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  556  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTLEEQAKVIVAPRSNNE  615

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPELLSIK+S IKYV EPN++T
Sbjct  616  MDGAKLSKEFPELLSIKDSLIKYVFEPNKRT  646



>gb|KCW77625.1| hypothetical protein EUGRSUZ_D01934 [Eucalyptus grandis]
Length=294

 Score =   140 bits (352),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  201  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYQEYIDPNFTWKNFTLEEQAKVIVAPRSNNE  260

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KL +EFPELL IKES IKYV +PN+KT
Sbjct  261  LDMTKLSREFPELLPIKESLIKYVFKPNQKT  291



>emb|CDP05404.1| unnamed protein product [Coffea canephora]
Length=155

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GV+ HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  58   SIEMAKRNCKGIWNFTNPGVISHNEILEMYRDYIDPKFKWTNFTLEEQAKVIVAPRSNNE  117

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNR  262
            MDASKLKKEF ELLSI+ S IKYV +PN+
Sbjct  118  MDASKLKKEFLELLSIRGSLIKYVFKPNK  146



>ref|XP_010915435.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915436.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915438.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
Length=678

 Score =   144 bits (364),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRN  GIWNFT  GV+ HNEI EMYK+Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SVEMAKRNCRGIWNFTNPGVISHNEILEMYKRYIDPGFNWVNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELL IK+S IKYV EPNRK
Sbjct  642  MDASKLKNEFPELLYIKDSLIKYVFEPNRK  671



>ref|XP_010501002.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  K+NL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKKNLRGIWNFTNPGVVSHNEILEMYKNYIEPGFKWSNFTLEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIKES IKYV EPN++T
Sbjct  638  MDGSKLSKEFPEMLSIKESLIKYVFEPNKRT  668



>ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=673

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  GVV HNEI EMYKKY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRDCRGIWNFTNPGVVSHNEILEMYKKYINPDFKWTNFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIK+S IKYV EPNRK
Sbjct  640  MDASKLKAEFPELLSIKDSLIKYVFEPNRK  669



>ref|XP_001775697.1| predicted protein [Physcomitrella patens]
 gb|EDQ59500.1| predicted protein [Physcomitrella patens]
Length=669

 Score =   144 bits (363),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP+  W NF+LEEQAKVIVA RSNNE
Sbjct  576  SIEMAKRNLTGIWNFTNPGVVSHNEIMEMYKEYIDPSLTWVNFTLEEQAKVIVAARSNNE  635

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKL KEFPE+L IKES  K+V EPNRKT
Sbjct  636  MDASKLSKEFPEMLGIKESLKKFVFEPNRKT  666



>ref|XP_010553490.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Tarenaya hassleriana]
Length=300

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYREYIDPNFTWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA KL  EFPE++SIKES +K+V EPN+KT
Sbjct  266  LDAKKLSAEFPEMMSIKESLVKFVFEPNKKT  296



>ref|XP_009389578.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009389587.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=306

 Score =   140 bits (352),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP F W NF+LEEQA+VIVA RSNNE
Sbjct  213  SIEMAKRNLTGIWNFTNPGAVSHNEILEMYRDYIDPNFTWKNFTLEEQAQVIVAPRSNNE  272

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLKKEFPELL IKES IK+V EPN+KT
Sbjct  273  LDTAKLKKEFPELLPIKESLIKHVFEPNQKT  303



>ref|XP_001766894.1| predicted protein [Physcomitrella patens]
 gb|EDQ68296.1| predicted protein [Physcomitrella patens]
Length=677

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+DP   W NF++EEQAKVIVA RSNNE
Sbjct  583  SIEMAKRNLTGIWNFTNPGVVSHNEIMEMYKEYIDPELSWVNFTIEEQAKVIVAARSNNE  642

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPE+L IKES  KYV EPNR+T
Sbjct  643  MDASKLKKEFPEMLGIKESLKKYVFEPNRQT  673



>ref|XP_004138882.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN62859.1| hypothetical protein Csa_2G377950 [Cucumis sativus]
Length=668

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMYKKY+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYKKYIDPKFKWENFNLEEQAKVIVAPRSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES +KYV E N+KT
Sbjct  638  LDASKLKKEFPELLSIKESILKYVFEANKKT  668



>gb|AAK82539.1| At1g53500/F22G10_13 [Arabidopsis thaliana]
 gb|AAN72275.1| At1g53500/F22G10_13 [Arabidopsis thaliana]
Length=498

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF++EEQAKVIVA RSNNE
Sbjct  408  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIEPGFKWSNFTVEEQAKVIVAARSNNE  467

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIKES +KYV EPN++T
Sbjct  468  MDGSKLSKEFPEMLSIKESLLKYVFEPNKRT  498



>ref|XP_008791880.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
 ref|XP_008791888.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=682

