BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037P11

Length=654
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010690550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    147   6e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009789910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    144   6e-37   Nicotiana sylvestris
gb|KDP44958.1|  hypothetical protein JCGZ_01458                         144   1e-36   Jatropha curcas
gb|AHL24662.1|  Fra e 10.01 allergen                                    135   2e-36   Fraxinus excelsior
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    143   2e-36   Nicotiana tomentosiformis
sp|Q84V39.1|ALL10_OLEEU  RecName: Full=Major pollen allergen Ole ...    135   2e-36   Olea europaea
ref|XP_011029669.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    141   1e-35   Populus euphratica
ref|XP_010690542.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    141   1e-35   
gb|EYU33213.1|  hypothetical protein MIMGU_mgv1a006294mg                140   1e-35   Erythranthe guttata [common monkey flower]
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    140   2e-35   Sesamum indicum [beniseed]
emb|CAN83700.1|  hypothetical protein VITISV_027546                     138   2e-35   Vitis vinifera
emb|CBI31680.3|  unnamed protein product                                139   3e-35   Vitis vinifera
ref|NP_001275174.1|  glucan endo-1,3-beta-glucosidase-like precursor    140   4e-35   Solanum tuberosum [potatoes]
gb|AHL24654.1|  Fra e 9.01 allergen                                     139   5e-35   Fraxinus excelsior
ref|XP_010256938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    139   6e-35   Nelumbo nucifera [Indian lotus]
gb|EYU19897.1|  hypothetical protein MIMGU_mgv1a006105mg                139   7e-35   Erythranthe guttata [common monkey flower]
gb|AHL24655.1|  Fra e 9.02 allergen                                     139   7e-35   Fraxinus excelsior
ref|XP_009610601.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        139   7e-35   Nicotiana tomentosiformis
ref|XP_002283647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        139   8e-35   Vitis vinifera
gb|ABK95730.1|  unknown                                                 138   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_002312097.1|  hypothetical protein POPTR_0008s05600g             138   1e-34   Populus trichocarpa [western balsam poplar]
ref|XP_009791207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    138   2e-34   Nicotiana sylvestris
ref|NP_001234416.1|  beta-glucosidase 08 precursor                      137   2e-34   Solanum lycopersicum
ref|XP_010264453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        137   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    135   1e-33   Ricinus communis
gb|AAX95269.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    133   6e-33   Oryza sativa Japonica Group [Japonica rice]
emb|CDP00093.1|  unnamed protein product                                133   8e-33   Coffea canephora [robusta coffee]
ref|XP_011101632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    132   1e-32   
ref|NP_001068545.2|  Os11g0704600                                       133   1e-32   
gb|EEC68648.1|  hypothetical protein OsI_37085                          133   1e-32   Oryza sativa Indica Group [Indian rice]
ref|XP_011029787.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    132   1e-32   Populus euphratica
ref|XP_007016411.1|  O-Glycosyl hydrolases family 17 protein isof...    132   1e-32   
ref|XP_009364443.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    131   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_002530862.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    131   4e-32   
ref|XP_006345964.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    131   6e-32   Solanum tuberosum [potatoes]
gb|EEE52578.1|  hypothetical protein OsJ_34867                          133   7e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008377338.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    130   8e-32   Malus domestica [apple tree]
ref|XP_002312098.1|  glucan endo-1 family protein                       130   1e-31   Populus trichocarpa [western balsam poplar]
gb|KHF99783.1|  Glucan endo-1,3-beta-glucosidase                        129   2e-31   Gossypium arboreum [tree cotton]
ref|XP_010034118.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        129   2e-31   Eucalyptus grandis [rose gum]
ref|XP_002282736.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    128   5e-31   Vitis vinifera
gb|AFK47562.1|  unknown                                                 122   6e-31   Lotus japonicus
pdb|2JON|A  Chain A, Solution Structure Of The C-Terminal Domain ...    120   7e-31   Olea europaea
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006488330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   1e-30   Citrus sinensis [apfelsine]
sp|Q94G86.1|ALL9_OLEEU  RecName: Full=Glucan endo-1,3-beta-D-gluc...    127   2e-30   Olea europaea
ref|XP_010922329.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    126   2e-30   Elaeis guineensis
ref|XP_008457927.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    126   2e-30   Cucumis melo [Oriental melon]
ref|XP_006424832.1|  hypothetical protein CICLE_v10028241mg             126   2e-30   Citrus clementina [clementine]
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg                126   2e-30   Erythranthe guttata [common monkey flower]
ref|XP_004239793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        126   2e-30   Solanum lycopersicum
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    126   3e-30   Populus euphratica
gb|KDO49091.1|  hypothetical protein CISIN_1g0122621mg                  122   3e-30   Citrus sinensis [apfelsine]
ref|XP_007017515.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    124   3e-30   
gb|KDP38494.1|  hypothetical protein JCGZ_04419                         125   4e-30   Jatropha curcas
ref|XP_010263687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    125   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      125   5e-30   Nelumbo nucifera [Indian lotus]
ref|XP_007017514.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    125   5e-30   
ref|XP_007017516.1|  Glucan endo-1,3-beta-glucosidase 7-beta-gluc...    125   5e-30   
ref|XP_010664681.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    125   5e-30   Vitis vinifera
ref|XP_004173544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   5e-30   
ref|XP_004299094.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      125   8e-30   Fragaria vesca subsp. vesca
gb|KHN33758.1|  Glucan endo-1,3-beta-glucosidase 7                      124   8e-30   Glycine soja [wild soybean]
gb|KJB83778.1|  hypothetical protein B456_013G263800                    125   8e-30   Gossypium raimondii
emb|CDP21469.1|  unnamed protein product                                124   9e-30   Coffea canephora [robusta coffee]
