BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF038C08

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009792656.1|  PREDICTED: sucrose synthase                        317   2e-98   Nicotiana sylvestris
ref|XP_009625446.1|  PREDICTED: sucrose synthase                        317   2e-98   Nicotiana tomentosiformis
ref|NP_001275286.1|  sucrose synthase                                   314   2e-97   Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            313   3e-97   Solanum tuberosum [potatoes]
emb|CAA09681.1|  sucrose synthase                                       313   4e-97   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   313   4e-97   
gb|AAA97571.1|  sucrose synthase                                        312   7e-97   Solanum tuberosum [potatoes]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    311   3e-96   Solanum tuberosum [potatoes]
gb|ABV02029.1|  sucrose sythase                                         308   3e-95   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        308   4e-95   Sesamum indicum [beniseed]
gb|AHL84158.1|  sucrose synthase                                        308   5e-95   Nicotiana tabacum [American tobacco]
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           307   7e-95   
ref|NP_001274911.1|  sucrose synthase 2                                 307   7e-95   Solanum tuberosum [potatoes]
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    307   8e-95   Solanum tuberosum [potatoes]
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             307   1e-94   
ref|NP_001234804.1|  sucrose synthase                                   306   1e-94   
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        306   3e-94   Nicotiana sylvestris
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        305   7e-94   Nicotiana tomentosiformis
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    305   7e-94   Daucus carota [carrots]
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        304   1e-93   
emb|CAI56307.1|  sucrose synthase                                       303   4e-93   Coffea canephora [robusta coffee]
emb|CAJ32596.1|  sucrose synthase                                       301   1e-92   Coffea arabica [arabica coffee]
gb|ABI17891.1|  sucrose synthase                                        301   2e-92   Coffea canephora [robusta coffee]
dbj|BAD94975.1|  sucrose-UDP glucosyltransferase                        284   9e-92   Arabidopsis thaliana [mouse-ear cress]
gb|ADR00484.1|  sucrose synthase                                        287   2e-90   Arachis hypogaea var. vulgaris [Spanish peanut]
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        295   3e-90   Populus euphratica
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        295   3e-90   Populus euphratica
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    295   4e-90   Daucus carota [carrots]
gb|ADW80556.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|AEQ94149.1|  sucrose synthase1                                       278   4e-90   Elaeis guineensis
gb|ADW80559.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80552.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80550.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80555.1|  sucrose synthase 1                                      295   4e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80536.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80571.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80566.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80551.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      295   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80548.1|  sucrose synthase 1                                      294   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80562.1|  sucrose synthase 1                                      294   5e-90   Populus tomentosa [Chinese white poplar]
gb|ADW80558.1|  sucrose synthase 1                                      294   5e-90   Populus tomentosa [Chinese white poplar]
emb|CAA67195.1|  sucrose synthase                                       275   7e-90   Pisum sativum [garden pea]
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         294   7e-90   Jatropha curcas
gb|AGH29112.1|  sucrose synthase                                        294   9e-90   Jatropha curcas
gb|KJB65372.1|  hypothetical protein B456_010G092300                    294   1e-89   Gossypium raimondii
gb|AFS17277.1|  sucrose synthase 1                                      293   1e-89   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       293   1e-89   
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       294   2e-89   Theobroma cacao [chocolate]
gb|AEN79500.1|  sucrose synthase 1                                      293   2e-89   Phelipanche ramosa
dbj|BAM37539.1|  sucrose synthase                                       293   2e-89   Mangifera indica
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        293   2e-89   Fragaria vesca subsp. vesca
dbj|BAM68521.1|  sucrose synthase                                       293   2e-89   Mangifera indica
gb|KJB82966.1|  hypothetical protein B456_013G222400                    293   2e-89   Gossypium raimondii
gb|AHA41509.1|  sucrose synthase                                        293   3e-89   Populus deltoides
gb|AEV40460.1|  sucrose synthase 1                                      293   3e-89   Gossypium arboreum [tree cotton]
gb|KHG00606.1|  Sucrose synthase                                        293   3e-89   Gossypium arboreum [tree cotton]
gb|ADW80545.1|  sucrose synthase 1                                      292   3e-89   Populus tomentosa [Chinese white poplar]
dbj|BAA89049.1|  sucrose synthase                                       292   4e-89   Citrus unshiu [satsuma mandarin]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        292   4e-89   Citrus sinensis [apfelsine]
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             292   4e-89   Citrus clementina [clementine]
gb|AAK59464.1|  putative sucrose synthase                               285   5e-89   Arabidopsis thaliana [mouse-ear cress]
gb|AHL29281.1|  sucrose synthase 1                                      292   5e-89   Camellia sinensis [black tea]
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   291   5e-89   Citrus sinensis [apfelsine]
gb|AEV40463.1|  sucrose synthase 4                                      292   5e-89   Gossypium arboreum [tree cotton]
emb|CAB39757.2|  sucrose synthase                                       275   7e-89   Lotus japonicus
gb|AEV40464.1|  sucrose synthase 5                                      291   1e-88   Gossypium arboreum [tree cotton]
dbj|BAA88905.1|  sucrose synthase                                       290   2e-88   Citrus unshiu [satsuma mandarin]
gb|ADR81996.1|  sucrose synthase 1                                      290   2e-88   Populus trichocarpa [western balsam poplar]
dbj|BAM68520.1|  sucrose synthase                                       290   2e-88   Mangifera indica
ref|XP_002324136.2|  sucrose synthase family protein                    290   2e-88   
dbj|BAM68527.1|  sucrose synthase                                       290   2e-88   Mangifera indica
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        290   2e-88   
gb|KHN17754.1|  Sucrose synthase                                        290   2e-88   Glycine soja [wild soybean]
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        290   2e-88   Cicer arietinum [garbanzo]
dbj|BAM68526.1|  sucrose synthase                                       290   3e-88   Mangifera indica
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        290   3e-88   Cicer arietinum [garbanzo]
gb|ABD61653.1|  sucrose synthase                                        290   3e-88   Cichorium intybus [radicchio]
gb|ADY68844.1|  sucrose synthase                                        290   3e-88   Gossypium barbadense [Egyptian cotton]
gb|AEN71079.1|  sucrose synthase Sus1                                   290   3e-88   Gossypium aridum
gb|AEN71067.1|  sucrose synthase Sus1                                   290   4e-88   Gossypium tomentosum
gb|ACV72640.1|  sucrose synthase 1                                      290   4e-88   Gossypium hirsutum [American cotton]
gb|AEN71075.1|  sucrose synthase Sus1                                   290   4e-88   Gossypium armourianum
gb|AEV40462.1|  sucrose synthase 3                                      290   4e-88   Gossypium arboreum [tree cotton]
gb|AEN71080.1|  sucrose synthase Sus1                                   290   4e-88   Gossypium gossypioides
gb|AEN71063.1|  sucrose synthase Sus1                                   290   4e-88   Gossypium mustelinum
gb|ADY68845.1|  sucrose synthase                                        290   4e-88   Gossypium barbadense [Egyptian cotton]
gb|AEN71068.1|  sucrose synthase Sus1                                   289   4e-88   Gossypium tomentosum
gb|AEN71078.1|  sucrose synthase Sus1                                   289   4e-88   Gossypium klotzschianum
gb|ADY68848.1|  sucrose synthase                                        289   4e-88   Gossypium hirsutum [American cotton]
gb|ADY68846.1|  sucrose synthase                                        289   4e-88   Gossypium herbaceum subsp. africanum
gb|AEN71059.1|  sucrose synthase Sus1                                   289   4e-88   Gossypium thurberi
gb|AEN71066.1|  sucrose synthase Sus1                                   289   5e-88   Gossypium darwinii
gb|AEN71061.1|  sucrose synthase Sus1                                   289   5e-88   Gossypium schwendimanii
gb|AAR03498.1|  sucrose synthase                                        289   5e-88   Populus tremuloides
gb|AFO84090.1|  sucrose synthase                                        289   7e-88   Actinidia chinensis
gb|AIJ28960.1|  sucrose synthase                                        288   8e-88   Manihot esculenta subsp. flabellifolia
ref|XP_006381564.1|  sucrose synthase family protein                    288   2e-87   Populus trichocarpa [western balsam poplar]
gb|ADR81997.1|  sucrose synthase 2                                      288   2e-87   Populus trichocarpa [western balsam poplar]
gb|AGM14949.1|  sucrose synthase 4                                      288   2e-87   Hevea brasiliensis [jebe]
gb|AEF56625.1|  sucrose synthase                                        288   2e-87   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|AEK81522.1|  sucrose synthase isoform D                              288   2e-87   Gossypium hirsutum [American cotton]
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             287   3e-87   Capsella rubella
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      287   3e-87   Tarenaya hassleriana [spider flower]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        287   3e-87   Nelumbo nucifera [Indian lotus]
gb|ADW80593.1|  sucrose synthase 2                                      287   3e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80590.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80589.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|AIJ28961.1|  sucrose synthase                                        286   4e-87   Manihot esculenta [manioc]
gb|ABD96570.1|  sucrose synthase                                        286   4e-87   Manihot esculenta [manioc]
gb|ADW80608.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80597.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80586.1|  sucrose synthase 2                                      286   4e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80588.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80600.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|AEN71060.1|  sucrose synthase Sus1                                   286   5e-87   Gossypium laxum
gb|ADW80609.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ACF80843.1|  unknown                                                 268   5e-87   Zea mays [maize]
gb|ADW80575.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80580.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80578.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
ref|XP_010493195.1|  PREDICTED: sucrose synthase 1                      286   5e-87   Camelina sativa [gold-of-pleasure]
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        286   5e-87   Eucalyptus grandis [rose gum]
gb|ADW80610.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      286   5e-87   Populus tomentosa [Chinese white poplar]
ref|XP_010454391.1|  PREDICTED: sucrose synthase 1-like isoform X2      286   5e-87   Camelina sativa [gold-of-pleasure]
gb|ABW76422.1|  sucrose synthase                                        286   5e-87   Populus tremuloides
ref|XP_010420928.1|  PREDICTED: sucrose synthase 1-like                 286   5e-87   Camelina sativa [gold-of-pleasure]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        286   6e-87   Populus euphratica
gb|ADW80596.1|  sucrose synthase 2                                      286   6e-87   Populus tomentosa [Chinese white poplar]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        286   6e-87   Malus domestica [apple tree]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        286   6e-87   Nelumbo nucifera [Indian lotus]
gb|AGM14948.1|  sucrose synthase 3                                      286   7e-87   Hevea brasiliensis [jebe]
ref|NP_566865.2|  sucrose synthase 4                                    286   7e-87   Arabidopsis thaliana [mouse-ear cress]
gb|AAR19769.1|  sucrose synthase                                        286   7e-87   Beta vulgaris [beet]
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        286   7e-87   
gb|ADW80602.1|  sucrose synthase 2                                      286   7e-87   Populus tomentosa [Chinese white poplar]
gb|AAD28641.1|  sucrose synthase                                        286   8e-87   Gossypium hirsutum [American cotton]
emb|CDX70945.1|  BnaC03g10290D                                          286   8e-87   
ref|XP_010454392.1|  PREDICTED: sucrose synthase 1-like isoform X3      286   8e-87   Camelina sativa [gold-of-pleasure]
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    286   9e-87   Brassica rapa
emb|CDX92432.1|  BnaA10g14710D                                          286   9e-87   
emb|CDY16569.1|  BnaC09g37040D                                          286   9e-87   Brassica napus [oilseed rape]
gb|AGO61958.1|  sucrose synthase                                        276   1e-86   Prunus serrulata
gb|ABR25521.1|  sucrose synthase metabolism                             268   1e-86   Oryza sativa Indica Group [Indian rice]