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRN  GIWNFT  GV+ HNEI EMYK YMD +F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SVEMAKRNCRGIWNFTNPGVISHNEILEMYKTYMDSSFKWVNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIK+S IKYV EPNRK
Sbjct  642  MDASKLKNEFPELLSIKDSLIKYVFEPNRK  671



>ref|XP_009394841.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394842.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  G V HNEI EMYK Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNCRGIWNFTNPGAVSHNEILEMYKSYIDPSFKWVNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK+EFPELLSIK+S IKYV EPN+K
Sbjct  639  MDATKLKREFPELLSIKDSLIKYVFEPNKK  668



>emb|CDY35137.1| BnaA06g11470D [Brassica napus]
Length=670

 Score =   144 bits (363),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNE+ EMY+ Y+D  F WANF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLKGIWNFTNPGVVSHNEVLEMYRDYIDSDFKWANFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IKY  EPN++T
Sbjct  640  LDASKLKKEFPELLSIKESLIKYAFEPNKRT  670



>ref|XP_009346674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009346676.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=282

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  189  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYKEYIDPSFSYKNFTLEEQAKVIVAPRSNNE  248

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFP+LLSIKES IK V +PN+KT
Sbjct  249  LDASKLKKEFPKLLSIKESLIKNVFKPNQKT  279



>emb|CDP22060.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GV+ HNEI EMY+  +DP F WANF+LEEQAK+IVA RSNNE
Sbjct  264  SIEMAKRNCKGIWNFTNPGVISHNEILEMYRDNIDPKFKWANFTLEEQAKIIVAPRSNNE  323

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELLSI+ES IKYV +PN+K
Sbjct  324  MDASKLKKEFPELLSIRESLIKYVFKPNKK  353



>gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Erythranthe guttata]
Length=669

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMYK+Y+DP F ++NF+LEEQAKVIVA RSNNE
Sbjct  576  SIEMAKRNLRGIYNFTNPGVVSHNEILEMYKQYIDPDFKYSNFTLEEQAKVIVAARSNNE  635

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLKKEFPELLSIK+S IK V EPNRKT
Sbjct  636  MDASKLKKEFPELLSIKDSLIKIVFEPNRKT  666



>ref|XP_010053354.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Eucalyptus 
grandis]
 gb|KCW77624.1| hypothetical protein EUGRSUZ_D01934 [Eucalyptus grandis]
Length=302

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYQEYIDPNFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KL +EFPELL IKES IKYV +PN+KT
Sbjct  269  LDMTKLSREFPELLPIKESLIKYVFKPNQKT  299



>ref|XP_009149137.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=672

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNE+ EMY+ Y+D  F WANF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNLKGIWNFTNPGVVSHNEVLEMYRDYVDSDFKWANFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IKY  EPN++T
Sbjct  642  LDASKLKKEFPELLSIKESLIKYAFEPNKRT  672



>ref|XP_006370064.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
 gb|ERP66633.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
Length=670

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W NF LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYINPDFTWVNFDLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELL IKES IKYV EPN++T
Sbjct  640  MDASKLKNEFPELLPIKESLIKYVFEPNKRT  670



>ref|XP_002531238.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF31135.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=622

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/91 (78%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK  +DP F W NF+LEEQAKVIVA RSNNE
Sbjct  532  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSCIDPDFKWVNFTLEEQAKVIVAPRSNNE  591

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDA+KLKKEFPELLSIKES IKYV E N+KT
Sbjct  592  MDAAKLKKEFPELLSIKESLIKYVFEANKKT  622



>emb|CDP18722.1| unnamed protein product [Coffea canephora]
Length=676

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GV+ HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRNCKGIWNFTNPGVISHNEILEMYRDYIDPKFKWTNFALEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELLSI+ES IKYV +PN+K
Sbjct  639  MDASKLKKEFPELLSIRESLIKYVFKPNKK  668



>gb|KHG22077.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYKTYIDPKFQWVNFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFP+LL IKES IKYV EP+++T
Sbjct  637  MDASKLKNEFPDLLPIKESLIKYVFEPSKRT  667



>ref|NP_564633.2| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9LPG6.1|RHM2_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2; AltName: Full=NDP-rhamnose synthase; AltName: 
Full=Protein MUCILAGE-MODIFIED 4; AltName: Full=Protein RHAMNOSE 
BIOSYNTHESIS 2; AltName: Full=Rhamnose biosynthetic enzyme 
2; Short=AtRHM2; AltName: Full=UDP-L-rhamnose synthase 
MUM4; Includes: RecName: Full=UDP-glucose 4,6-dehydratase; 
Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAF78439.1|AC018748_18 Contains similarity to dTPD-D-glucose-4,6-dehydratase from Sphingomonas 
sp.S88 gb|U51197 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain [Arabidopsis thaliana]
 gb|AAG51981.1|AC024260_19 dTDP-D-glucose 4,6-dehydratase, putative; 102946-105028 [Arabidopsis 
thaliana]
 emb|CAD92667.1| putative NDP-rhamnose synthase [Arabidopsis thaliana]
 gb|AAP93963.1| putative UDP-L-rhamnose synthase MUM4 [Arabidopsis thaliana]
 gb|AEE32949.1| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=667