ref|XP_007220315.1|  hypothetical protein PRUPE_ppa005160m2g            119   9e-30   
ref|XP_004151673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    124   9e-30   
ref|XP_003522947.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    124   9e-30   Glycine max [soybeans]
ref|XP_009365605.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    124   1e-29   Pyrus x bretschneideri [bai li]
ref|XP_006663687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    124   1e-29   
gb|KHG11479.1|  hypothetical protein F383_06303                         124   1e-29   Gossypium arboreum [tree cotton]
ref|XP_003552703.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        124   1e-29   Glycine max [soybeans]
ref|XP_011083694.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      124   1e-29   Sesamum indicum [beniseed]
gb|KEH40123.1|  glucan endo-1,3-beta-glucosidase-like protein           124   2e-29   Medicago truncatula
ref|XP_004500813.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    124   2e-29   Cicer arietinum [garbanzo]
ref|XP_002509479.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    123   2e-29   Ricinus communis
gb|KCW67838.1|  hypothetical protein EUGRSUZ_F01563                     122   2e-29   Eucalyptus grandis [rose gum]
ref|XP_004148850.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   3e-29   Cucumis sativus [cucumbers]
gb|KJB32498.1|  hypothetical protein B456_005G243100                    122   3e-29   Gossypium raimondii
ref|XP_006423251.1|  hypothetical protein CICLE_v10028372mg             123   3e-29   Citrus clementina [clementine]
ref|XP_010060942.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    123   4e-29   Eucalyptus grandis [rose gum]
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             123   4e-29   Prunus persica
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      122   4e-29   Phoenix dactylifera
gb|KJB32496.1|  hypothetical protein B456_005G243100                    122   4e-29   Gossypium raimondii
ref|XP_007042210.1|  O-Glycosyl hydrolases family 17 protein isof...    122   4e-29   
emb|CDP07525.1|  unnamed protein product                                122   4e-29   Coffea canephora [robusta coffee]
ref|XP_004499144.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   5e-29   Cicer arietinum [garbanzo]
ref|XP_008220789.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      122   5e-29   Prunus mume [ume]
ref|XP_007222662.1|  hypothetical protein PRUPE_ppa004976mg             122   5e-29   
dbj|BAD94999.1|  beta-1,3-glucanase - like protein                      117   5e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510373.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    122   7e-29   Ricinus communis
emb|CDP05033.1|  unnamed protein product                                122   8e-29   Coffea canephora [robusta coffee]
gb|KJB34916.1|  hypothetical protein B456_006G090600                    122   8e-29   Gossypium raimondii
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    122   9e-29   Populus euphratica
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g             122   9e-29   Populus trichocarpa [western balsam poplar]
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      122   9e-29   Elaeis guineensis
ref|XP_008802734.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        121   1e-28   Phoenix dactylifera
emb|CAN61862.1|  hypothetical protein VITISV_043447                     122   1e-28   Vitis vinifera
gb|AFS50098.1|  glucan endo-1,3-beta-glucosidase                        121   1e-28   Elaeis guineensis
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   1e-28   Malus domestica [apple tree]
ref|XP_011088385.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    122   1e-28   Sesamum indicum [beniseed]
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      121   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_009357727.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    121   1e-28   
ref|XP_008371690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    121   1e-28   Malus domestica [apple tree]
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        122   1e-28   
ref|XP_008236880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      121   1e-28   Prunus mume [ume]
ref|XP_003631648.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      121   1e-28   Vitis vinifera
ref|XP_010096392.1|  Glucan endo-1,3-beta-glucosidase 7                 121   2e-28   Morus notabilis
ref|XP_002878033.1|  hypothetical protein ARALYDRAFT_485970             120   2e-28   
ref|XP_004169494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   2e-28   
ref|XP_004499143.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    121   2e-28   
gb|ACM45718.1|  endo-1,3-beta-glucanase                                 120   2e-28   Pyrus x bretschneideri x Pyrus pyrifolia
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   2e-28   Cucumis sativus [cucumbers]
ref|XP_008466580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      120   2e-28   Cucumis melo [Oriental melon]
gb|KEH40124.1|  glucan endo-1,3-beta-glucosidase-like protein           120   2e-28   Medicago truncatula
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g             120   3e-28   
ref|XP_008233624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    120   3e-28   Prunus mume [ume]
gb|KDP46246.1|  hypothetical protein JCGZ_10086                         120   3e-28   Jatropha curcas
ref|XP_010412786.1|  PREDICTED: major pollen allergen Ole e 10-like     114   3e-28   
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   3e-28   Pyrus x bretschneideri [bai li]
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    120   3e-28   Ricinus communis
ref|XP_009804916.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    120   3e-28   Nicotiana sylvestris
ref|XP_008377425.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    120   3e-28   
ref|XP_007013797.1|  O-Glycosyl hydrolases family 17 protein, put...    120   4e-28   
ref|XP_009406752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    120   4e-28   
gb|KJB53907.1|  hypothetical protein B456_009G010800                    119   5e-28   Gossypium raimondii
ref|XP_010107844.1|  Glucan endo-1,3-beta-glucosidase 7                 120   5e-28   
ref|XP_010065396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-28   Eucalyptus grandis [rose gum]
ref|XP_004516968.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   6e-28   Cicer arietinum [garbanzo]
gb|KHN20071.1|  Glucan endo-1,3-beta-glucosidase 7                      119   6e-28   Glycine soja [wild soybean]
ref|XP_010447074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-28   Camelina sativa [gold-of-pleasure]
ref|XP_006581120.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-28   
gb|KJB32499.1|  hypothetical protein B456_005G243100                    119   6e-28   Gossypium raimondii