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             285   1e-86   
gb|AEK81520.1|  sucrose synthase isoform B                              285   1e-86   Gossypium hirsutum [American cotton]
tpg|DAA45272.1|  TPA: putative sucrose synthase family protein          271   1e-86   
ref|XP_010454390.1|  PREDICTED: sucrose synthase 1-like isoform X1      286   1e-86   Camelina sativa [gold-of-pleasure]
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        285   2e-86   Vitis vinifera
emb|CAN82840.1|  hypothetical protein VITISV_024563                     285   2e-86   Vitis vinifera
ref|NP_001289655.1|  sucrose synthase                                   285   2e-86   Eucalyptus grandis [rose gum]
gb|ADW80579.1|  sucrose synthase 2                                      285   2e-86   Populus tomentosa [Chinese white poplar]
gb|ADW80603.1|  sucrose synthase 2                                      285   2e-86   Populus tomentosa [Chinese white poplar]
ref|NP_197583.1|  sucrose synthase 1                                    285   2e-86   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80599.1|  sucrose synthase 2                                      285   2e-86   Populus tomentosa [Chinese white poplar]
gb|AIJ28959.1|  sucrose synthase                                        285   2e-86   Manihot esculenta subsp. flabellifolia
emb|CDX88838.1|  BnaA03g08110D                                          283   2e-86   
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 285   2e-86   Tarenaya hassleriana [spider flower]
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      285   2e-86   Brassica rapa
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    285   2e-86   Arabidopsis thaliana [mouse-ear cress]
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                286   2e-86   Erythranthe guttata [common monkey flower]
gb|ADW80577.1|  sucrose synthase 2                                      285   2e-86   Populus tomentosa [Chinese white poplar]
ref|XP_003609947.1|  Sucrose synthase                                   278   2e-86   
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             285   3e-86   Phaseolus vulgaris [French bean]
gb|AAN76498.1|AF315375_1  sucrose synthase                              285   3e-86   Phaseolus vulgaris [French bean]
gb|ADW80604.1|  sucrose synthase 2                                      284   3e-86   Populus tomentosa [Chinese white poplar]
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             284   4e-86   Phaseolus vulgaris [French bean]
ref|NP_001237525.1|  sucrose synthase                                   284   4e-86   Glycine max [soybeans]
gb|AIJ28962.1|  sucrose synthase                                        284   4e-86   Manihot esculenta [manioc]
gb|ADW80601.1|  sucrose synthase 2                                      284   6e-86   Populus tomentosa [Chinese white poplar]
gb|ADW80611.1|  sucrose synthase 2                                      283   7e-86   Populus tomentosa [Chinese white poplar]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             284   8e-86   
gb|ADW80583.1|  sucrose synthase 2                                      283   1e-85   Populus tomentosa [Chinese white poplar]
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      283   1e-85   Phoenix dactylifera
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             283   1e-85   Eutrema salsugineum [saltwater cress]
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      283   1e-85   Phoenix dactylifera
gb|AAA34305.1|  sucrose synthase type 2                                 267   1e-85   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   283   1e-85   
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   283   2e-85   
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        282   2e-85   
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   282   2e-85   Pyrus x bretschneideri [bai li]
gb|KHN49081.1|  Sucrose synthase                                        282   2e-85   Glycine soja [wild soybean]
gb|KJB65376.1|  hypothetical protein B456_010G092300                    282   2e-85   Gossypium raimondii
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        282   2e-85   Glycine max [soybeans]
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   282   2e-85   
gb|ACP17902.1|  sucrose synthase                                        282   3e-85   Phaseolus vulgaris [French bean]
emb|CAA09910.1|  sucrose synthase                                       282   3e-85   Pisum sativum [garden pea]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             282   3e-85   Arabidopsis lyrata subsp. lyrata
gb|AFW88069.1|  sucrose synthase1                                       271   3e-85   
gb|KHN47619.1|  Sucrose synthase                                        282   3e-85   Glycine soja [wild soybean]
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        282   3e-85   Pisum sativum [garden pea]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   282   3e-85   Pyrus x bretschneideri [bai li]
gb|ADW80576.1|  sucrose synthase 2                                      282   3e-85   Populus tomentosa [Chinese white poplar]
tpg|DAA45273.1|  TPA: putative sucrose synthase family protein          271   3e-85   
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    281   4e-85   Vicia faba [broad bean]
emb|CDO97805.1|  unnamed protein product                                280   6e-85   Coffea canephora [robusta coffee]
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   281   6e-85   Pyrus x bretschneideri [bai li]
gb|ABP88869.1|  sucrose synthase                                        281   7e-85   Medicago falcata [sickle alfalfa]
ref|XP_010107074.1|  Sucrose synthase                                   281   8e-85   Morus notabilis
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        281   8e-85   
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        280   1e-84   
gb|AGQ57012.1|  sucrose synthase 1                                      280   1e-84   Hevea brasiliensis [jebe]
gb|KEH37657.1|  sucrose synthase                                        280   1e-84   Medicago truncatula
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    280   2e-84   Tulipa gesneriana
dbj|BAM05649.1|  sucrose synthase 3                                     280   2e-84   Eucalyptus globulus subsp. globulus
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    279   2e-84   Medicago sativa [alfalfa]
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    279   3e-84   Vigna radiata var. radiata [golden gram]
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        279   3e-84   Pyrus x bretschneideri [bai li]
dbj|BAH56282.1|  sucrose synthase                                       279   3e-84   Vigna angularis [azuki bean]
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 279   3e-84   Elaeis guineensis
ref|XP_003609949.1|  Sucrose synthase                                   279   3e-84   Medicago truncatula
emb|CAB40795.1|  sucrose synthase                                       279   3e-84   Medicago truncatula
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    279   4e-84   Arabidopsis thaliana [mouse-ear cress]
gb|KJB82967.1|  hypothetical protein B456_013G222400                    279   4e-84   Gossypium raimondii
emb|CAA57881.1|  sucrose synthase                                       279   4e-84   Oxybasis rubra [pigweed]
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      279   5e-84   Phoenix dactylifera
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             278   6e-84   Prunus persica
gb|AFI57908.1|  sucrose synthase 1                                      278   6e-84   Prunus persica
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 278   6e-84   Elaeis guineensis
gb|AII19313.1|  sucrose synthase 1                                      278   8e-84   Ricinus communis
gb|ADE77562.1|  unknown                                                 263   8e-84   Picea sitchensis
ref|XP_002516210.1|  sucrose synthase, putative                         277   8e-84   
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      278   9e-84   Phoenix dactylifera
gb|ACN36258.1|  unknown                                                 270   1e-83   Zea mays [maize]
gb|AFM52233.1|  putative sucrose synthase 2                             277   1e-83   Gossypium arboreum [tree cotton]
emb|CAA50317.1|  sucrose synthase                                       277   1e-83   Arabidopsis thaliana [mouse-ear cress]
gb|KJB54541.1|  hypothetical protein B456_009G038000                    278   1e-83   Gossypium raimondii
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        277   1e-83   Prunus mume [ume]
gb|KJB54539.1|  hypothetical protein B456_009G038000                    278   2e-83   Gossypium raimondii
ref|XP_008795811.1|  PREDICTED: sucrose synthase 4-like                 262   2e-83   Phoenix dactylifera
tpg|DAA45279.1|  TPA: putative sucrose synthase family protein          268   2e-83   
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      278   2e-83   
ref|XP_003609946.1|  Sucrose synthase                                   278   2e-83   
gb|AGV22112.1|  sucrose synthase 2                                      277   2e-83   Betula luminifera [liang ye hua]
emb|CAA09680.1|  sucrose synthase                                       267   2e-83   Solanum lycopersicum
gb|ACF78506.1|  unknown                                                 271   2e-83   Zea mays [maize]
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        277   2e-83   
gb|ABE73120.1|  SUS1                                                    270   3e-83   Dianthus caryophyllus [carnation]
gb|AIL23782.1|  sucrose synthase                                        276   3e-83   Prunus serrulata
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        276   4e-83   
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       276   4e-83   Cucumis sativus [cucumbers]
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      276   5e-83   Phoenix dactylifera
dbj|BAM75184.1|  sucrose synthase                                       264   5e-83   Ricinus communis
ref|NP_001289661.1|  sucrose synthase-like                              276   5e-83   Eucalyptus grandis [rose gum]
gb|AEN83999.1|  sucrose synthase                                        276   5e-83   Cucumis sativus [cucumbers]
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   276   5e-83   Cucumis sativus [cucumbers]
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   276   5e-83   Eucalyptus grandis [rose gum]
gb|AFA36485.1|  putative sucrose synthase 2                             260   6e-83   Lolium perenne [perennial ryegrass]
ref|XP_006474683.1|  PREDICTED: sucrose synthase-like                   275   7e-83   Citrus sinensis [apfelsine]
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    276   8e-83   Tulipa gesneriana
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      275   1e-82   Elaeis guineensis
gb|AGM14947.1|  sucrose synthase 2                                      275   1e-82   Hevea brasiliensis [jebe]
dbj|BAM05650.1|  sucrose synthase 3                                     275   1e-82   Eucalyptus pilularis
dbj|BAM05651.1|  sucrose synthase 3                                     275   1e-82   
gb|EMT20174.1|  Sucrose synthase 2                                      273   1e-82   
gb|AAA34304.1|  sucrose synthase type 1                                 258   1e-82   
ref|XP_010932355.1|  PREDICTED: sucrose synthase 2-like isoform X2      274   1e-82   
ref|XP_008223239.1|  PREDICTED: sucrose synthase 2                      258   2e-82   
dbj|BAE06059.1|  sucrose synthase                                       275   2e-82   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      274   2e-82   
emb|CAC32462.1|  sucrose synthase isoform 3                             274   3e-82   
gb|AGQ57013.1|  sucrose synthase 2                                      274   3e-82   
ref|XP_009610442.1|  PREDICTED: sucrose synthase 4-like                 261   3e-82   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      274   3e-82   
gb|AEV40461.1|  sucrose synthase 2                                      272   3e-82   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 274   4e-82   
gb|AAM22755.1|  sucrose synthase                                        255   4e-82   
gb|KDO87158.1|  hypothetical protein CISIN_1g003492mg                   270   5e-82   
ref|XP_006444401.1|  hypothetical protein CICLE_v10018889mg             270   5e-82   
gb|KJB07349.1|  hypothetical protein B456_001G017700                    273   5e-82   
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          273   6e-82   
gb|KDO87153.1|  hypothetical protein CISIN_1g003492mg                   270   8e-82   
gb|KDO73800.1|  hypothetical protein CISIN_1g003947mg                   272   8e-82   
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        273   9e-82   
gb|ABR15470.1|  sucrose synthase                                        273   1e-81   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    272   1e-81   
ref|XP_006452875.1|  hypothetical protein CICLE_v10010343mg             272   1e-81   
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        273   1e-81   
gb|AFR41908.1|  sucrose synthase                                        253   1e-81   
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 272   1e-81   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like                 271   2e-81   
gb|ADY02961.1|  sucrose synthase                                        271   3e-81   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 271   3e-81   
gb|EMS65561.1|  Sucrose synthase 2                                      271   3e-81   
gb|AFY03626.1|  sucrose synthase                                        271   3e-81   
gb|AFR41929.1|  sucrose synthase                                        252   3e-81   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           271   4e-81   
dbj|BAA89232.1|  wsus                                                   271   4e-81   
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          271   5e-81   
ref|NP_001105194.1|  sucrose synthase2                                  271   5e-81   
gb|AGI56230.1|  sucrose synthase 1                                      271   6e-81   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   270   6e-81   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 270   6e-81   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             270   6e-81   
dbj|BAA88904.1|  sucrose synthase                                       270   6e-81   