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF++EEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIEPGFKWSNFTVEEQAKVIVAARSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIKES +KYV EPN++T
Sbjct  637  MDGSKLSKEFPEMLSIKESLLKYVFEPNKRT  667



>ref|XP_002468080.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
 gb|EER95078.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
Length=672

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  GVV HNEI EMYKKY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRDCRGIWNFTNPGVVSHNEILEMYKKYINPDFKWTNFTLEEQAKVIVARRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFP+LLSIK+S IKYV EPNRK
Sbjct  639  MDASKLKAEFPQLLSIKDSLIKYVFEPNRK  668



>ref|XP_010502125.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIK+S IKYV EPN++T
Sbjct  634  MDGSKLSKEFPEMLSIKDSLIKYVFEPNKRT  664



>ref|XP_010465388.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIK+S IKYV EPN++T
Sbjct  634  MDGSKLSKEFPEMLSIKDSLIKYVFEPNKRT  664



>ref|XP_002317559.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
 gb|EEE98171.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
Length=670

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILDMYKNYIDPNFTWVNFNLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLK EFPELL IKES IKYV EPN++T
Sbjct  640  LDASKLKNEFPELLPIKESLIKYVFEPNKRT  670



>ref|XP_010479911.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIEPGFKWSNFTLEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD  KL KEFPE+LSIKES IKYV EPN++T
Sbjct  638  MDGVKLSKEFPEMLSIKESLIKYVFEPNKRT  668



>ref|XP_010487282.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIK+S IKYV EPN++T
Sbjct  634  MDGSKLSKEFPEMLSIKDSLIKYVFEPNKRT  664



>ref|XP_010462242.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYIEPGFKWSNFTLEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD  KL KEFPE+LSIKES IKYV EPN++T
Sbjct  638  MDGVKLSKEFPEMLSIKESLIKYVFEPNKRT  668



>ref|XP_007158451.1| hypothetical protein PHAVU_002G153500g [Phaseolus vulgaris]
 gb|ESW30445.1| hypothetical protein PHAVU_002G153500g [Phaseolus vulgaris]
Length=303

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SLEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYVDPSFRWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNR  262
            +DASKLKKEFP LLSIK+S +KYV  PN 
Sbjct  266  LDASKLKKEFPHLLSIKDSLLKYVFHPNH  294



>emb|CDX97601.1| BnaA05g24780D [Brassica napus]
Length=646

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  556  SIEMAKRNLKGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFTLEEQAKVIVAPRSNNE  615

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPELLSIK+S IKYV EPN++T
Sbjct  616  MDGAKLSKEFPELLSIKDSLIKYVFEPNKRT  646



>emb|CDY20084.1| BnaA01g29180D [Brassica napus]
Length=644

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL G+WNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  554  SIEMAKRNLRGVWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTLEEQAKVIVAARSNNE  613

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPE+LSIK+S IKYV EPN++T
Sbjct  614  MDGAKLSKEFPEMLSIKDSLIKYVFEPNKRT  644



>ref|XP_011029152.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Populus euphratica]
Length=302

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPDFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK+EFPELL IKES IKYV +PN+KT
Sbjct  269  LDTAKLKREFPELLPIKESLIKYVFKPNQKT  299



>ref|XP_011006811.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
 ref|XP_011006812.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=670

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILDMYKNYIDPNFSWVNFNLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLK EFPELL IKES IKYV EPN++T
Sbjct  640  LDASKLKNEFPELLPIKESLIKYVFEPNKRT  670



>ref|XP_010676576.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Beta vulgaris subsp. vulgaris]
Length=303

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY++Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  208  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYREYIDPKFTWKNFTLEEQAKVIVAPRSNNE  267

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            ++ +KLK+EFPELL IKES IKYV EPN+KT
Sbjct  268  LETTKLKQEFPELLPIKESLIKYVFEPNKKT  298



>ref|XP_009394163.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=675

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYRSYIDPSFKWTNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK+EFPELLSIK+S IK+V EPN+K
Sbjct  642  MDATKLKREFPELLSIKDSLIKFVFEPNKK  671



>ref|XP_009146324.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Brassica 
rapa]
Length=665

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  575  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTLEEQAKVIVAPRSNNE  634

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPELLSI++S IKYV EPN++T
Sbjct  635  MDGAKLSKEFPELLSIQDSLIKYVFEPNKRT  665