ref|XP_010432409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   6e-28   Camelina sativa [gold-of-pleasure]
gb|KDO72847.1|  hypothetical protein CISIN_1g0375832mg                  119   6e-28   Citrus sinensis [apfelsine]
gb|AES74164.2|  glucan endo-1,3-beta-glucosidase-like protein           118   7e-28   Medicago truncatula
ref|XP_006581121.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   7e-28   
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...    119   8e-28   
ref|XP_009343476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        119   9e-28   Pyrus x bretschneideri [bai li]
ref|XP_007136171.1|  hypothetical protein PHAVU_009G024000g             119   9e-28   Phaseolus vulgaris [French bean]
ref|XP_003603912.1|  Glucan endo-1,3-beta-glucosidase                   119   9e-28   Medicago truncatula
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   9e-28   Populus euphratica
ref|XP_008461659.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        119   9e-28   Cucumis melo [Oriental melon]
gb|AIR93908.1|  glucanase                                               119   1e-27   Cicer arietinum [garbanzo]
ref|XP_008362701.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    119   1e-27   Malus domestica [apple tree]
gb|KJB73919.1|  hypothetical protein B456_011G260900                    112   1e-27   Gossypium raimondii
ref|XP_003603913.1|  Glucan endo-1,3-beta-glucosidase                   119   1e-27   
ref|XP_010043555.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   1e-27   Eucalyptus grandis [rose gum]
ref|XP_011015294.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   1e-27   Populus euphratica
gb|AAX95357.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....    119   1e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008681422.1|  PREDICTED: uncharacterized protein LOC100273...    118   1e-27   
ref|XP_004293211.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      119   1e-27   Fragaria vesca subsp. vesca
ref|NP_001141090.1|  uncharacterized protein LOC100273173               117   1e-27   
gb|KHG05533.1|  Glucan endo-1,3-beta-glucosidase                        118   2e-27   Gossypium arboreum [tree cotton]
ref|XP_010499944.1|  PREDICTED: major pollen allergen Ole e 10-like     112   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_009796709.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    117   2e-27   Nicotiana sylvestris
ref|XP_010060941.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    118   2e-27   Eucalyptus grandis [rose gum]
ref|XP_007160762.1|  hypothetical protein PHAVU_001G014900g             118   2e-27   Phaseolus vulgaris [French bean]
ref|XP_006412222.1|  hypothetical protein EUTSA_v10024968mg             118   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_010427314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    117   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   2e-27   Populus euphratica
gb|KDO84535.1|  hypothetical protein CISIN_1g040787mg                   117   2e-27   Citrus sinensis [apfelsine]
ref|XP_006434974.1|  hypothetical protein CICLE_v10003630mg             117   3e-27   
gb|KHN13912.1|  Glucan endo-1,3-beta-glucosidase                        116   3e-27   Glycine soja [wild soybean]
gb|ABK24319.1|  unknown                                                 117   3e-27   Picea sitchensis
gb|AAK76666.1|  putative beta-1,3-glucanase                             117   4e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004167482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    117   4e-27   
ref|XP_009605959.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    117   4e-27   Nicotiana tomentosiformis
ref|XP_009112198.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      117   4e-27   Brassica rapa
ref|XP_010690894.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    117   4e-27   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001118954.1|  carbohydrate-binding X8 domain-containing pr...    110   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|KHN20986.1|  Glucan endo-1,3-beta-glucosidase 7                      115   5e-27   Glycine soja [wild soybean]
ref|XP_006379239.1|  hypothetical protein POPTR_0009s11830g             117   5e-27   Populus trichocarpa [western balsam poplar]
ref|XP_003544417.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   5e-27   Glycine max [soybeans]
gb|ABK28115.1|  unknown                                                 110   5e-27   Arabidopsis thaliana [mouse-ear cress]
gb|ABK25242.1|  unknown                                                 117   5e-27   Picea sitchensis
ref|XP_004230886.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      117   5e-27   Solanum lycopersicum
ref|XP_010091148.1|  Glucan endo-1,3-beta-glucosidase                   114   6e-27   
ref|XP_010534498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        116   6e-27   Tarenaya hassleriana [spider flower]
ref|XP_010461223.1|  PREDICTED: major pollen allergen Ole e 10-like     110   6e-27   Camelina sativa [gold-of-pleasure]
ref|NP_191103.1|  O-Glycosyl hydrolases family 17 protein               116   6e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAM66982.1|  beta-1,3-glucanase-like protein                         116   7e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003622030.1|  Glucan endo-1,3-beta-glucosidase                   116   7e-27   Medicago truncatula
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    116   7e-27   Phoenix dactylifera
ref|XP_004295910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    117   8e-27   Fragaria vesca subsp. vesca
emb|CDX75437.1|  BnaA01g02650D                                          116   8e-27   
ref|XP_010444969.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    116   8e-27   
ref|XP_004982218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    116   1e-26   Setaria italica
ref|XP_010444207.1|  PREDICTED: major pollen allergen Ole e 10-like     110   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010106478.1|  Glucan endo-1,3-beta-glucosidase                   116   1e-26   
ref|XP_010496153.1|  PREDICTED: major pollen allergen Ole e 10-like     110   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        115   1e-26   Nelumbo nucifera [Indian lotus]
gb|KEH40125.1|  glucan endo-1,3-beta-glucosidase-like protein           115   1e-26   Medicago truncatula
ref|XP_008223598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    116   1e-26   Prunus mume [ume]
gb|KFK27709.1|  hypothetical protein AALP_AA8G419000                    115   1e-26   Arabis alpina [alpine rockcress]
ref|NP_001078361.1|  carbohydrate-binding X8 domain-containing pr...    109   1e-26   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69064.1|  BnaC01g03890D                                          116   1e-26   