gb|AHM02468.1|  sucrose synthase                                        270   6e-81   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   270   7e-81   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2      270   7e-81   
gb|AGM14950.1|  sucrose synthase 5                                      270   7e-81   
gb|AFR41915.1|  sucrose synthase                                        251   7e-81   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                   270   7e-81   
gb|AAL50570.1|AF412037_1  sucrose synthase                              270   7e-81   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          270   8e-81   
gb|AFR41912.1|  sucrose synthase                                        251   8e-81   
gb|AIL88517.1|  sucrose synthase type 2-2                               270   8e-81   
dbj|BAJ10424.1|  sucrose synthase                                       270   9e-81   
ref|XP_003562658.1|  PREDICTED: sucrose synthase 2                      270   1e-80   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg             270   1e-80   
gb|AIL88516.1|  sucrose synthase type 2-1                               270   1e-80   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         270   1e-80   
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 270   1e-80   
gb|AEO09338.2|  sucrose synthase                                        270   1e-80   
gb|AAM95944.1|  sucrose synthase                                        270   1e-80   
gb|EAY90371.1|  hypothetical protein OsI_11950                          270   1e-80   
ref|NP_001050319.1|  Os03g0401300                                       270   1e-80   
ref|NP_001105323.1|  sucrose synthase 2                                 269   2e-80   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      269   2e-80   
gb|AGW23638.1|  sucrose synthase                                        270   2e-80   
pir||S22535  sucrose synthase (EC 2.4.1.13) 1 - rice (fragment)         252   2e-80
ref|XP_006378062.1|  hypothetical protein POPTR_0010s01360g             258   2e-80   
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    268   3e-80   
ref|NP_001268888.1|  sucrose synthase 2-like                            268   3e-80   
gb|AFR41891.1|  sucrose synthase                                        249   3e-80   
gb|ABF95854.1|  Sucrose synthase 2, putative, expressed                 265   4e-80   
ref|XP_007163138.1|  hypothetical protein PHAVU_001G209600g             268   4e-80   
pir||S24966  sucrose synthase (EC 2.4.1.13) - barley (fragment)         263   4e-80
gb|AAA68209.1|  sus1                                                    268   4e-80   
gb|AFR41914.1|  sucrose synthase                                        249   5e-80   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                       268   5e-80   
dbj|BAA88981.1|  sucrose synthase                                       268   5e-80   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          268   6e-80   
gb|ACL79522.1|  sucrose synthase                                        253   6e-80   
ref|XP_010092252.1|  Sucrose synthase 2                                 268   6e-80   
gb|AFY03625.1|  sucrose synthase                                        261   6e-80   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 268   7e-80   
gb|AAL27096.1|  sucrose synthase                                        267   8e-80   
ref|XP_002516963.1|  sucrose synthase, putative                         266   9e-80   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      267   1e-79   
gb|AFR41907.1|  sucrose synthase                                        248   1e-79   
ref|XP_006650177.1|  PREDICTED: sucrose synthase 1-like isoform X2      267   1e-79   
gb|EMT33394.1|  Sucrose synthase 1                                      267   1e-79   
ref|XP_010088307.1|  Sucrose synthase 2                                 265   1e-79   
ref|XP_008246168.1|  PREDICTED: sucrose synthase 2-like                 252   1e-79   
gb|ADM77474.1|  sucrose synthase-like protein                           249   1e-79   
emb|CAA03935.1|  sucrose synthase type 2                                267   1e-79   
ref|XP_007200961.1|  hypothetical protein PRUPE_ppa002723mg             263   2e-79   
gb|AJA37527.1|  sucrose synthase                                        266   2e-79   
gb|AAV64256.2|  sucrose synthase                                        266   2e-79   
gb|AAL50571.1|AF412038_1  sucrose synthase                              266   3e-79   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 266   3e-79   
ref|NP_001050064.1|  Os03g0340500                                       265   4e-79   
gb|ADM77484.1|  sucrose synthase-like protein                           248   4e-79   
gb|AEN71101.1|  sucrose synthase SusA1                                  265   4e-79   
dbj|BAM05652.1|  sucrose synthase 3                                     265   4e-79   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      265   4e-79   
gb|AEN71088.1|  sucrose synthase SusA1                                  265   4e-79   
gb|AEV40896.1|  sucrose synthase                                        265   4e-79   
gb|AEN71099.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71086.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AFR41916.1|  sucrose synthase                                        246   5e-79   
gb|AEN71085.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71106.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71104.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71084.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71105.1|  sucrose synthase SusA1                                  265   5e-79   
gb|EMS66266.1|  Sucrose synthase 1                                      265   5e-79   
gb|AEN71093.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71103.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71089.1|  sucrose synthase SusA1                                  265   5e-79   
ref|NP_001060278.1|  Os07g0616800                                       265   5e-79   
gb|AEN71094.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71091.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEN71090.1|  sucrose synthase SusA1                                  265   5e-79   
gb|AEZ00745.1|  SusA1                                                   265   5e-79   
ref|XP_006651359.1|  PREDICTED: sucrose synthase 4-like                 265   5e-79   
gb|AEV40893.1|  sucrose synthase                                        265   5e-79   
gb|AEN71092.1|  sucrose synthase SusA1                                  265   6e-79   
gb|KJB24380.1|  hypothetical protein B456_004G142700                    262   6e-79   
gb|AAC41682.1|  sucrose synthase 3                                      265   6e-79   
gb|AEN71083.1|  sucrose synthase SusA1                                  265   6e-79   
gb|KEH24408.1|  sucrose synthase                                        265   6e-79   
gb|AEN71096.1|  sucrose synthase SusA1                                  265   6e-79   
gb|AAL50572.2|AF412039_1  sucrose synthase                              265   6e-79   
gb|EMT06653.1|  Sucrose synthase 1                                      265   6e-79   
dbj|BAK02964.1|  predicted protein                                      265   6e-79   
gb|EAZ04713.1|  hypothetical protein OsI_26874                          265   6e-79   
gb|AEZ00746.1|  SusA1                                                   265   6e-79   
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     265   6e-79   
gb|EPS58089.1|  sucrose synthase                                        257   6e-79   
dbj|BAM05645.1|  sucrose synthase 1                                     265   7e-79   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      265   7e-79   
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 265   7e-79   
gb|AFM52237.1|  putative sucrose synthase 6                             265   8e-79   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    265   8e-79   
dbj|BAJ99820.1|  predicted protein                                      265   9e-79   
emb|CAZ64535.1|  sucrose synthase                                       265   9e-79   
ref|XP_002302727.1|  sucrose synthase family protein                    265   1e-78   
sp|P31922.1|SUS1_HORVU  RecName: Full=Sucrose synthase 1; AltName...    265   1e-78   
ref|XP_004287544.1|  PREDICTED: sucrose synthase-like                   264   1e-78   
ref|NP_001280838.1|  sucrose synthase 3                                 264   1e-78   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      264   1e-78   
gb|AIO11845.1|  sucrose synthase                                        264   2e-78   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   264   2e-78   
ref|NP_001266691.1|  sucrose synthase 1                                 264   2e-78   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       264   2e-78   
ref|XP_002523115.1|  sucrose synthase, putative                         263   2e-78   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      264   2e-78   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg             264   2e-78   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 264   2e-78   
ref|XP_008659019.1|  PREDICTED: sucrose synthase 1 isoform X1           263   2e-78   
gb|KCW58409.1|  hypothetical protein EUGRSUZ_H01094                     260   2e-78   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      263   2e-78   
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        264   2e-78   
gb|AEN71087.1|  sucrose synthase SusA1                                  263   2e-78   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                      263   2e-78   
ref|NP_001105411.1|  sucrose synthase 1                                 263   2e-78   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                      263   2e-78   
gb|AAF85966.1|AF263384_1  sucrose synthase-2                            263   2e-78   
gb|ABY82048.1|  sucrose synthase                                        253   3e-78   
gb|KHN43494.1|  Sucrose synthase 2                                      263   3e-78   
emb|CDX86250.1|  BnaA06g29670D                                          263   3e-78   
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 263   4e-78   
gb|EAZ00002.1|  hypothetical protein OsI_22003                          263   4e-78   
gb|ABL74568.1|  sucrose synthase 2                                      263   4e-78   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like                 263   4e-78   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    263   4e-78   
ref|NP_001057047.1|  Os06g0194900                                       263   4e-78   
gb|AEV40895.1|  sucrose synthase                                        263   4e-78   
ref|XP_006655877.1|  PREDICTED: sucrose synthase 2-like                 263   5e-78   
emb|CAA78747.1|  sucrose synthase                                       263   5e-78   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 263   5e-78   
dbj|BAB20799.1|  sucrose synthase 1                                     263   5e-78   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      263   5e-78   
gb|AEV40894.1|  sucrose synthase                                        263   5e-78   
gb|AGV22111.1|  sucrose synthase 1                                      263   6e-78   
gb|ACM69042.1|  sucrose synthase                                        262   6e-78   
gb|AEX98033.1|  sucrose synthase                                        262   6e-78   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                      262   6e-78   
dbj|BAM05648.1|  sucrose synthase 1                                     262   6e-78   
gb|AFR41922.1|  sucrose synthase                                        243   7e-78   
gb|AAM68126.1|  sucrose synthase                                        262   9e-78   
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                       262   1e-77   
ref|XP_004964611.1|  PREDICTED: sucrose synthase 1-like                 261   1e-77   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 261   1e-77   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg             261   1e-77   
gb|AEA76429.1|  sucrose synthase 1                                      261   1e-77   
gb|AAM95943.1|  sucrose synthase                                        261   1e-77   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                      261   1e-77   
gb|KDO87154.1|  hypothetical protein CISIN_1g003492mg                   261   2e-77   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      261   2e-77   
emb|CDX85398.1|  BnaC07g27090D                                          261   2e-77   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      261   2e-77   
ref|XP_004984440.1|  PREDICTED: sucrose synthase 4-like                 261   3e-77   
emb|CAL25362.2|  sucrose synthase                                       261   3e-77   
gb|AFS17278.1|  sucrose synthase 2                                      260   3e-77   
emb|CAA04543.1|  sucrose synthase type I                                260   4e-77   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 260   4e-77   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                      260   4e-77   
gb|AIO11846.1|  sucrose synthase                                        260   4e-77   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    260   5e-77   
gb|AIL88515.1|  sucrose synthase type 3                                 260   5e-77   
gb|AEX32875.1|  sucrose synthase 2                                      259   7e-77   
emb|CAZ65725.1|  sucrose synthase                                       259   9e-77   
gb|KCW67227.1|  hypothetical protein EUGRSUZ_F01010                     254   1e-76   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like                 259   1e-76   
gb|AFP23359.1|  sucrose synthase                                        259   1e-76   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                    259   1e-76   
ref|XP_004494390.1|  PREDICTED: sucrose synthase 2-like isoform X1      259   2e-76   
gb|AFZ78660.1|  sucrose synthase                                        258   2e-76   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 258   2e-76   
ref|XP_008789904.1|  PREDICTED: sucrose synthase 4                      258   2e-76   
ref|NP_192137.1|  sucrose synthase 3                                    258   2e-76   
ref|XP_011006464.1|  PREDICTED: sucrose synthase 2                      258   2e-76   
ref|XP_009111303.1|  PREDICTED: sucrose synthase 3                      258   2e-76   