>gb|KEH38548.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=682

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP F WANF+LEEQAKVIVA RSNNE
Sbjct  591  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYRDYIDPNFKWANFTLEEQAKVIVAARSNNE  650

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIKES IKYV E N+K+
Sbjct  651  MDASKLKNEFPELLSIKESLIKYVFEANKKS  681



>ref|XP_008238760.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=394

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 78/91 (86%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SI+  KRNL GI+NFT  GVV HNEI EMYK+Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  301  SIDMAKRNLTGIYNFTNPGVVSHNEILEMYKEYIDPSFTWKNFTLEEQAKVIVAPRSNNE  360

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLK+EFPELLSIKES IK V +PN+KT
Sbjct  361  LDATKLKQEFPELLSIKESLIKNVFKPNQKT  391



>ref|XP_002299567.1| hypothetical protein POPTR_0001s08570g [Populus trichocarpa]
 gb|ABK94159.1| unknown [Populus trichocarpa]
 gb|EEE84372.1| hypothetical protein POPTR_0001s08570g [Populus trichocarpa]
Length=302

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPDFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK+EFPELL IKES IKYV +PN+KT
Sbjct  269  LDTAKLKQEFPELLPIKESLIKYVFKPNQKT  299



>ref|XP_003570100.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=300

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPSFSWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D  KLK EFPELLSIKES IK V +PN+KT
Sbjct  267  LDTVKLKTEFPELLSIKESLIKNVFKPNQKT  297



>ref|XP_002882893.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59152.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFNLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+LSIK+S IKYV EPN++T
Sbjct  634  MDGSKLSKEFPEMLSIKDSLIKYVFEPNKRT  664



>ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=672

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  GVV HNEI EMY+KY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRDCRGIWNFTNPGVVSHNEILEMYRKYINPDFKWTNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIK+S IKYV EPNRK
Sbjct  639  MDASKLKVEFPELLSIKDSLIKYVFEPNRK  668



>ref|XP_008445073.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Cucumis melo]
Length=667

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  GVV HNEI EMYKKY+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRDCRGIWNFTNPGVVSHNEILEMYKKYIDPKFTWENFNLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES +KYV E N+KT
Sbjct  637  LDASKLKKEFPELLSIKESILKYVFEANKKT  667



>gb|KHG15836.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=681

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK Y+DP F W NFSL+EQAKVIVA RSNNE
Sbjct  584  SIEMAKRNLRGIWNFTNPGVVSHNEILQMYKDYIDPNFNWVNFSLQEQAKVIVAPRSNNE  643

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLK EFPELLSIK+S IKYV EPN KT
Sbjct  644  LDASKLKNEFPELLSIKDSLIKYVFEPNWKT  674



>ref|XP_007022008.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY13533.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=667

 Score =   143 bits (360),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y+D  F W NF+LEEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKTYIDSNFQWTNFTLEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELL IKES IKYV EPN++T
Sbjct  637  MDASKLKNEFPELLPIKESLIKYVFEPNKRT  667



>ref|XP_008373757.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=299

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL G +NFT  GVV HNEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGTYNFTNPGVVSHNEILEMYKEYIDPSFSYKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V +PN+KT
Sbjct  266  LDASKLKKEFPELLSIKESLIKNVFKPNQKT  296



>ref|XP_006297150.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
 gb|EOA30048.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
Length=664

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFTLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPE+LSIK+S IKYV EPN++T
Sbjct  634  MDGAKLSKEFPEMLSIKDSLIKYVFEPNKRT  664



>ref|XP_008776517.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=302

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NFSLEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFTWKNFSLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +  ++LK EFPELL IKES IKYV +PN+KT
Sbjct  269  LGTARLKNEFPELLPIKESLIKYVFKPNQKT  299



>emb|CDY32340.1| BnaC01g36590D [Brassica napus]
Length=643

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL G+WNFT  GVV HNEI EMYK Y++P+F W+NF+LEEQAKVIVA RSNNE
Sbjct  553  SIEMAKRNLRGVWNFTNPGVVSHNEILEMYKSYIEPSFKWSNFTLEEQAKVIVAPRSNNE  612

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPE+L IKES IKYV EPN++T
Sbjct  613  MDGAKLSKEFPEMLPIKESLIKYVFEPNKRT  643



>ref|XP_004960685.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=666

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GI+NFT  GVV HNEI EMYK+Y+ P+F W NF+LEEQAKVI+A RSNNE
Sbjct  573  SVEMAKRNLRGIYNFTNPGVVSHNEILEMYKQYIHPSFKWTNFNLEEQAKVIIAPRSNNE  632

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLKKEFPELLSIK+S IKYV EPN+K
Sbjct  633  MDASKLKKEFPELLSIKDSLIKYVFEPNQK  662



>ref|XP_002894444.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70703.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY  Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYTNYIEPGFKWSNFTLEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+L IKES IKYV EPN++T
Sbjct  638  MDGSKLSKEFPEMLPIKESLIKYVFEPNKRT  668