ref|XP_007205054.1|  hypothetical protein PRUPE_ppa004320mg             116   1e-26   Prunus persica
ref|XP_003629685.1|  Glucan endo-1 3-beta-glucosidase                   109   1e-26   Medicago truncatula
ref|XP_007131842.1|  hypothetical protein PHAVU_011G045800g             115   2e-26   Phaseolus vulgaris [French bean]
gb|KHN25369.1|  Glucan endo-1,3-beta-glucosidase 7                      114   2e-26   Glycine soja [wild soybean]
ref|XP_006856026.1|  hypothetical protein AMTR_s00059p00061500          115   2e-26   Amborella trichopoda
ref|NP_001118955.1|  carbohydrate-binding X8 domain-containing pr...    109   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010500533.1|  PREDICTED: major pollen allergen Ole e 10-like     109   2e-26   Camelina sativa [gold-of-pleasure]
gb|ABK28052.1|  unknown                                                 109   2e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478822.1|  PREDICTED: major pollen allergen Ole e 10-like     109   2e-26   Camelina sativa [gold-of-pleasure]
ref|NP_001148381.1|  glucan endo-1,3-beta-glucosidase 7 precursor       115   2e-26   Zea mays [maize]
gb|ACN26761.1|  unknown                                                 114   2e-26   Zea mays [maize]
ref|XP_009407686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    115   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      115   2e-26   Tarenaya hassleriana [spider flower]
emb|CDX87130.1|  BnaC09g04450D                                          115   2e-26   
ref|XP_002466692.1|  hypothetical protein SORBIDRAFT_01g012380          115   3e-26   
ref|XP_006283912.1|  hypothetical protein CARUB_v10005030mg             114   3e-26   
ref|XP_004145947.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    115   3e-26   
ref|XP_006291113.1|  hypothetical protein CARUB_v10017225mg             114   3e-26   Capsella rubella
ref|XP_006391444.1|  hypothetical protein EUTSA_v10019456mg             108   4e-26   Eutrema salsugineum [saltwater cress]
gb|KCW85570.1|  hypothetical protein EUGRSUZ_B02367                     114   4e-26   Eucalyptus grandis [rose gum]
ref|XP_002872445.1|  hypothetical protein ARALYDRAFT_489799             108   4e-26   
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        114   4e-26   Vitis vinifera
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   5e-26   Elaeis guineensis
ref|XP_002451320.1|  hypothetical protein SORBIDRAFT_05g027690          114   5e-26   Sorghum bicolor [broomcorn]
emb|CDX76097.1|  BnaA04g03610D                                          114   5e-26   
ref|XP_004980076.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   6e-26   Setaria italica
emb|CDY04078.1|  BnaC02g37930D                                          108   6e-26   
ref|XP_010516112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_009345986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   6e-26   Pyrus x bretschneideri [bai li]
ref|XP_009353665.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   6e-26   Pyrus x bretschneideri [bai li]
ref|XP_009345982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   6e-26   Pyrus x bretschneideri [bai li]
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    113   6e-26   
ref|XP_010479430.1|  PREDICTED: major pollen allergen Ole e 10-like     108   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010504397.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   6e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002298356.1|  glycosyl hydrolase family 17 family protein        114   6e-26   
ref|XP_009129295.1|  PREDICTED: major pollen allergen Ole e 10-like     108   6e-26   
ref|XP_007139210.1|  hypothetical protein PHAVU_008G010600g             113   6e-26   Phaseolus vulgaris [French bean]
ref|XP_010421258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    113   6e-26   Camelina sativa [gold-of-pleasure]
ref|NP_001275210.1|  glucan endo-1,3-beta-D-glucosidase-like prec...    114   7e-26   Solanum tuberosum [potatoes]
ref|XP_006846179.1|  hypothetical protein AMTR_s00012p00207210          114   7e-26   Amborella trichopoda
ref|XP_009357726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        114   7e-26   
ref|XP_006409465.1|  hypothetical protein EUTSA_v10022641mg             114   7e-26   
ref|XP_010519110.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase      113   8e-26   Tarenaya hassleriana [spider flower]
dbj|BAJ87172.1|  predicted protein                                      113   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAP44659.1|  putative beta 1,3-glucanase                             113   9e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010459987.1|  PREDICTED: major pollen allergen Ole e 10-like     107   9e-26   Camelina sativa [gold-of-pleasure]
emb|CDY45313.1|  BnaA03g52860D                                          115   9e-26   Brassica napus [oilseed rape]
gb|EAY91326.1|  hypothetical protein OsI_12942                          113   1e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_010479435.1|  PREDICTED: major pollen allergen Ole e 10-like     107   1e-25   Camelina sativa [gold-of-pleasure]
emb|CDY02936.1|  BnaC04g25500D                                          113   1e-25   
dbj|BAF02203.1|  hypothetical protein                                   110   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009138297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   1e-25   Brassica rapa
ref|XP_002874188.1|  hydrolase, hydrolyzing O-glycosyl compounds        112   1e-25   
ref|XP_006491986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    113   1e-25   Citrus sinensis [apfelsine]
emb|CDY19838.1|  BnaA09g04910D                                          113   1e-25   Brassica napus [oilseed rape]
ref|XP_009111627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        113   1e-25   Brassica rapa
ref|XP_003606895.1|  Glucan endo-1,3-beta-glucosidase                   113   1e-25   Medicago truncatula
ref|XP_009138298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    113   1e-25   Brassica rapa
gb|KHG04672.1|  hypothetical protein F383_30229                         113   1e-25   Gossypium arboreum [tree cotton]
ref|XP_010048931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        112   1e-25   Eucalyptus grandis [rose gum]
ref|XP_010455339.1|  PREDICTED: major pollen allergen Ole e 10-like     107   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_010484048.1|  PREDICTED: major pollen allergen Ole e 10-like     107   1e-25   Camelina sativa [gold-of-pleasure]
gb|KGN49838.1|  hypothetical protein Csa_5G139170                       113   1e-25   Cucumis sativus [cucumbers]
ref|XP_006441150.1|  hypothetical protein CICLE_v10020075mg             112   1e-25   Citrus clementina [clementine]
gb|KDP34495.1|  hypothetical protein JCGZ_11045                         113   2e-25   Jatropha curcas
ref|XP_006403459.1|  hypothetical protein EUTSA_v10010363mg             112   2e-25   Eutrema salsugineum [saltwater cress]