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAELL DFFEKCKK+PSHWE IS GGLKRIQEKYTWQIYSDRLLTLA+VY
Sbjct  708  FHIDPYHGDQAAELLADFFEKCKKEPSHWEAISEGGLKRIQEKYTWQIYSDRLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   317 bits (811),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/158 (93%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELL DFFE+CKK+PSHWE IS GGLKRIQEKYTWQIYSDRLLTLA+VY
Sbjct  708  FHIDPYHGEQAAELLADFFERCKKEPSHWEAISEGGLKRIQEKYTWQIYSDRLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEAVPLAVE  805



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   313 bits (803),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+EKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   313 bits (802),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   313 bits (802),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCKK+PSHWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKKEPSHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   312 bits (800),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 152/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCK++PSHWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKREPSHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   311 bits (796),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCKKDPSHWETIS GGLKRI+EKYTWQIYS+ LLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKKDPSHWETISMGGLKRIEEKYTWQIYSESLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   308 bits (790),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   308 bits (788),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 145/158 (92%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATLHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY+GEQ AE+LVDFFEKCK DPSHWETISAGGLKRIQEKYTWQIYSDRLLTLA VY
Sbjct  708  FHIDPYNGEQVAEVLVDFFEKCKHDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDR EIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  768  GFWKYVSKLDRREIRRYLEMFYALKFRKLAEAVPLAVE  805



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   308 bits (788),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 151/158 (96%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCK +PSHWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKTEPSHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYL+MFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLDMFYALKYRKMAEAVPLAAE  805



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   307 bits (787),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQIYSDRLLTLA+VY
Sbjct  708  FQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQIYSDRLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   307 bits (787),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQIYSDRLLTLA+VY
Sbjct  708  FQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQIYSDRLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   307 bits (786),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F IDPYHGEQAA+LL DFFEKCK DPSHWE IS GGLKRIQEKYTWQIYSDRLLTLA+VY
Sbjct  708  FQIDPYHGEQAADLLADFFEKCKVDPSHWEAISEGGLKRIQEKYTWQIYSDRLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALKFRKLA+ VPLA+E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAQLVPLAVE  805



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   307 bits (786),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQEKYTWQIYSDRLLTLA+VY
Sbjct  708  FQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQEKYTWQIYSDRLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   306 bits (785),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 143/158 (91%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAM+CGLPTFATN GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMSCGLPTFATNQGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F IDPYHGEQAA+LL +FFEKCK DPSHWE IS GGLKRIQEKYTWQIYSDRLLTLA+VY
Sbjct  708  FQIDPYHGEQAADLLAEFFEKCKVDPSHWEAISKGGLKRIQEKYTWQIYSDRLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALKFRKLAE VPLA+E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAELVPLAVE  805



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   306 bits (783),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCK +P HWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKTEPYHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   305 bits (780),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 142/158 (90%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI  T+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYIAGTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+LL DFFEKCK  PSHWETIS GGLKRIQEKYTWQIYS+RLLTLA+VY
Sbjct  708  FHIDPYHGEQAADLLADFFEKCKTQPSHWETISTGGLKRIQEKYTWQIYSERLLTLAAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA E
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAEAVPLAAE  805



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   305 bits (780),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  650  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATLHGGPAEIIVHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQ AELLV+FFEKCK DPS W+ ISAGGLKRIQEKYTWQIYS+RLLTLA VY
Sbjct  710  FHIDPYHGEQVAELLVNFFEKCKTDPSQWDAISAGGLKRIQEKYTWQIYSERLLTLAGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            GFWKHVSKLDRLEIRRYLEMFYALK+RKLAE VPLA
Sbjct  770  GFWKHVSKLDRLEIRRYLEMFYALKYRKLAESVPLA  805



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 148/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI D KGAFVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADMKGAFVQPAFYEAFGLTVVEAMTCGLPTFATVHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY+GEQ AE LV+FFEKCKKDPSHWETISAGGLKRI EKYTWQIYSDRLLTLA VY
Sbjct  708  FHIDPYNGEQVAETLVNFFEKCKKDPSHWETISAGGLKRIMEKYTWQIYSDRLLTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAAE  805



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   303 bits (775),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEII+HGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIIHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQEKYTWQIYSDRLLTLA VY
Sbjct  708  FHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQEKYTWQIYSDRLLTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  768  GFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEII+HGKSG
Sbjct  648  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIIHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQ +ELL +FFE+CKK+PS+W+TISAGGLKRIQEKYTWQIYSDRLLTLA VY
Sbjct  708  FHIDPYHGEQVSELLANFFERCKKEPSYWDTISAGGLKRIQEKYTWQIYSDRLLTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  768  GFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 149/158 (94%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEII+HGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIIHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQ +ELL +FFE+CKK+PS+W+TI AGGLKRIQEKYTWQIYSDRLLTLA VY
Sbjct  708  FHIDPYHGEQVSELLANFFERCKKEPSYWDTIPAGGLKRIQEKYTWQIYSDRLLTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VSKLDR EIRRYLEMFYALK+RKLAE VPLA++
Sbjct  768  GFWKCVSKLDRQEIRRYLEMFYALKYRKLAEAVPLAVD  805



>dbj|BAD94975.1| sucrose-UDP glucosyltransferase [Arabidopsis thaliana]
Length=279

 Score =   284 bits (726),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSGF
Sbjct  122  RVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSGF  181

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VYG
Sbjct  182  HIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVYG  241

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            FWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  242  FWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  276



>gb|ADR00484.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=490

 Score =   287 bits (735),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  332  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  391

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  392  FHIDPYHGDRAADLLVDFFDKCKVDPTHWDNISQGGLQRIEEKYTWQIYSQRLLTLTGVY  451

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  452  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  489



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   295 bits (756),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  805



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   295 bits (755),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/158 (88%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  655  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  714

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFF+KCK DP+HWE IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  715  FHIDPYHGEQAAELLVDFFDKCKVDPAHWEKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  774

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPL  E
Sbjct  775  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLTKE  812



>sp|O49845.1|SUS2_DAUCA RecName: Full=Sucrose synthase isoform 2; AltName: Full=Sucrose 
synthase isoform II; AltName: Full=Sucrose-UDP glucosyltransferase 
2; AltName: Full=Susy*Dc2 [Daucus carota]
 emb|CAA76057.1| sucrose synthase isoform II [Daucus carota]
Length=801

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKGAFVQPAFYEAFGLTV+EAMTCGLPTFAT HGGPAEIIVHG SG
Sbjct  644  NRVRNGELYRCIADTKGAFVQPAFYEAFGLTVIEAMTCGLPTFATIHGGPAEIIVHGTSG  703

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGE+AAEL+V+FFE+CK +PSHWETISAGGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  704  FHIDPYHGEKAAELIVNFFERCKTEPSHWETISAGGLKRIQEKYTWQIYSERLLTLGGVY  763

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR+EIRRYLEMF ALK+R LAE VPLA++
Sbjct  764  GFWKHVSKLDRIEIRRYLEMFCALKYRNLAESVPLAVD  801



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (755),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AEQ94149.1| sucrose synthase1 [Elaeis guineensis]
Length=235

 Score =   278 bits (711),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPAFYEAFGLTVVE+MTCGLPTFAT HGGPAEIIVHG SG
Sbjct  69   NRVRNGELYRYICDTKGVFVQPAFYEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGVSG  128

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++AAELLVDFFEKCK+DPSHW  IS GGL+RI+EKYTW++YS+RL+TL+ VY
Sbjct  129  FHIDPYQGDKAAELLVDFFEKCKEDPSHWAKISQGGLQRIEEKYTWKLYSERLMTLSGVY  188

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPL  291
            GFWK+VS LDR E RRYLEMFYALK+R LA+ VPL
Sbjct  189  GFWKYVSNLDRRETRRYLEMFYALKYRNLAKSVPL  223



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   294 bits (753),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>emb|CAA67195.1| sucrose synthase [Pisum sativum]
Length=164

 Score =   275 bits (703),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 132/159 (83%), Positives = 140/159 (88%), Gaps = 1/159 (1%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  5    NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  64

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETIS-AGGLKRIQEKYTWQIYSDRLLTLASV  399
            FHIDPYHGE AA+LLV+FFEK K DPSHW+ IS  GGL+RI+EKYTWQIYS RLLTL  V
Sbjct  65   FHIDPYHGEGAADLLVEFFEKVKSDPSHWDKISLKGGLQRIEEKYTWQIYSQRLLTLTGV  124

Query  398  YGFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            YGFWKHVS LDRLE RRYLEMFYALK+RK AE VPLA+E
Sbjct  125  YGFWKHVSNLDRLESRRYLEMFYALKYRKSAESVPLAVE  163



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   294 bits (752),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   294 bits (752),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHGEQAA+LLVDFFEKCK DPSHW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGEQAAQLLVDFFEKCKVDPSHWDKISQGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   294 bits (752),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS GGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFDKCKKDPSHWNDISEGGLKRIQEKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPA+YEAFGLTVVE+MTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  645  NRVRNGELYRYIADTKGAFVQPAYYEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGKSG  704

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AAELLVDFF+K K DP+HWETIS GGLKRI+EKYTWQIYSDRLLTLA VY
Sbjct  705  FHIDPYHGDKAAELLVDFFKKSKADPTHWETISKGGLKRIEEKYTWQIYSDRLLTLAGVY  764

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  765  GFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQEKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   294 bits (752),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  694  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  753

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  754  FNIDPYHGDQAAEILVDFFEKCKADPSYWNKISEGGLKRIQEKYTWQIYSERLLTLTGVY  813

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  814  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  851



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 140/158 (89%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKGAFVQPAFYEAFGLTVVEAMT GLPTFAT HGGPAEIIV GKSG
Sbjct  648  NRVRNGELYRCIADTKGAFVQPAFYEAFGLTVVEAMTRGLPTFATLHGGPAEIIVDGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY+GEQ AE LV FFEKC KDPSHWE IS GGLKRIQEKYTWQIYSDRLLTLA VY
Sbjct  708  FHIDPYNGEQVAETLVSFFEKCNKDPSHWEAISTGGLKRIQEKYTWQIYSDRLLTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDRLEIRRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKYVSKLDRLEIRRYLEMFYALKYRKLAEAVPLAVE  805