>ref|XP_007040092.1| Nucleotide-rhamnose synthase/epimerase-reductase [Theobroma cacao]
 gb|EOY24593.1| Nucleotide-rhamnose synthase/epimerase-reductase [Theobroma cacao]
Length=300

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY  Y+D  F W NF+LEEQAKVI+A RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYHDYIDSNFSWKNFTLEEQAKVIIAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLSIKES +KYV EPN+KT
Sbjct  267  LDTNKLKNEFPELLSIKESLVKYVFEPNKKT  297



>ref|XP_002303557.1| hypothetical protein POPTR_0003s12000g [Populus trichocarpa]
 gb|ABK94255.1| unknown [Populus trichocarpa]
 gb|EEE78536.1| hypothetical protein POPTR_0003s12000g [Populus trichocarpa]
Length=302

 Score =   138 bits (347),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPKFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D  KLK+EFPELL IKES IKYV +PN+KT
Sbjct  269  LDTVKLKQEFPELLPIKESLIKYVFKPNQKT  299



>ref|XP_011033826.1| PREDICTED: bifunctional dTDP-4-dehydrorhamnose 3,5-epimerase/dTDP-4-dehydrorhamnose 
reductase [Populus euphratica]
Length=302

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  209  SIEMAKRNLTGIYNFTNPGVVSHNEILEMYRDYIDPKFTWKNFTLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D  KLK+EFPELL IKES IKYV +PN+KT
Sbjct  269  LDTVKLKQEFPELLPIKESLIKYVFKPNQKT  299



>ref|XP_006358852.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=301

 Score =   138 bits (347),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP+F W NF++EEQAKVIVA RSNNE
Sbjct  208  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPSFSWKNFTIEEQAKVIVAPRSNNE  267

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKL KEFPE+ SIKES I+ V +PNRKT
Sbjct  268  LDASKLSKEFPEMKSIKESLIENVFKPNRKT  298



>ref|XP_004498563.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498564.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=655

 Score =   142 bits (357),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GV+ HNEI E+YK+Y+DP F W NF LEEQAKVIVA RSNNE
Sbjct  565  SIEMAKRNLKGIWNFTNPGVISHNEILELYKEYIDPQFKWENFDLEEQAKVIVAQRSNNE  624

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFP LLSIK+S IK+V EPN+KT
Sbjct  625  MDASKLKNEFPNLLSIKDSVIKFVFEPNKKT  655



>gb|EYU38237.1| hypothetical protein MIMGU_mgv1a002436mg [Erythranthe guttata]
Length=675

 Score =   142 bits (358),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK+Y+D  F W+NF+LEEQAKVI+A RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKEYIDADFKWSNFTLEEQAKVIIAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V  PNRKT
Sbjct  640  LDASKLKKEFPELLSIKESLIKNVFGPNRKT  670



>ref|XP_006845495.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
 gb|ERN07170.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
Length=681

 Score =   142 bits (358),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  K+N  GIWN+T  GVV HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  591  SIEMAKKNCRGIWNYTNPGVVSHNEILEMYRDYIDPSFKWVNFNLEEQAKVIVAPRSNNE  650

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DASKLKKEFPELLSIKES IKYV EPN++
Sbjct  651  LDASKLKKEFPELLSIKESLIKYVFEPNKR  680



>ref|XP_003588651.1| Rhamnose synthase [Medicago truncatula]
 gb|AES58902.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=655

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GV+ HN+I E+Y+ Y+DP++ W NF+LEEQAKVIVA RSNNE
Sbjct  565  SIEMAKRNLKGIWNFTNPGVISHNQILELYRDYIDPSYKWVNFNLEEQAKVIVAPRSNNE  624

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELLSIK+S IK+V EPN+KT
Sbjct  625  MDASKLKNEFPELLSIKDSVIKFVFEPNKKT  655



>ref|XP_008776518.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=302

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  +RNL GIWNFT  G V HNEI EMY+ Y+DP F W NFSLEEQAKVIVA RSNNE
Sbjct  209  SIEMARRNLTGIWNFTNPGAVSHNEILEMYRDYIDPNFTWKNFSLEEQAKVIVAPRSNNE  268

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNR  262
            +D +KLK EFPELLSIKES IKYV +PN+
Sbjct  269  LDTTKLKNEFPELLSIKESLIKYVFKPNQ  297



>ref|NP_188097.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
 sp|Q9LH76.1|RHM3_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3; AltName: Full=Probable rhamnose biosynthetic 
enzyme 3; Short=AtRHM3; Includes: RecName: Full=UDP-glucose 
4,6-dehydratase; Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase 
[Arabidopsis thaliana]
 dbj|BAB02645.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL84958.1| AT3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AAM98324.1| At3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AEE75567.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
Length=664