ref|XP_006281313.1|  hypothetical protein CARUB_v10027366mg             107   2e-25   Capsella rubella
ref|XP_004505325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    112   2e-25   Cicer arietinum [garbanzo]
ref|XP_004505326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    112   2e-25   
ref|XP_009139167.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    112   2e-25   Brassica rapa
ref|XP_003561438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    112   2e-25   Brachypodium distachyon [annual false brome]
ref|XP_007042209.1|  O-Glycosyl hydrolases family 17 protein isof...    112   2e-25   
gb|EMS56219.1|  Glucan endo-1,3-beta-glucosidase                        112   2e-25   Triticum urartu
emb|CDY40218.1|  BnaA09g35000D                                          112   2e-25   Brassica napus [oilseed rape]
gb|KFK34786.1|  hypothetical protein AALP_AA5G193500                    111   3e-25   Arabis alpina [alpine rockcress]
ref|XP_006653891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    111   3e-25   
gb|KFK30062.1|  hypothetical protein AALP_AA7G211800                    112   3e-25   Arabis alpina [alpine rockcress]
ref|XP_009116237.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    111   3e-25   Brassica rapa
sp|P52409.1|E13B_WHEAT  RecName: Full=Glucan endo-1,3-beta-glucos...    111   4e-25   Triticum aestivum [Canadian hard winter wheat]
gb|KHG22731.1|  Glucan endo-1,3-beta-glucosidase                        111   4e-25   Gossypium arboreum [tree cotton]
ref|XP_004309121.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        112   5e-25   Fragaria vesca subsp. vesca
ref|XP_008667523.1|  PREDICTED: uncharacterized protein LOC100273...    111   5e-25   Zea mays [maize]
ref|NP_195174.6|  glucan endo-1,3-beta-glucosidase 7                    111   5e-25   
ref|NP_001141385.1|  uncharacterized protein LOC100273476 precursor     111   5e-25   
gb|ACF79258.1|  unknown                                                 111   5e-25   
ref|XP_009392256.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        111   5e-25   
ref|NP_001241760.1|  glucan endo-1,3-beta-glucosidase precursor         111   6e-25   
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            111   6e-25   
emb|CDY41234.1|  BnaC08g26240D                                          110   6e-25   
ref|XP_008382813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    111   6e-25   
emb|CDY62387.1|  BnaCnng40170D                                          110   7e-25   
gb|KJB58293.1|  hypothetical protein B456_009G202900                    110   9e-25   
ref|XP_007039107.1|  O-Glycosyl hydrolases family 17 protein            110   1e-24   
ref|NP_001118956.1|  carbohydrate-binding X8 domain-containing pr...    104   1e-24   
ref|XP_004241225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    110   1e-24   
emb|CDX72483.1|  BnaC07g45050D                                          112   1e-24   
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        110   1e-24   
ref|XP_004507424.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    110   1e-24   
ref|XP_008375942.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    110   1e-24   
ref|XP_008681421.1|  PREDICTED: uncharacterized protein LOC100273...    109   2e-24   
gb|EPS59066.1|  hypothetical protein M569_15744                         109   2e-24   
ref|XP_006394296.1|  hypothetical protein EUTSA_v10005544mg             104   2e-24   
ref|XP_004147695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    109   2e-24   
ref|XP_009103956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    109   2e-24   
emb|CDY53692.1|  BnaA07g37860D                                          109   2e-24   
ref|NP_192648.2|  carbohydrate-binding X8 domain-containing protein     103   2e-24   
ref|XP_009123249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      109   3e-24   
ref|XP_010489192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   3e-24   
emb|CAB85903.1|  beta-1,3 glucanase                                     108   3e-24   
gb|KFK33989.1|  hypothetical protein AALP_AA5G087500                    108   3e-24   
ref|XP_006827757.1|  hypothetical protein AMTR_s00009p00263650          108   4e-24   
ref|XP_006350772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    108   4e-24   
gb|KJB73922.1|  hypothetical protein B456_011G261200                    103   4e-24   
gb|KJB58294.1|  hypothetical protein B456_009G202900                    108   4e-24   
ref|XP_010489191.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   4e-24   
gb|ADM75497.1|  glycosyl hydrolase-like protein                         104   4e-24   
ref|XP_007220925.1|  hypothetical protein PRUPE_ppa023079mg             108   4e-24   
ref|NP_001174147.1|  Os04g0681950                                       104   4e-24   
gb|ADM75470.1|  glycosyl hydrolase-like protein                         104   5e-24   
ref|XP_006299612.1|  hypothetical protein CARUB_v10015799mg             108   5e-24   
gb|ADM75467.1|  glycosyl hydrolase-like protein                         104   5e-24   
gb|KJB73921.1|  hypothetical protein B456_011G261100                    103   5e-24   
ref|XP_006420924.1|  hypothetical protein CICLE_v10005883mg             104   6e-24   
ref|NP_179219.4|  O-glycosyl hydrolases family 17 protein               108   6e-24   
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      108   7e-24   
ref|XP_004982217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   7e-24   
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    108   8e-24   
ref|XP_008234701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        107   9e-24   
ref|XP_006493056.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    104   1e-23   
emb|CDY26761.1|  BnaC09g08880D                                          108   1e-23   
ref|XP_006287713.1|  hypothetical protein CARUB_v10000922mg             107   1e-23   
ref|XP_008780692.1|  PREDICTED: major pollen allergen Ole e 10-like     102   1e-23   
gb|KJB37375.1|  hypothetical protein B456_006G202300                    108   1e-23   
ref|XP_011470609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    109   1e-23   
ref|XP_006420925.1|  hypothetical protein CICLE_v10005883mg             104   1e-23   
ref|XP_010423738.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   1e-23   
ref|XP_011041899.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...    103   1e-23   
gb|EMT12982.1|  Glucan endo-1,3-beta-glucosidase                        105   1e-23   
ref|NP_001151529.1|  LOC100285163 precursor                             107   2e-23   
tpg|DAA35302.1|  TPA: putative O-glycosyl hydrolase family 17 pro...    107   2e-23   
gb|EMT27870.1|  Glucan endo-1,3-beta-glucosidase 7                      106   2e-23   
gb|EMS60868.1|  Glucan endo-1,3-beta-glucosidase 7                      106   2e-23   