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  643  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  702

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  703  FHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEEKYTWKIYSQRLLTLTGVY  762

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  763  GFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  649  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHGEQAAE+LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGEQAAEILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK++KLA+ VPLA E
Sbjct  769  GFWKHVSNLDRLESRRYIEMFYALKYKKLADSVPLAEE  806



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  643  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  702

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE+LVDFF KCK DPSHW+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  703  FHIDPYHGQQAAEILVDFFGKCKADPSHWDKISQGGLKRIEEKYTWKIYSQRLLTLTGVY  762

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  763  GFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AEV40460.1| sucrose synthase 1 [Gossypium arboreum]
 gb|AFM52232.1| putative sucrose synthase 1 [Gossypium arboreum]
Length=806

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHG00606.1| Sucrose synthase [Gossypium arboreum]
Length=814

 Score =   293 bits (749),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  656  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  715

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  716  FNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWKIYSERLLTLTGVY  775

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  776  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  813



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAAELLVDFFEKCK DP+HW+ IS GGL+RI EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAAELLVDFFEKCKVDPAHWDKISHGGLQRIHEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  708  YHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWKIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   292 bits (748),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  708  YHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWKIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   292 bits (747),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  708  YHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWKIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AAK59464.1| putative sucrose synthase [Arabidopsis thaliana]
Length=532

 Score =   285 bits (730),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  374  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  433

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  434  FHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQIYSQRLLTLTGVY  493

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  494  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  531



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 147/158 (93%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT++GGPAEII+HGKSG
Sbjct  648  NRVRNGELYRCIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATSYGGPAEIIIHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+Q AELLV+F+E+C KDPSHW+ ISAGGL+RI EKYTWQIYS+RL+TLA VY
Sbjct  708  FHIDPYHGDQVAELLVNFYERCSKDPSHWDEISAGGLQRIMEKYTWQIYSERLMTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDRLE RRYLEMFYALK+RKLAE VPLAIE
Sbjct  768  GFWKYVSKLDRLETRRYLEMFYALKYRKLAESVPLAIE  805



>gb|KDO73788.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=783

 Score =   291 bits (746),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  626  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVNGKSG  685

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  686  YHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWKIYSQRLLTLTGVY  745

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  746  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  783



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   292 bits (747),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQEKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  805



>emb|CAB39757.2| sucrose synthase [Lotus japonicus]
Length=233

 Score =   275 bits (703),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/157 (81%), Positives = 141/157 (90%), Gaps = 0/157 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            R+RNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG+
Sbjct  76   RIRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSGY  135

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG++AAE LV+FFEK K DPS+W+ IS GGL+RI EKYTW+IYSDRLLTL  VYG
Sbjct  136  HIDPYHGDRAAETLVEFFEKSKADPSYWDKISQGGLQRIHEKYTWKIYSDRLLTLTGVYG  195

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            FWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  196  FWKHVTNLDRRENKRYLEMFYALKYSKLAESVPLAVE  232



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   291 bits (746),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 137/158 (87%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  675  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  734

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFF+KCKK+PSHW  IS GGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  735  FNIDPYHGDQAAEILVDFFDKCKKEPSHWNDISEGGLKRIQEKYTWQIYSERLLTLTGVY  794

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  795  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAEE  832



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYIC+TKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYICETKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHGEQAAE+LVDFFEKCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  708  YHIDPYHGEQAAEILVDFFEKCKADPSYWDKISLGGLKRIEEKYTWKIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  643  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  702

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  703  FHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEEKYTWKIYSQRLLTLTGVY  762

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  763  GFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGE+AAELLVDFFEKCK DP+HW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEKAAELLVDFFEKCKVDPAHWDKISHGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  643  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  702

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  703  FHIDPYHGQQAAEILVDFFGKCKADPSYWDKISQGGLKRIEEKYTWKIYSQRLLTLTGVY  762

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  763  GFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   290 bits (743),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLVDFFEKCK DP+HWETIS  GL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVDFFEKCKLDPTHWETISKAGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   290 bits (742),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM CGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMGCGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  643  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  702

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE+LVDFF KCK DPS+W+ IS GGLKRI+EKYTW+IYS RLLTL  VY
Sbjct  703  FHIDPYHGQQAAEILVDFFGKCKVDPSYWDKISQGGLKRIEEKYTWKIYSQRLLTLTGVY  762

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA+E
Sbjct  763  GFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVE  800



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 136/158 (86%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM CGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMGCGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGE+AA+LLV+FFEKCK DPSHW+ IS GGLKRI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGERAADLLVEFFEKCKVDPSHWDKISQGGLKRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYR I DT+GAF+QPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRVIADTRGAFIQPAFYEAFGLTVVEAMTCGLPTFATLHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+Q  +LLV FFEK K DPSHWE IS G  +RIQEKYTWQIYSDRLLTLA VY
Sbjct  708  FHIDPYHGDQVTDLLVKFFEKTKVDPSHWEAISKGAEQRIQEKYTWQIYSDRLLTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLEIRRYLEMFYALK+RK+AE VPLA++
Sbjct  768  GFWKHVSKLDRLEIRRYLEMFYALKYRKMAESVPLAVD  805



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   290 bits (741),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   289 bits (740),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   289 bits (740),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  708  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPL  E
Sbjct  768  GFWKHVSNLDRLESRRYMEMFYALKYRKLAESVPLTKE  805



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   289 bits (739),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR+I DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEII+HGKSG
Sbjct  648  NRVRNGELYRFIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATCHGGPAEIIIHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+Q AELLV+F+EKCK DPSHW+ IS GGLKRI EKYTWQIYS+RL+TLA VY
Sbjct  708  FHIDPYHGDQVAELLVNFYEKCKVDPSHWDAISEGGLKRILEKYTWQIYSERLMTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA++
Sbjct  768  GFWKYVSKLDRRETRRYLEMFYALKYRKLAEAVPLAVD  805



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   288 bits (738),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRCICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLV+FFEKCK DPSHW+ IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGDQAAELLVEFFEKCKADPSHWDKISQGAMQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLE RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRLESRRYLEMFYALKYRKLAESVPLTVE  805



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DPS+W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPSYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLVDFFEK K DPSHW  IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGDQAAELLVDFFEKSKADPSHWNNISQGAMQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLVDFF+KCK DP+HW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVDFFDKCKVDPTHWDKISQGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEA GLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEALGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFFEKCK D S+W  IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFEKCKTDSSYWTKISEGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEII HGKSG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIEHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE L DFF KCK+DPSHW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  710  FHIDPYHGDQAAETLADFFTKCKQDPSHWDQISLGGLQRIQEKYTWQIYSQRLLTLTGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  770  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAQE  805



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   287 bits (735),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATCHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++AAELLV FFEKCK+DPSHWE IS GGLKRI EKYTWQIYS+RL+TL+ VY
Sbjct  708  FHIDPYQGDRAAELLVHFFEKCKEDPSHWEKISQGGLKRIHEKYTWQIYSERLMTLSGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKL+R E RRYLEMFYALK+RKLA+ VPLA++
Sbjct  768  GFWKYVSKLERRETRRYLEMFYALKYRKLAQMVPLAVD  805



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGVFVQPAIYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGVFVQPAIYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLV FFEKCK DPSHW  IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGDQAAELLVQFFEKCKADPSHWIKISEGAMQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRIRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFE CKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAADILVDFFEVCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  805



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ACF80843.1| unknown [Zea mays]
Length=185

 Score =   268 bits (686),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHG  G
Sbjct  22   NRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATAYGGPAEIIVHGVPG  81

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPY G++A+ LLVDFF+KC+ DPSHW  IS GGL+RI+EKYTW++YS+RL+TL  VY
Sbjct  82   YHIDPYQGDKASALLVDFFDKCQADPSHWSKISQGGLQRIEEKYTWKLYSERLMTLTGVY  141

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS L+R E RRYLEM YALK+R +A  VPLA+E
Sbjct  142  GFWKYVSNLERRETRRYLEMLYALKYRTMASTVPLAVE  179



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_010493195.1| PREDICTED: sucrose synthase 1 [Camelina sativa]
Length=808

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  710  FHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQIYSQRLLTLTGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  770  GFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICD +GAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDMRGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI+EKYTWQIYS+RLL L +VY
Sbjct  708  FHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKEKYTWQIYSERLLNLTAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_010454391.1| PREDICTED: sucrose synthase 1-like isoform X2 [Camelina sativa]
Length=808

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  710  FHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQIYSQRLLTLTGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  770  GFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_010420928.1| PREDICTED: sucrose synthase 1-like [Camelina sativa]
Length=808

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  710  FHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQIYSQRLLTLTGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  770  GFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  807



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   286 bits (732),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEK+TW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKHTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLAE VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLAESVPLTIE  803



>gb|ADW80596.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (732),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   286 bits (732),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  649  NRVRNGELYRYICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQIYSQRLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+ KLA  VPLA+E
Sbjct  769  GFWKHVSNLDRLESRRYLEMFYALKYSKLAASVPLAVE  806



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   286 bits (732),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 146/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVE+MTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AAELLV+FFEK K+DP++WE IS GGL+RI EKYTWQIYS RL+TLA VY
Sbjct  708  FHIDPYHGDRAAELLVNFFEKSKEDPTYWEKISQGGLQRIHEKYTWQIYSGRLMTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKYVSKLDRRETRRYLEMFYALKYRKLAEMVPLAVE  805



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   286 bits (732),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  652  NRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  711

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLVDFFEKCK DPS+W  IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  712  FNIDPYHGDQAAELLVDFFEKCKVDPSYWNNISHGAMQRIQEKYTWQIYSQRLLTLTGVY  771

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDRLE +RYLEMFYALK+ KLAE VPL +E
Sbjct  772  GFWKHVSKLDRLESKRYLEMFYALKYHKLAESVPLTVE  809



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   286 bits (732),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  710  FHIDPYHGDKAAESLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQIYSQRLLTLTGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  770  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAHE  807



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   286 bits (732),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPA+YEAFGLTVVEAMTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  645  NRVRNGELYRYIADTRGAFVQPAYYEAFGLTVVEAMTCGLPTFATCHGGPAEIIVHGKSG  704

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+EKYTW+IYSDRLLTLA VY
Sbjct  705  FHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEEKYTWKIYSDRLLTLAGVY  764

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  765  GFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   286 bits (732),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPA+YEAFGLTVVEAMTCGLPTFAT HGGPAEIIVHGKSG
Sbjct  645  NRVRNGELYRYIADTRGAFVQPAYYEAFGLTVVEAMTCGLPTFATCHGGPAEIIVHGKSG  704

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLVDFFEK   DPS+WE IS GGL+RI+EKYTW+IYSDRLLTLA VY
Sbjct  705  FHIDPYHGDKAADLLVDFFEKSTADPSYWENISKGGLQRIEEKYTWKIYSDRLLTLAGVY  764

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK++KLAE VPLAIE
Sbjct  765  GFWKYVSNLDRREARRYLEMFYALKYKKLAESVPLAIE  802