 Score =   142 bits (357),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF+LEEQAKVIVA RSNNE
Sbjct  574  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPDFKWSNFNLEEQAKVIVAPRSNNE  633

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPE+LSIK+S IKYV EPN++T
Sbjct  634  MDGAKLSKEFPEMLSIKDSLIKYVFEPNKRT  664



>emb|CDX98052.1| BnaA06g08030D [Brassica napus]
Length=323

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMY++++DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  226  SLEMAKRNLTGIWNFTNPGVVSHNEILEMYREFVDPSFTWKNFTLEEQAKVIVAPRSNNE  285

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNR  262
            +DA+KLK EFPE+LSIKE+ +K+V EPN+
Sbjct  286  LDATKLKTEFPEMLSIKEALVKFVFEPNK  314



>ref|XP_010268536.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Nelumbo nucifera]
Length=665

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMY+ Y+DP F W NFSL+EQAKVIVA RSNNE
Sbjct  575  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYRNYIDPEFKWVNFSLDEQAKVIVAPRSNNE  634

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKL+KEFP LLSIK+S IKYV EPN++T
Sbjct  635  LDASKLQKEFPGLLSIKDSIIKYVFEPNKRT  665



>ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
 gb|EER95086.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
Length=672

 Score =   142 bits (357),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  K++  GIWNFT  GVV HNEI EMYKKY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKQDCRGIWNFTNPGVVSHNEILEMYKKYINPDFKWTNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFP+LLSIK+S IKYV EPNRK
Sbjct  639  MDASKLKAEFPQLLSIKDSLIKYVFEPNRK  668



>gb|EMT13548.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=300

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFSWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D  KLK EFPELLSIKES IK V +PN+KT
Sbjct  267  LDTVKLKTEFPELLSIKESLIKNVFKPNQKT  297



>gb|EMS50143.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=300

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  207  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFSWKNFNLEEQAKVIVAPRSNNE  266

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D  KLK EFPELLSIKES IK V +PN+KT
Sbjct  267  LDTVKLKTEFPELLSIKESLIKNVFKPNQKT  297



>gb|KEH17189.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=798

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP+F W NF+LEEQAKVIVA RSNNE
Sbjct  708  SIEMAKRNLSGIWNFTNPGAVSHNEILEMYRDYIDPSFKWQNFTLEEQAKVIVAARSNNE  767

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MD +KLKKEFPELLSIKES IKYV  PN+K
Sbjct  768  MDGAKLKKEFPELLSIKESLIKYVFVPNKK  797



>ref|XP_011045548.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Populus euphratica]
Length=670

 Score =   141 bits (356),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 69/91 (76%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W NF LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKNYINPDFTWVNFDLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKLK EFPELL IK S IKYV EPN++T
Sbjct  640  MDASKLKNEFPELLPIKGSLIKYVFEPNKRT  670



>gb|EPS68271.1| hypothetical protein M569_06499, partial [Genlisea aurea]
Length=297

 Score =   137 bits (345),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP+F W NFSLEEQAKVIVA RSNNE
Sbjct  208  SIEMGKRNLTGIWNFTNPGVVSHNEILEMYRDYVDPSFSWKNFSLEEQAKVIVAPRSNNE  267

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLK  FP +L+IKES ++YV  PNRK
Sbjct  268  LDATKLKDHFPRMLTIKESLLQYVFIPNRK  297



>ref|XP_006392784.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
 gb|ESQ30070.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
Length=667

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF++EEQAKVIVA RSNNE
Sbjct  577  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTVEEQAKVIVAPRSNNE  636

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD SKL KEFPE+L IKE+ IKYV EPN++T
Sbjct  637  MDGSKLSKEFPEMLPIKEALIKYVFEPNKRT  667



>dbj|BAJ95321.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=327

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 73/91 (80%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMY+ Y+DP F W NF+LEEQAKVIVA RSNNE
Sbjct  234  SIEMAKRNLTGIWNFTNPGVVSHNEILEMYRDYIDPNFSWKNFNLEEQAKVIVAPRSNNE  293

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D  KLK EFPELLSIKES IK V +PN+KT
Sbjct  294  LDTVKLKTEFPELLSIKESLIKNVFKPNQKT  324



>ref|XP_008380346.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
 ref|XP_008358039.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
Length=688

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GV+ HNEI EMYK Y+DP+F W NF++EEQAKV+VA RSN E
Sbjct  581  SVEMAKRNLRGIWNFTNPGVLSHNEILEMYKNYIDPSFKWTNFTVEEQAKVLVAGRSNCE  640

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELL +KES IKYV EPN+KT
Sbjct  641  VDASKLKKEFPELLPVKESLIKYVFEPNKKT  671



>ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=673

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  GVV HNEI EMYK++++P F W NF+LEEQAKVIVA RSNNE
Sbjct  580  SIEMAKRDCRGIWNFTNPGVVSHNEILEMYKEHINPDFKWTNFTLEEQAKVIVAPRSNNE  639

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIK+S IKYV EPNRK
Sbjct  640  MDASKLKSEFPELLSIKDSLIKYVFEPNRK  669



>ref|XP_001775602.1| predicted protein [Physcomitrella patens]
 gb|EDQ59549.1| predicted protein [Physcomitrella patens]
Length=679

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KRNL GIWNFT  GVV HNEI EMYK+Y+DP   W NF+LEEQAKVIVA RSNNE
Sbjct  585  SLEMAKRNLTGIWNFTNPGVVSHNEIMEMYKEYIDPELSWVNFTLEEQAKVIVAARSNNE  644

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKL +EFPE+L IKES  K+V EPNRKT
Sbjct  645  MDASKLSREFPEVLGIKESLKKFVFEPNRKT  675



>ref|XP_004509959.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=667

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMY+ Y+DP + W NF+LEEQAKVIVA RSNNE
Sbjct  578  SIEMAKRNLSGIWNFTNPGAVSHNEILEMYRDYIDPNYKWENFTLEEQAKVIVAARSNNE  637

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDA+KLK EFPELL IKES IKYV EPN+K
Sbjct  638  MDATKLKNEFPELLPIKESLIKYVFEPNKK  667



>ref|XP_010060763.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW67616.1| hypothetical protein EUGRSUZ_F01369 [Eucalyptus grandis]
Length=666

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  G V HNEI EMYK Y+DP F W NF+LEEQA+VIVA RSNNE
Sbjct  573  SIEMAKRNLRGIWNFTNPGAVSHNEILEMYKSYIDPDFQWVNFTLEEQAQVIVAPRSNNE  632

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA+KLK EFP+LLSIK+S IKYV EPN+K
Sbjct  633  LDATKLKNEFPDLLSIKDSLIKYVFEPNKK  662



>ref|XP_007011619.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY29238.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=659

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GV+ HNEI EMY  Y++P F W NFSLEEQAKVIVA RSNNE
Sbjct  569  SIEMAKRNCRGIWNFTNPGVISHNEILEMYNAYINPQFKWKNFSLEEQAKVIVAPRSNNE  628

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DA+KLKKEFPELLSIK+S IKYV +PN+KT
Sbjct  629  LDAAKLKKEFPELLSIKDSIIKYVFKPNKKT  659



>emb|CDY45116.1| BnaC06g06370D [Brassica napus]
Length=665

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF++EEQAKVIVA RSNNE
Sbjct  575  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTVEEQAKVIVAPRSNNE  634

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPE+L IKE+ IKYV EPN++T
Sbjct  635  MDGAKLSKEFPEMLPIKEALIKYVFEPNKRT  665



>emb|CDY24092.1| BnaA06g00900D [Brassica napus]
Length=665

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI EMYK Y++P F W+NF++EEQAKVIVA RSNNE
Sbjct  575  SIEMAKRNLRGIWNFTNPGVVSHNEILEMYKSYIEPGFKWSNFTVEEQAKVIVAPRSNNE  634

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MD +KL KEFPE+L IKE+ IKYV EPN++T
Sbjct  635  MDGAKLSKEFPEMLPIKEALIKYVFEPNKRT  665



>ref|XP_008365831.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=353

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/91 (75%), Positives = 77/91 (85%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GI+NFT  GVV  NEI EMYK+Y+DP+F + NF+LEEQAKVIVA RSNNE
Sbjct  260  SIEMAKRNLTGIYNFTNPGVVSXNEILEMYKEYIDPSFTYKNFTLEEQAKVIVAPRSNNE  319

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELLSIKES IK V +PN+KT
Sbjct  320  LDASKLKKEFPELLSIKESLIKNVFKPNQKT  350



>ref|XP_007048831.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007048832.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92988.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92989.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
Length=732

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 77/93 (83%), Gaps = 2/93 (2%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK Y+DP F W NF+LEEQA+VIVA RSNNE
Sbjct  582  SIEMAKRNLRGIWNFTNPGVVSHNEILQMYKDYIDPNFNWVNFTLEEQARVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEP--NRKT  256
            +DASKLK+EFPE+LSIK+S IKYV EP  NRKT
Sbjct  642  LDASKLKEEFPEILSIKDSLIKYVFEPNSNRKT  674



>ref|XP_001779703.1| predicted protein [Physcomitrella patens]
 gb|EDQ55499.1| predicted protein [Physcomitrella patens]
Length=666

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK+Y+DP+  W NF+LEEQAKVIVA RSNNE
Sbjct  573  SIEMAKRNLTGIWNFTNPGVVSHNEIMDMYKEYIDPSLTWENFTLEEQAKVIVAARSNNE  632