ref|XP_010484050.1|  PREDICTED: major pollen allergen Ole e 10-like     101   2e-23   
ref|NP_001242796.1|  uncharacterized protein LOC100779749 precursor     103   3e-23   
ref|XP_008437641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        107   3e-23   
ref|XP_006289630.1|  hypothetical protein CARUB_v10003182mg             100   3e-23   
gb|ABK24695.1|  unknown                                                 106   4e-23   
ref|XP_003629683.1|  Glucan endo-1 3-beta-glucosidase                   101   4e-23   
gb|EPS63364.1|  glycoside hydrolase                                     105   4e-23   
ref|XP_004504426.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    100   4e-23   
gb|KJB49751.1|  hypothetical protein B456_008G135800                    100   4e-23   
gb|KDO69312.1|  hypothetical protein CISIN_1g0384522mg                  105   5e-23   
ref|XP_008376760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        105   5e-23   
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             105   6e-23   
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    105   6e-23   
gb|KHG07607.1|  Glucan endo-1,3-beta-glucosidase                        100   6e-23   
ref|XP_002323780.2|  hypothetical protein POPTR_0017s08280g             100   7e-23   
ref|XP_004504427.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    100   7e-23   
ref|XP_003629680.1|  Glucan endo-1,3-beta-glucosidase-like protein      102   7e-23   
ref|XP_006394688.1|  hypothetical protein EUTSA_v10004182mg             105   8e-23   
ref|XP_002518089.1|  hydrolase, hydrolyzing O-glycosyl compounds,...  99.8    8e-23   
ref|XP_006281398.1|  hypothetical protein CARUB_v10027463mg           98.6    9e-23   
ref|XP_003607845.1|  Glucan endo-1,3-beta-glucosidase                   105   9e-23   
gb|KDP35193.1|  hypothetical protein JCGZ_09352                         105   1e-22   
gb|AFK49325.1|  unknown                                                 100   1e-22   
ref|XP_002448791.1|  hypothetical protein SORBIDRAFT_06g033250          104   1e-22   
emb|CAJ86292.1|  H0124B04.9                                             107   1e-22   
gb|AES90042.2|  O-glycosyl hydrolase family 17 protein                  105   1e-22   
ref|XP_004960035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    104   1e-22   
ref|XP_010444208.1|  PREDICTED: major pollen allergen Ole e 10-like   99.8    1e-22   
ref|XP_011460166.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  99.4    1e-22   
emb|CDY17781.1|  BnaC08g21890D                                        99.4    1e-22   
gb|AIR93913.1|  glucanase                                               104   2e-22   
gb|ADE76367.1|  unknown                                                 104   2e-22   
gb|KJB49750.1|  hypothetical protein B456_008G135800                  99.4    2e-22   
ref|XP_010510460.1|  PREDICTED: major pollen allergen Ole e 10-like   99.0    2e-22   
ref|XP_006444594.1|  hypothetical protein CICLE_v10022784mg           99.4    2e-22   
ref|XP_006289259.1|  hypothetical protein CARUB_v10002725mg           98.6    2e-22   
ref|XP_010109237.1|  Glucan endo-1,3-beta-glucosidase                   103   2e-22   
ref|XP_006848467.1|  hypothetical protein AMTR_s00013p00250830          100   2e-22   
ref|XP_004504345.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    100   2e-22   
gb|EEE61922.1|  hypothetical protein OsJ_16662                          105   2e-22   
gb|EEC78268.1|  hypothetical protein OsI_17962                          105   3e-22   
ref|XP_010685761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    103   3e-22   
ref|XP_010473970.1|  PREDICTED: major pollen allergen Ole e 10-like   98.2    3e-22   
emb|CDY72458.1|  BnaCnng77720D                                        97.8    4e-22   
ref|XP_002888551.1|  glycosyl hydrolase family protein 17             97.8    4e-22   
ref|XP_010923610.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  99.8    4e-22   
ref|XP_010505644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    104   5e-22   
ref|XP_008785981.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  99.8    5e-22   
ref|XP_010435755.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  97.1    5e-22   
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    102   5e-22   
ref|XP_011462312.1|  PREDICTED: major pollen allergen Ole e 10-like   98.2    5e-22   
ref|XP_009150384.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  97.4    6e-22   
ref|XP_002866544.1|  hypothetical protein ARALYDRAFT_919614           97.8    6e-22   
ref|XP_002862245.1|  hypothetical protein ARALYDRAFT_333412           97.8    6e-22   
ref|XP_006295997.1|  hypothetical protein CARUB_v10025141mg             103   6e-22   
ref|XP_010435766.1|  PREDICTED: major pollen allergen Ole e 10-like   97.4    7e-22   
ref|NP_201128.2|  glycosyl hydrolase family protein 17                97.1    7e-22   
ref|XP_010412950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    103   8e-22   
ref|XP_008224513.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  99.8    8e-22   
gb|AAD22313.1|  putative beta-1,3-glucanase                             102   8e-22   
ref|NP_001119271.1|  O-Glycosyl hydrolases family 17 protein            102   8e-22   
ref|XP_010923607.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  99.0    9e-22   
ref|XP_003531231.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  99.0    9e-22   
ref|XP_004506563.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  97.8    9e-22   
ref|XP_010484049.1|  PREDICTED: major pollen allergen Ole e 10-like   96.7    1e-21   
emb|CDY26741.1|  BnaA06g12810D                                        98.6    1e-21   
ref|XP_010459998.1|  PREDICTED: major pollen allergen Ole e 10-like   96.7    1e-21   
dbj|BAJ87944.1|  predicted protein                                    98.2    1e-21   
ref|XP_010460010.1|  PREDICTED: major pollen allergen Ole e 10-like   96.7    1e-21   
ref|XP_011091443.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  99.0    1e-21   
ref|XP_007156494.1|  hypothetical protein PHAVU_003G290700g           98.6    1e-21   
gb|ACG38222.1|  GPI-anchored protein                                    100   1e-21   
ref|XP_010444206.1|  PREDICTED: major pollen allergen Ole e 10-like   96.3    1e-21   
ref|NP_001142053.1|  uncharacterized protein LOC100274209 precursor     100   1e-21   
gb|AFW83361.1|  hypothetical protein ZEAMMB73_163198                    100   1e-21   
ref|XP_002893006.1|  hypothetical protein ARALYDRAFT_889285           98.2    2e-21   
ref|NP_176859.1|  carbohydrate-binding X8 domain-containing protein   96.3    2e-21   
ref|XP_002888554.1|  glycosyl hydrolase family protein 17             96.3    2e-21   
ref|XP_004500462.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  97.1    2e-21   
emb|CDY41510.1|  BnaA06g22630D                                        96.3    2e-21   
gb|EYU32671.1|  hypothetical protein MIMGU_mgv1a018824mg              96.3    2e-21   