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   286 bits (732),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FH+DPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHVDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   286 bits (732),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 145/158 (92%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RN ELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  649  NRIRNVELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAA++LVDFFEKCKKDPSHW+ IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  709  FNIDPYHGDQAADILVDFFEKCKKDPSHWDKISQGGLKRIEEKYTWKIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS L+R E RRYLEMFYALK+RKLAE VPLA E
Sbjct  769  GFWKHVSNLERRESRRYLEMFYALKYRKLAESVPLAEE  806



>emb|CDX70945.1| BnaC03g10290D [Brassica napus]
Length=806

 Score =   286 bits (731),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGEQAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGEQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>ref|XP_010454392.1| PREDICTED: sucrose synthase 1-like isoform X3 [Camelina sativa]
Length=838

 Score =   286 bits (733),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  680  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  739

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  740  FHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQIYSQRLLTLTGVY  799

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  800  GFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  837



>ref|XP_009120766.1| PREDICTED: LOW QUALITY PROTEIN: sucrose synthase 1 [Brassica 
rapa]
Length=805

 Score =   286 bits (731),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>emb|CDX92432.1| BnaA10g14710D [Brassica napus]
Length=805

 Score =   286 bits (731),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDQAADTLADFFTKCKEDPSHWDQISKGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>emb|CDY16569.1| BnaC09g37040D [Brassica napus]
Length=805

 Score =   286 bits (731),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDQAADTLADFFAKCKEDPSHWDQISKGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  805



>gb|AGO61958.1| sucrose synthase, partial [Prunus serrulata]
Length=437

 Score =   276 bits (706),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  279  NRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  338

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+LVDFFEK + DPSHW+ IS GGL+RI EKYT QIYS+RLLTL  VY
Sbjct  339  YHIDPYHGDQAAEILVDFFEKSRADPSHWDKISQGGLQRIFEKYTRQIYSERLLTLTGVY  398

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA E
Sbjct  399  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAEE  436



>gb|ABR25521.1| sucrose synthase metabolism [Oryza sativa Indica Group]
Length=210

 Score =   268 bits (686),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/158 (77%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVE+MTCGLPTFAT +GGPAEIIV+G SG
Sbjct  47   NRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATAYGGPAEIIVNGVSG  106

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++A+ LLV+FFEKC++DPSHW  IS GGL+RI+EKYTW++YS+RL+TL  VY
Sbjct  107  FHIDPYQGDKASALLVEFFEKCQEDPSHWTKISQGGLQRIEEKYTWKLYSERLMTLTGVY  166

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS L+R E RRYLEM YALK+R +A  VPLA+E
Sbjct  167  GFWKYVSNLERRETRRYLEMLYALKYRTMASTVPLAVE  204



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMT GLPTFAT +GGPAEIIVHGKSG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTSGLPTFATCNGGPAEIIVHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE L DFF KCK DPSHW+ IS GGL+RIQEKYTWQIYS+RLLTL  VY
Sbjct  710  FHIDPYHGDQAAETLADFFTKCKHDPSHWDQISLGGLERIQEKYTWQIYSERLLTLTGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  770  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  807



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   285 bits (730),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 134/158 (85%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+ AFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTRVAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+L DFF+KCKKDPSHW  IS GGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILADFFDKCKKDPSHWNDISEGGLKRIQEKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+ KLAE VPLA E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYPKLAESVPLAEE  805



>tpg|DAA45272.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=282

 Score =   271 bits (692),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R RNGELYRYI DT GAFVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEII HG SG
Sbjct  122  NRARNGELYRYIADTHGAFVQPAFYEAFGLTVVEAMTCGLPTFATLHGGPAEIIEHGVSG  181

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYH EQAA L+ DFFE+CK+DP HW  IS  GL+RI EKYTW+IYS+RL+TLA VY
Sbjct  182  FHIDPYHPEQAANLMADFFERCKQDPDHWVKISGAGLQRIYEKYTWKIYSERLMTLAGVY  241

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  242  GFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  279



>ref|XP_010454390.1| PREDICTED: sucrose synthase 1-like isoform X1 [Camelina sativa]
Length=862

 Score =   286 bits (732),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  704  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  763

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  764  FHIDPYHGDQAADTLADFFTKCKEDPSHWDEISQGGLQRIEEKYTWQIYSQRLLTLTGVY  823

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  824  GFWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLAQE  861



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            RVRNGELYRYI DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSGF
Sbjct  649  RVRNGELYRYIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSGF  708

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+EKYTW+IYS+RLLTLA VYG
Sbjct  709  HIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEEKYTWKIYSERLLTLAGVYG  768

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            FWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  769  FWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/157 (84%), Positives = 144/157 (92%), Gaps = 0/157 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            RVRNGELYRYI DTKG FVQPAFYEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSGF
Sbjct  649  RVRNGELYRYIADTKGVFVQPAFYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSGF  708

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG++AAELL +FFEKCK DP+HWE IS  GLKRI+EKYTW+IYS+RLLTLA VYG
Sbjct  709  HIDPYHGDKAAELLANFFEKCKADPTHWEKISKAGLKRIEEKYTWKIYSERLLTLAGVYG  768

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            FWK+VS LDR E RRYLEMFYALK+RKLA+ VPLA+E
Sbjct  769  FWKYVSNLDRRETRRYLEMFYALKYRKLAQSVPLAVE  805



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICD +GAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDMRGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE L +FFEKCK DPSHW+ IS G ++RI++KYTWQIYS+RLL L +VY
Sbjct  708  FHIDPYHGDQAAETLANFFEKCKVDPSHWDKISQGAMQRIKDKYTWQIYSERLLNLTAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWRIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKH S LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHASNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFW+HVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWEHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|NP_197583.1| sucrose synthase 1 [Arabidopsis thaliana]
 ref|NP_001031915.1| sucrose synthase 1 [Arabidopsis thaliana]
 sp|P49040.3|SUSY1_ARATH RecName: Full=Sucrose synthase 1; Short=AtSUS1; AltName: Full=Sucrose-UDP 
glucosyltransferase 1 [Arabidopsis thaliana]
 dbj|BAH19538.1| AT5G20830 [Arabidopsis thaliana]
 gb|AED92894.1| sucrose synthase 1 [Arabidopsis thaliana]
 gb|AED92895.1| sucrose synthase 1 [Arabidopsis thaliana]
Length=808

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSGF
Sbjct  651  RVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSGF  710

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VYG
Sbjct  711  HIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVYG  770

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            FWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  771  FWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+  PL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSAPLTIE  803



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLV FF KCK DPSHW  IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGDQAAELLVQFFVKCKADPSHWTKISEGAMQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>emb|CDX88838.1| BnaA03g08110D [Brassica napus]
Length=743

 Score =   283 bits (725),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  585  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  644

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  645  FHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVY  704

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  705  GFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  742



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE+L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  709  FHIDPYHGDQAAEILADFFAKCKEDPSHWDEISHGGLQRIEEKYTWQIYSQRLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  769  GFWKHVSNLDRLESRRYLEMFYALKYRPLAQAVPLAQE  806



>ref|XP_009131818.1| PREDICTED: sucrose synthase 1 [Brassica rapa]
Length=806

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRPLAKAVPLAEE  805



>pdb|3S28|A Chain A, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|B Chain B, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|C Chain C, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|D Chain D, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|E Chain E, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|F Chain F, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|G Chain G, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S28|H Chain H, The Crystal Structure Of Sucrose Synthase-1 In Complex 
With A Breakdown Product Of The Udp-Glucose
 pdb|3S29|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S29|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSGF
Sbjct  651  RVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSGF  710

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VYG
Sbjct  711  HIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVYG  770

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            FWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  771  FWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   286 bits (731),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEIIV G SG
Sbjct  709  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATLHGGPAEIIVDGISG  768

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY+GE  AE+L+ FFEKC KDPSHWE IS GGLKRI+EKYTWQIYS+RLL LA VY
Sbjct  769  FHIDPYNGESVAEILIGFFEKCTKDPSHWEAISTGGLKRIREKYTWQIYSERLLNLAGVY  828

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDRLEI+RYLEM YALK RKLAE VPLA+E
Sbjct  829  GFWKYVSKLDRLEIKRYLEMLYALKLRKLAEAVPLAVE  866



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLE+FYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEVFYALKYRKLADSVPLTIE  803



>ref|XP_003609947.1| Sucrose synthase [Medicago truncatula]
Length=531

 Score =   278 bits (711),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  374  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  433

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW IYS RLLTL  VY
Sbjct  434  FHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWTIYSQRLLTLTGVY  493

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  494  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  531



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   285 bits (728),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVISDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   285 bits (728),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVISDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEKCK +PSHW+TIS  GL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKCKVEPSHWDTISQAGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   284 bits (727),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGL VVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLPVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_007138617.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 ref|XP_007138618.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10611.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
 gb|ESW10612.1| hypothetical protein PHAVU_009G223800g [Phaseolus vulgaris]
Length=806

 Score =   284 bits (727),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV GKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATFNGGPAEIIVDGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG++AAE+LVDFFEK K DPSHW+ IS GGLKRIQEKYTWQIYSDRLLTL  VY
Sbjct  708  YHIDPYHGDRAAEILVDFFEKSKADPSHWDKISQGGLKRIQEKYTWQIYSDRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  768  GFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLVDFFEKCK DP+HW+ IS  GL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVDFFEKCKLDPTHWDKISKAGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAAE  805



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   284 bits (726),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKG FVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRCICDTKGVFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLV+FFEKCK DP HW+ IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGDQAAELLVEFFEKCKADPPHWDKISQGAMQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   284 bits (726),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKY W+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYAWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   283 bits (725),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAF LTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFELTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   284 bits (727),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSGF
Sbjct  693  RVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSGF  752

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VYG
Sbjct  753  HIDPYHGDQAADTLADFFTKCKEDPSHWDEISLGGLQRIEEKYTWQIYSQRLLTLTGVYG  812

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            FWKHVS LDRLE RRYLEMFYALK+R LA+ VPLA
Sbjct  813  FWKHVSNLDRLEARRYLEMFYALKYRPLAQAVPLA  847



>gb|ADW80583.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHI PYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIVPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>ref|XP_008783129.1| PREDICTED: sucrose synthase 1-like isoform X1 [Phoenix dactylifera]
Length=817

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVE+MTCGLPTFAT HGGPAEIIVHG SG
Sbjct  649  NRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGVSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++AAELLVDFFEKCK+DPSHW  IS GGL+RI+EKYTW++YS+RL+TL+ VY
Sbjct  709  FHIDPYQGDKAAELLVDFFEKCKEDPSHWNKISQGGLQRIKEKYTWKLYSERLMTLSGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK+R LA+ VPL I+
Sbjct  769  GFWKYVSNLDRRESRRYLEMFYALKYRNLAKSVPLHID  806



>ref|XP_006400648.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
 gb|ESQ42101.1| hypothetical protein EUTSA_v10012719mg [Eutrema salsugineum]
Length=806

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDQAADTLADFFAKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD LE RRYLEMFYALK+R LA+ VPLA E
Sbjct  768  GFWKHVSNLDHLESRRYLEMFYALKYRPLAQAVPLAQE  805



>ref|XP_008783137.1| PREDICTED: sucrose synthase 1-like isoform X2 [Phoenix dactylifera]
Length=816