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            MDASKL  EFPE+L IKES  K+V EPNRKT
Sbjct  633  MDASKLLSEFPEMLGIKESLKKFVFEPNRKT  663



>gb|AFK41450.1| unknown [Medicago truncatula]
 gb|KEH31692.1| 3,5-epimerase/4-reductase [Medicago truncatula]
Length=298

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK Y+D +F W NF+LEEQAKVIVA RSNNE
Sbjct  206  SIEMAKRNLTGIWNFTNPGVVSHNEILQMYKDYIDSSFTWKNFTLEEQAKVIVAPRSNNE  265

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA KLKKEFPELLSIKES I+ V +PN+K
Sbjct  266  LDAGKLKKEFPELLSIKESLIENVFKPNQK  295



>ref|NP_001151455.1| RHM1 [Zea mays]
 ref|XP_008658705.1| PREDICTED: RHM1 isoform X1 [Zea mays]
 gb|ACG42927.1| RHM1 [Zea mays]
 gb|ACN32027.1| unknown [Zea mays]
 gb|AFW88805.1| RHM1 isoform 1 [Zea mays]
 gb|AFW88806.1| RHM1 isoform 2 [Zea mays]
Length=672

 Score =   140 bits (353),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/90 (74%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KR+  GIWNFT  G V HNEI EMYKKY++P F W NF+LEEQAKVIVA RSNNE
Sbjct  579  SIEMAKRDCRGIWNFTNPGAVSHNEILEMYKKYINPDFKWTNFTLEEQAKVIVAPRSNNE  638

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MD SKLK EFP+LLSIK+S IKYV EPNRK
Sbjct  639  MDTSKLKAEFPQLLSIKDSLIKYVFEPNRK  668



>gb|EMS45937.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=675

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KR+  GIWNFT  GVV HNEI EMYK+Y++P F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SVEMAKRDCRGIWNFTNPGVVSHNEILEMYKEYINPDFKWTNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIKES IK V EPNRK
Sbjct  642  MDASKLKSEFPELLSIKESLIKNVFEPNRK  671



>dbj|BAJ86835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=675

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KR+  GIWNFT  GVV HNEI EMYK+Y++P F W NF+LEEQAKVIVA RSNNE
Sbjct  582  SVEMAKRDCRGIWNFTNPGVVSHNEILEMYKEYINPDFKWTNFTLEEQAKVIVAPRSNNE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            MDASKLK EFPELLSIKES IK V EPNRK
Sbjct  642  MDASKLKSEFPELLSIKESLIKNVFEPNRK  671



>ref|XP_009356708.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Pyrus x bretschneideri]
Length=689

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 65/91 (71%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            S+E  KR+L GIWNFT  GV+ HNEI EMYK Y+DP+F W NF++EEQAKV+VA RSN E
Sbjct  582  SVEMAKRHLRGIWNFTNPGVLSHNEILEMYKNYIDPSFKWTNFTVEEQAKVLVAGRSNCE  641

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +DASKLKKEFPELL +KES IKYV EPN+KT
Sbjct  642  VDASKLKKEFPELLPVKESLIKYVFEPNKKT  672



>ref|XP_009586858.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586859.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586860.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=653

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMY++Y+DP F W NF+L+EQAKVIVA RSNNE
Sbjct  563  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYREYIDPNFKWQNFNLQEQAKVIVAPRSNNE  622

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLSIK+S IKYV  PNRKT
Sbjct  623  LDTTKLKNEFPELLSIKDSIIKYVFGPNRKT  653



>ref|XP_009803668.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=653

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRN  GIWNFT  GVV HNEI EMY++Y+DP F W NF+L+EQAKVIVA RSNNE
Sbjct  563  SIEMAKRNCRGIWNFTNPGVVSHNEILEMYREYIDPNFKWQNFNLQEQAKVIVAPRSNNE  622

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRKT  256
            +D +KLK EFPELLSIK+S IKYV  PNRKT
Sbjct  623  LDTTKLKNEFPELLSIKDSIIKYVFGPNRKT  653



>ref|XP_004515790.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=303

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/90 (73%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -1

Query  528  SIEXXKRNLXGIWNFTXXGVVGHNEIXEMYKKYMDPAFXWANFSLEEQAKVIVAXRSNNE  349
            SIE  KRNL GIWNFT  GVV HNEI +MYK+Y+D  F W NF+LEEQAKVIVA RSNNE
Sbjct  211  SIEMAKRNLTGIWNFTNPGVVSHNEILQMYKEYVDSNFTWKNFTLEEQAKVIVAPRSNNE  270

Query  348  MDASKLKKEFPELLSIKESXIKYVXEPNRK  259
            +DA KLKKEFPELLSIKES I+ V +PN+K
Sbjct  271  LDAEKLKKEFPELLSIKESLIENVFKPNQK  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556507818200