emb|CAB78033.1|  beta-1, 3-glucanase-like protein                     95.1    2e-21   
ref|XP_009791979.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  95.9    2e-21   
ref|XP_002456008.1|  hypothetical protein SORBIDRAFT_03g028790          100   2e-21   
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    101   2e-21   
ref|XP_007227133.1|  hypothetical protein PRUPE_ppa026075mg           98.2    2e-21   
ref|XP_002862247.1|  hypothetical protein ARALYDRAFT_921012           95.9    2e-21   
emb|CDY52833.1|  BnaAnng11800D                                        95.9    2e-21   
gb|KDP39363.1|  hypothetical protein JCGZ_01120                       97.8    2e-21   
ref|XP_010650340.1|  PREDICTED: major pollen allergen Ole e 10 is...  97.4    3e-21   
gb|KHG23265.1|  hypothetical protein F383_08704                       97.8    3e-21   
ref|XP_004969247.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  99.8    3e-21   
gb|KJB69317.1|  hypothetical protein B456_011G041500                  95.9    3e-21   
ref|XP_006411190.1|  hypothetical protein EUTSA_v10017897mg             101   3e-21   
gb|EEC79758.1|  hypothetical protein OsI_21142                        99.0    3e-21   
ref|XP_006394538.1|  hypothetical protein EUTSA_v10004907mg           97.8    3e-21   
gb|EEE64827.1|  hypothetical protein OsJ_19684                        99.8    3e-21   
ref|XP_006295440.1|  hypothetical protein CARUB_v10024539mg           95.5    3e-21   
ref|XP_006293434.1|  hypothetical protein CARUB_v10025630mg           95.5    3e-21   
ref|XP_002886212.1|  glycosyl hydrolase family 17 protein               100   3e-21   
gb|KJB28181.1|  hypothetical protein B456_005G032500                  97.1    4e-21   
gb|KHG03086.1|  hypothetical protein F383_28364                       97.4    4e-21   
ref|XP_010546204.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  97.4    4e-21   
emb|CDY54368.1|  BnaC03g74560D                                        95.1    4e-21   
ref|XP_007156489.1|  hypothetical protein PHAVU_003G290300g           95.1    5e-21   
ref|XP_010690895.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    100   5e-21   
ref|XP_002881067.1|  hypothetical protein ARALYDRAFT_901946           95.1    5e-21   
emb|CDY53600.1|  BnaA05g34730D                                          100   5e-21   
ref|XP_002300169.2|  hypothetical protein POPTR_0001s32290g           94.7    5e-21   
gb|KJB28182.1|  hypothetical protein B456_005G032500                  97.1    5e-21   
ref|XP_006414881.1|  hypothetical protein EUTSA_v10026599mg           95.1    5e-21   
ref|XP_010511589.1|  PREDICTED: major pollen allergen Ole e 10-like   94.7    5e-21   
ref|XP_010247078.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  97.1    6e-21   
ref|XP_002267551.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  97.4    6e-21   
ref|XP_009374584.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  97.1    6e-21   
ref|XP_010069024.1|  PREDICTED: major pollen allergen Ole e 10        97.1    6e-21   
emb|CDX87201.1|  BnaC09g05160D                                        96.7    7e-21   
ref|XP_011045647.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  96.7    7e-21   
emb|CDY16822.1|  BnaA09g05600D                                        96.7    7e-21   
ref|XP_002866543.1|  glycosyl hydrolase family protein 17             95.1    7e-21   
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  99.8    7e-21   
ref|XP_004504425.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  95.1    7e-21   
gb|KHG03210.1|  hypothetical protein F383_26843                       97.1    8e-21   
ref|XP_009115714.1|  PREDICTED: major pollen allergen Ole e 10-like   94.4    9e-21   
ref|XP_010268562.1|  PREDICTED: major pollen allergen Ole e 10-like   94.4    9e-21   
emb|CDY20461.1|  BnaC04g05830D                                        99.4    9e-21   
gb|KHG24844.1|  Glucan endo-1,3-beta-glucosidase                      94.4    9e-21   
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g           99.4    9e-21   
ref|XP_003524190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  95.1    1e-20   
ref|NP_001078788.1|  glycosyl hydrolase family protein 17             94.0    1e-20   
ref|XP_009111977.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  96.3    1e-20   
ref|XP_009407040.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  95.9    1e-20   
ref|XP_004307514.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  99.4    1e-20   
ref|NP_001043647.1|  Os01g0631500                                     97.4    1e-20   
ref|XP_006644401.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  97.4    1e-20   
ref|NP_201130.1|  carbohydrate-binding X8 domain-containing protein   94.4    1e-20   
gb|EAY75064.1|  hypothetical protein OsI_02956                        97.4    1e-20   
ref|XP_009627182.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  95.9    1e-20   
gb|KDO42823.1|  hypothetical protein CISIN_1g0304152mg                94.0    1e-20   
ref|XP_006416584.1|  hypothetical protein EUTSA_v10008839mg           95.9    2e-20   
ref|XP_010105821.1|  hypothetical protein L484_004704                 95.5    2e-20   
ref|XP_007034351.1|  Carbohydrate-binding X8 domain superfamily p...  95.5    2e-20   
gb|KFK36244.1|  glucan endo- -beta-glucosidase 4 precursor            95.5    2e-20   
ref|XP_004298071.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  95.5    2e-20   
ref|XP_009149352.1|  PREDICTED: PLASMODESMATA CALLOSE-BINDING PRO...  95.5    2e-20   
ref|XP_002881667.1|  glycosyl hydrolase family 17 protein             99.4    2e-20   
ref|NP_001131448.1|  hypothetical protein                             97.1    2e-20   
gb|EPS57844.1|  hypothetical protein M569_16973                       95.1    2e-20   
ref|XP_009790933.1|  PREDICTED: major pollen allergen Ole e 10-like   94.0    2e-20   
ref|NP_001031243.1|  carbohydrate-binding X8 domain-containing pr...  93.2    2e-20   
ref|XP_006837143.1|  hypothetical protein AMTR_s00110p00143620        93.2    2e-20   
ref|XP_007157802.1|  hypothetical protein PHAVU_002G099500g           99.0    2e-20   
ref|XP_006586372.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.2    2e-20   
dbj|BAK07907.1|  predicted protein                                    96.7    2e-20   
emb|CDY19232.1|  BnaC05g14330D                                        95.1    2e-20   
ref|XP_006281136.1|  hypothetical protein CARUB_v10027167mg           95.1    2e-20   
ref|XP_010470560.1|  PREDICTED: major pollen allergen Ole e 10-like   92.8    3e-20   
ref|XP_002862246.1|  glycosyl hydrolase family protein 17             93.6    3e-20   
ref|XP_002320265.1|  hypothetical protein POPTR_0014s10980g           93.6    3e-20   
ref|NP_201129.1|  carbohydrate-binding X8 domain-containing protein   93.2    3e-20   
ref|XP_002888553.1|  predicted protein                                92.8    3e-20   