 Score =   283 bits (724),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVE+MTCGLPTFAT HGGPAEIIVHG SG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGVSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++AAELLVDFFEKCK+DPSHW  IS GGL+RI+EKYTW++YS+RL+TL+ VY
Sbjct  708  FHIDPYQGDKAAELLVDFFEKCKEDPSHWNKISQGGLQRIKEKYTWKLYSERLMTLSGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK+R LA+ VPL I+
Sbjct  768  GFWKYVSNLDRRESRRYLEMFYALKYRNLAKSVPLHID  805



>gb|AAA34305.1| sucrose synthase type 2, partial [Triticum aestivum]
Length=235

 Score =   267 bits (682),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/158 (76%), Positives = 139/158 (88%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICD KGAFVQPAFYEAFGLTV+EAMTCGLPTFAT +GGPAEIIVHG SG
Sbjct  72   NRVRNGELYRYICDMKGAFVQPAFYEAFGLTVIEAMTCGLPTFATAYGGPAEIIVHGVSG  131

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPY  ++A+ LLVDFF KC++DPSHW  IS GGL+RI+EKYTW++YS+RL+TL+ VY
Sbjct  132  YHIDPYQNDKASALLVDFFGKCQEDPSHWNKISQGGLQRIEEKYTWKLYSERLMTLSGVY  191

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
             FWK+VS LDR E RRYLEM YALK+RK+A  VPLA+E
Sbjct  192  RFWKYVSNLDRRETRRYLEMLYALKYRKMAATVPLAVE  229



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   283 bits (723),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCKGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCKGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQIYSDRLLTL  VY
Sbjct  708  YHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQIYSDRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  768  GFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCKGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPY G+QAAE+LVDFFEK K DPSHWE IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYQGDQAAEILVDFFEKSKADPSHWEKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLENRRYLEMFYALKFRKLAASVPLAVE  806



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG++AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQIYSDRLLTL  VY
Sbjct  708  YHIDPYHGDRAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQIYSDRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  768  GFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFF+KCKKDPSHW  IS GGLKRIQEKYTWQIYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFDKCKKDPSHWNDISEGGLKRIQEKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAE  303
            GFWKHVS LDR E RRYLEMFYALK+RKL +
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLVD  798



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQIYSDRLLTL  VY
Sbjct  708  YHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQIYSDRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  768  GFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   282 bits (721),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCKGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+ VDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEIJVDFFEKNKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLESRRYLEMFYALKFRKLAASVPLAVE  806



>gb|ACP17902.1| sucrose synthase [Phaseolus vulgaris]
Length=806

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV GKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATFNGGPAEIIVDGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG++AAE+LVDFFEK K DPSHWE IS GGLKRIQEKYTWQ+YSDRLLTL  VY
Sbjct  708  YHIDPYHGDRAAEILVDFFEKSKADPSHWEKISQGGLKRIQEKYTWQVYSDRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHV+ L+R E +R LEMFYALK+RKLAE VPLAIE
Sbjct  768  GFWKHVTNLERRESKRSLEMFYALKYRKLAESVPLAIE  805



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_002874016.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50275.1| hypothetical protein ARALYDRAFT_910122 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAA  L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  710  FHIDPYHGDQAANTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            GFWKHVS LD LE RRYLEMFYALK+R LA+ VPLA
Sbjct  770  GFWKHVSNLDHLEARRYLEMFYALKYRPLAQAVPLA  805



>gb|AFW88069.1| sucrose synthase1 [Zea mays]
Length=385

 Score =   271 bits (693),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHG SG
Sbjct  222  NRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATAYGGPAEIIVHGVSG  281

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPY G++A+ LLVDFF+KC+ DPSHW  IS GGL+RI+EKYTW++YS+RL+TL  VY
Sbjct  282  YHIDPYQGDKASALLVDFFDKCQADPSHWSKISQGGLQRIEEKYTWKLYSERLMTLTGVY  341

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS L+R E RRYLEM YALK+R +A  VPLA+E
Sbjct  342  GFWKYVSNLERRETRRYLEMLYALKYRTMASTVPLAVE  379



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+ AAE+LV+FFEK K DPSHW+ IS GGLKRI EKYTWQIYSDRLLTL  VY
Sbjct  708  YHIDPYHGDHAAEILVEFFEKSKADPSHWDKISQGGLKRIHEKYTWQIYSDRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHV+ L+R E +RYLEMFYALK+RKLAE VPLAIE
Sbjct  768  GFWKHVTNLERRESKRYLEMFYALKYRKLAESVPLAIE  805



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKTDPSHWDKISQGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCMGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALK+RKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLESRRYLEMFYALKYRKLAASVPLAVE  806



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   282 bits (721),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMT GLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTRGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG QAAELLVDFFEKCK DP++W+ IS GGL+RIQEKYTW+IYS RLLTL  VY
Sbjct  706  FHIDPYHGVQAAELLVDFFEKCKADPTYWDKISQGGLQRIQEKYTWKIYSQRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LD  E RRYLEMFYALK+RKLA+ VPL IE
Sbjct  766  GFWKHVSNLDHRESRRYLEMFYALKYRKLADSVPLTIE  803



>tpg|DAA45273.1| TPA: putative sucrose synthase family protein [Zea mays]
Length=383

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R RNGELYRYI DT GAFVQPAFYEAFGLTVVEAMTCGLPTFAT HGGPAEII HG SG
Sbjct  223  NRARNGELYRYIADTHGAFVQPAFYEAFGLTVVEAMTCGLPTFATLHGGPAEIIEHGVSG  282

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYH EQAA L+ DFFE+CK+DP HW  IS  GL+RI EKYTW+IYS+RL+TLA VY
Sbjct  283  FHIDPYHPEQAANLMADFFERCKQDPDHWVKISGAGLQRIYEKYTWKIYSERLMTLAGVY  342

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKL+RLE RRYLEMFY LKFR+LA+ VPLAI+
Sbjct  343  GFWKYVSKLERLETRRYLEMFYILKFRELAKTVPLAID  380



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   281 bits (720),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 142/158 (90%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKADPSHWDKISLGGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CDO97805.1| unnamed protein product [Coffea canephora]
Length=731

 Score =   280 bits (715),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT+GAFVQPAFYEAFGLTVVEAMTCGLPTFAT +GGPAEIIV+GKSG
Sbjct  575  NRVRNGELYRYIADTRGAFVQPAFYEAFGLTVVEAMTCGLPTFATINGGPAEIIVNGKSG  634

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY GEQ AE+LVDFFE+CK+D S+WETIS+GGLKRIQEKYTWQIYSDR+LTLA VY
Sbjct  635  FHIDPYKGEQVAEVLVDFFERCKEDASYWETISSGGLKRIQEKYTWQIYSDRILTLAGVY  694

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            GFWK VS+ DRL+++RYLEMFY L +RKLAE VP+A
Sbjct  695  GFWKEVSRPDRLKMQRYLEMFYLLNYRKLAESVPVA  730



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   281 bits (719),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCKGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPY G+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYQGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLENRRYLEMFYALKFRKLAASVPLAVE  806



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   281 bits (718),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/158 (84%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  647  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  706

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHGE+AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW IYS RLLTL  VY
Sbjct  707  FHIDPYHGERAADLLVEFFEKVKADPSHWDKISQGGLQRIEEKYTWTIYSQRLLTLTGVY  766

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  767  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  804



>ref|XP_010107074.1| Sucrose synthase [Morus notabilis]
 gb|EXC13595.1| Sucrose synthase [Morus notabilis]
Length=806

 Score =   281 bits (718),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG++AAELLVDFFEK K DPS W+ IS  GL+RI +KYTWQIYS+RLLTL  VY
Sbjct  708  YHIDPYHGDRAAELLVDFFEKSKADPSLWDKISQAGLQRIYDKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRY+EMFYALK+RKLAE VPLA++
Sbjct  768  GFWKHVSNLDRLESRRYIEMFYALKYRKLAESVPLAVD  805



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score =   281 bits (718),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+G SG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCKGGPAEIIVNGISG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLECRRYLEMFYALKFRKLAASVPLAVE  806



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+G SG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCKGGPAEIIVNGISG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDRLE RRYLEMFYALKFRKLA  VPLA+E
Sbjct  769  GFWKDVSNLDRLECRRYLEMFYALKFRKLAASVPLAVE  806



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   280 bits (717),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 138/158 (87%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR+ICDTKG FVQPA YEAFGL VVEAMTCGLPTFAT +GGPAEIIVHGK G
Sbjct  648  NRVRNGELYRFICDTKGVFVQPALYEAFGLAVVEAMTCGLPTFATCNGGPAEIIVHGKPG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG QAAELLVDFFEK K DPSHW  IS G ++RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGGQAAELLVDFFEKSKADPSHWNNISRGAMQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK+RKLAE VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYRKLAESVPLTVE  805



>gb|KEH37657.1| sucrose synthase [Medicago truncatula]
Length=804

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             R+RNGELYR ICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  646  NRIRNGELYRVICDTKGAFVQPAIYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  705

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE LV+FFEK K DPS+W+ IS GGLKRI EKYTWQIYSDRLLTL  VY
Sbjct  706  YHIDPYHGDQAAETLVEFFEKSKADPSYWDKISHGGLKRIHEKYTWQIYSDRLLTLTGVY  765

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHV+ LDR E +RYLEMFYALK+ KLAE VPLA+E
Sbjct  766  GFWKHVTNLDRRESKRYLEMFYALKYSKLAESVPLAVE  803



>sp|Q41608.1|SUS1_TULGE RecName: Full=Sucrose synthase 1; AltName: Full=Sucrose-UDP glucosyltransferase 
1 [Tulipa gesneriana]
 emb|CAA65639.1| sucrose-synthase 1 [Tulipa gesneriana]
Length=805

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 128/158 (81%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTVVE+MTCGLPTFAT HGGPAEIIVHG SG
Sbjct  647  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGVSG  706

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++A+E LV FFEKCK+DP+HWE IS GGL+RI EKYTW++YS+RL+TLA VY
Sbjct  707  FHIDPYHGDKASEQLVSFFEKCKEDPAHWEKISQGGLQRIYEKYTWKLYSERLMTLAGVY  766

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK+R LA+ VPLAI+
Sbjct  767  GFWKYVSNLDRRETRRYLEMFYALKYRNLAKSVPLAID  804



>dbj|BAM05649.1| sucrose synthase 3 [Eucalyptus globulus subsp. globulus]
Length=806

 Score =   280 bits (715),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/157 (82%), Positives = 138/157 (88%), Gaps = 0/157 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+QAAE L DFFEKCK DPSHW+ IS G ++RI+EKYTWQIYS+RLL L +VY
Sbjct  708  FHIDPYHGDQAAETLADFFEKCKVDPSHWDKISQGAMQRIKEKYTWQIYSERLLNLTAVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAI  285
            GFWKHVS LDRLE RRYLEMFYALK+RKL  D  L I
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLVRDSQLFI  804



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   279 bits (714),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW IYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKADPSHWDKISQGGLQRIEEKYTWTIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQAGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_009343357.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=807

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTV+EAMTCGLPTFAT  GGPAEIIV+GKSG
Sbjct  649  NRVRNGELYRYICDTRGAFVQPAVYEAFGLTVIEAMTCGLPTFATCMGGPAEIIVNGKSG  708

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAAE+LVDFFEK K DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  709  YHIDPYHGDQAAEILVDFFEKSKADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  768

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK VS LDR E RRYLEMFYALK+RKLA  VPLA+E
Sbjct  769  GFWKDVSTLDRRESRRYLEMFYALKYRKLAASVPLAVE  806



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS  GL+RI+EKYTWQIYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISEAGLQRIEEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDR E RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRRESRRYLEMFYALKYRKLAESVPLAVE  805



>ref|XP_010937277.1| PREDICTED: sucrose synthase 2-like [Elaeis guineensis]
Length=816

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKG FVQPAFYEAFGLTVVE+MTCGLPTFAT HGGPAEIIVHG SG
Sbjct  650  NRVRNGELYRYICDTKGVFVQPAFYEAFGLTVVESMTCGLPTFATCHGGPAEIIVHGVSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++AAELLVDFFEKCK+DPSHW  IS GGL+RI+EKYTW++YS+RL+TL+ VY
Sbjct  710  FHIDPYQGDKAAELLVDFFEKCKEDPSHWAKISQGGLQRIEEKYTWKLYSERLMTLSGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPL  291
            GFWK+VS LDR E RRYLEMFYALK+R LA+ VPL
Sbjct  770  GFWKYVSNLDRRETRRYLEMFYALKYRNLAKSVPL  804



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW IYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWTIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   279 bits (714),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKGAFVQPA YEAFGLTVVEAM  GLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVICDTKGAFVQPAVYEAFGLTVVEAMATGLPTFATLNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG++AA+LLV+FFEK K DPSHW+ IS GGL+RI+EKYTW IYS RLLTL  VY
Sbjct  708  FHIDPYHGDRAADLLVEFFEKVKVDPSHWDKISQGGLQRIEEKYTWTIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VPLA+E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPLAVE  805



>pdb|3S27|A Chain A, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S27|B Chain B, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S27|C Chain C, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S27|D Chain D, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S27|E Chain E, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S27|F Chain F, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S27|G Chain G, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
 pdb|3S27|H Chain H, The Crystal Structure Of Sucrose Synthase-1 From Arabidopsis 
Thaliana And Its Functional Implications.
Length=816

 Score =   279 bits (714),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  752  RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSGF  573
            RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEA TCGLPTFAT  GGPAEIIVHGKSGF
Sbjct  651  RVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAXTCGLPTFATCKGGPAEIIVHGKSGF  710

Query  572  HIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVYG  393
            HIDPYHG+QAA+ L DFF KCK+DPSHW+ IS GGL+RI+EKYTWQIYS RLLTL  VYG
Sbjct  711  HIDPYHGDQAADTLADFFTKCKEDPSHWDEISKGGLQRIEEKYTWQIYSQRLLTLTGVYG  770

Query  392  FWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLA  288
            FWKHVS LDRLE RRYLE FYALK+R LA+ VPLA
Sbjct  771  FWKHVSNLDRLEARRYLEXFYALKYRPLAQAVPLA  805



>gb|KJB82967.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=815

 Score =   279 bits (714),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/154 (84%), Positives = 140/154 (91%), Gaps = 0/154 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRYICDTKGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAE+LVDFFEKCK DPS+W  IS GGLKRI+EKYTW+IYS+RLLTL  VY
Sbjct  708  FNIDPYHGDQAAEILVDFFEKCKTDPSYWTKISEGGLKRIEEKYTWKIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVP  294
            GFWKHVS LDRLE RRYLEMFYALK+RKL   +P
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLVILMP  801



>emb|CAA57881.1| sucrose synthase [Oxybasis rubra]
Length=803

 Score =   279 bits (713),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/158 (82%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPA+YEAFGLTVVEAMTCGLPTFAT HGGPAEIIV+GKSG
Sbjct  645  NRVRNGELYRYIADTKGAFVQPAYYEAFGLTVVEAMTCGLPTFATCHGGPAEIIVNGKSG  704

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG++AAELLV+FFEK   +PSHWE IS GGLKRI+EKYTW+IYSDRLLTLA VY
Sbjct  705  YHIDPYHGDKAAELLVEFFEKSTANPSHWEAISNGGLKRIEEKYTWKIYSDRLLTLAGVY  764

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK++K AE VPL +E
Sbjct  765  GFWKYVSNLDRREARRYLEMFYALKYKKPAESVPLLVE  802



>ref|XP_008797380.1| PREDICTED: sucrose synthase 1-like isoform X2 [Phoenix dactylifera]
Length=814

 Score =   279 bits (713),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DT GAFVQPAFYEAFGLTV+EAMTCGLPTFAT++GGPAEIIVHG SG
Sbjct  648  NRVRNGELYRYIADTGGAFVQPAFYEAFGLTVIEAMTCGLPTFATSNGGPAEIIVHGVSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++AAELLV FFEKC++DP+HW  IS GGLKRI+EKYTW++YS+RL+TLA VY
Sbjct  708  FHIDPYQGDKAAELLVSFFEKCREDPNHWNKISQGGLKRIEEKYTWKLYSERLMTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKLDR E RRYLEMFYALK+R LA  VPLA++
Sbjct  768  GFWKYVSKLDRRETRRYLEMFYALKYRNLATSVPLAVD  805



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  708  YHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 131/158 (83%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR I DTKGAFVQPA YEAFGLTVVEAMTCGLPTFAT  GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRVIADTKGAFVQPAVYEAFGLTVVEAMTCGLPTFATCKGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPYHG+QAA++LVDFFEK + DPSHW+ IS GGL+RI EKYTWQIYS+RLLTL  VY
Sbjct  708  YHIDPYHGDQAADILVDFFEKSRADPSHWDKISQGGLQRIYEKYTWQIYSERLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVS LDRLE RRYLEMFYALK+RKLAE VP A E
Sbjct  768  GFWKHVSNLDRLESRRYLEMFYALKYRKLAESVPRAEE  805



>ref|XP_010917399.1| PREDICTED: sucrose synthase 1-like [Elaeis guineensis]
 ref|XP_010917400.1| PREDICTED: sucrose synthase 1-like [Elaeis guineensis]
 ref|XP_010917401.1| PREDICTED: sucrose synthase 1-like [Elaeis guineensis]
Length=814

 Score =   278 bits (712),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 143/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYI DTKGAFVQPAFYEAFGLTV+EAMTCGLPTFAT +GGPAEIIVHG SG
Sbjct  648  NRVRNGELYRYIADTKGAFVQPAFYEAFGLTVIEAMTCGLPTFATANGGPAEIIVHGVSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++AAELLV FFEKC++DP+HW  IS GGLKRI+EKYTW++YS+RL+TLA VY
Sbjct  708  FHIDPYQGDKAAELLVSFFEKCREDPTHWNKISLGGLKRIEEKYTWKLYSERLMTLAGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VSKL+R E RRYLEMFYALK+R LA  VPLA++
Sbjct  768  GFWKYVSKLERRETRRYLEMFYALKYRNLARSVPLAVD  805



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   278 bits (711),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKG FVQPA YEAFGLTVVE+M+CGLPTFAT +GGPAEIIVHGKSG
Sbjct  648  NRVRNGELYRCICDTKGVFVQPALYEAFGLTVVESMSCGLPTFATCNGGPAEIIVHGKSG  707

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  708  FNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQEKYTWQIYSQRLLTLTGVY  767

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  768  GFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  805



>gb|ADE77562.1| unknown [Picea sitchensis]
Length=257

 Score =   263 bits (672),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDT+GAFVQPA YEAFGLTVVEAMTCGLPTFAT +GGPAEIIV G SG
Sbjct  88   NRVRNGELYRYICDTRGAFVQPALYEAFGLTVVEAMTCGLPTFATCNGGPAEIIVDGVSG  147

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPYHG+ A+E + DFFE+CK DP +W+ IS  GL+RI E+YTW+IYS+RL+ LA VY
Sbjct  148  FHIDPYHGDYASECIADFFERCKTDPGYWDKISNAGLQRIYERYTWKIYSERLMMLAGVY  207

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE*MKAG  267
            GFWK+VSKLDR E RRYLEMFY LK+R L + VPLA+E +  G
Sbjct  208  GFWKYVSKLDRRETRRYLEMFYTLKYRDLVKTVPLAVEEITDG  250



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   277 bits (709),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 141/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYR ICDTKG FVQPA YEAFGLTVVE+M+CGLPTFAT +GGPAEIIVHGKSG
Sbjct  616  NRVRNGELYRCICDTKGVFVQPALYEAFGLTVVESMSCGLPTFATCNGGPAEIIVHGKSG  675

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            F+IDPYHG+QAAELLV+FFEKCK DP  W+ IS GGL+RIQEKYTWQIYS RLLTL  VY
Sbjct  676  FNIDPYHGDQAAELLVEFFEKCKADPCVWDEISKGGLQRIQEKYTWQIYSQRLLTLTGVY  735

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWKHVSKLDR E RRYLEMFYALK++KLA+ VPL +E
Sbjct  736  GFWKHVSKLDRRESRRYLEMFYALKYKKLADSVPLTVE  773



>ref|XP_008783098.1| PREDICTED: sucrose synthase 1 [Phoenix dactylifera]
Length=816

 Score =   278 bits (711),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 125/158 (79%), Positives = 144/158 (91%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVE+MTCGLPTFAT +GGPAEIIVHG SG
Sbjct  650  NRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVESMTCGLPTFATCYGGPAEIIVHGVSG  709

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            FHIDPY G++A+ELLVDFFEKCK+DP+HW  IS GGL+RI+EKYTW++YS+RL+TL+ VY
Sbjct  710  FHIDPYQGDKASELLVDFFEKCKEDPNHWNKISLGGLQRIEEKYTWKLYSERLMTLSGVY  769

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS LDR E RRYLEMFYALK+R LA+ VPL ++
Sbjct  770  GFWKYVSNLDRRETRRYLEMFYALKYRNLAKSVPLHVD  807



>gb|ACN36258.1| unknown [Zea mays]
Length=499

 Score =   270 bits (691),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/158 (77%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  755  TRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATNHGGPAEIIVHGKSG  576
             RVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFAT +GGPAEIIVHG SG
Sbjct  336  NRVRNGELYRYICDTKGAFVQPAFYEAFGLTVVEAMTCGLPTFATAYGGPAEIIVHGVSG  395

Query  575  FHIDPYHGEQAAELLVDFFEKCKKDPSHWETISAGGLKRIQEKYTWQIYSDRLLTLASVY  396
            +HIDPY G++A+ LLVDFF+KC+ DPSHW  IS GGL+RI+EKYTW++YS+RL+TL  VY
Sbjct  396  YHIDPYQGDKASALLVDFFDKCQADPSHWSKISQGGLQRIEEKYTWKLYSERLMTLTGVY  455

Query  395  GFWKHVSKLDRLEIRRYLEMFYALKFRKLAEDVPLAIE  282
            GFWK+VS L+R E RRYLEM YALK+R +A  VPLA+E
Sbjct  456  GFWKYVSNLERRETRRYLEMLYALKYRTMASTVPLAVE  493



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680