>ref|XP_010690550.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=465

 Score =   147 bits (372),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  ATDAQLQANINYVC QGVDC+PIQPGGACFNPN VR+HA Y+MNTFYQTKGRQ
Sbjct  382  WCVPKPQATDAQLQANINYVCSQGVDCKPIQPGGACFNPNNVRAHATYVMNTFYQTKGRQ  441

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            PFQCDFS TA +++ +PS+G C+Y
Sbjct  442  PFQCDFSHTAMLSNRNPSYGICRY  465



>ref|XP_009789910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=463

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpq-----pkpkptpgrtGKFCTPKAAATDAQLQA  490
            FTPVYN+G+LK + A   P      N       P     P  + KFC PKA ATDAQLQ+
Sbjct  333  FTPVYNIGVLKGEQAQPTPALPAPRNGSGNKGQPTSPVRPAESKKFCMPKADATDAQLQS  392

Query  489  NINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITST  310
            NINYVC QGVDC PIQ GG CFNPNT+RSHAA+ MN++YQ +GR  F CDF+GT  + ST
Sbjct  393  NINYVCSQGVDCTPIQAGGPCFNPNTIRSHAAFAMNSYYQREGRNAFNCDFAGTGVVAST  452

Query  309  DPSHGSCKYLS  277
            DPS+G+CK+ S
Sbjct  453  DPSYGTCKFQS  463



>gb|KDP44958.1| hypothetical protein JCGZ_01458 [Jatropha curcas]
Length=446

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 85/125 (68%), Gaps = 10/125 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVYNVGIL+           P  NP            K+C PKA AT+ QLQ NI+YV
Sbjct  332  FSPVYNVGILR----------NPQKNPTVPQPTPTTGGKKWCVPKAEATEQQLQGNIDYV  381

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QGVDC+PIQ GGACF+PN VRSHA+++MN+FYQT GR  F CDFS T  +T++DPSHG
Sbjct  382  CSQGVDCKPIQAGGACFDPNNVRSHASFVMNSFYQTHGRNDFNCDFSKTGEVTTSDPSHG  441

Query  294  SCKYL  280
             CKYL
Sbjct  442  GCKYL  446



>gb|AHL24662.1| Fra e 10.01 allergen [Fraxinus excelsior]
Length=123

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            K+C PKA ATDAQLQ+NI+YVC QG +DCRPIQ  GACFNPNT R+HA+Y+MN++YQ+KG
Sbjct  36   KWCVPKAEATDAQLQSNIDYVCSQGGMDCRPIQANGACFNPNTARAHASYVMNSWYQSKG  95

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
            R  F C+FSGT  ITS+DPS+GSC +LS
Sbjct  96   RNDFDCNFSGTGAITSSDPSNGSCSFLS  123



>ref|XP_009593199.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=464

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 89/131 (68%), Gaps = 5/131 (4%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpq-----pkpkptpgrtGKFCTPKAAATDAQLQA  490
            FTPVYN+G+LK + A   P      N       P     P  + KFC PKA ATDAQLQ+
Sbjct  334  FTPVYNIGVLKGEQAQPTPALPAPRNGSGNNGQPTSPVRPAESKKFCMPKAEATDAQLQS  393

Query  489  NINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITST  310
            NINYVC QGVDC PIQ GG CFNPNT+RSHAA+ MN++YQ +GR  F CDF+GT  + S 
Sbjct  394  NINYVCSQGVDCTPIQAGGPCFNPNTIRSHAAFAMNSYYQREGRNQFNCDFAGTGVVASA  453

Query  309  DPSHGSCKYLS  277
            DPS+G+CK+ S
Sbjct  454  DPSYGTCKFQS  464



>sp|Q84V39.1|ALL10_OLEEU RecName: Full=Major pollen allergen Ole e 10; AltName: Allergen=Ole 
e 10; Flags: Precursor [Olea europaea]
 gb|AAL92578.1| allergen Ole e 10 [Olea europaea]
Length=123

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            K+C PKA ATDAQLQ+NI+YVC Q G+DC PIQ  GACFNPNTVR+HA+Y MN++YQ+KG
Sbjct  36   KWCVPKAEATDAQLQSNIDYVCSQSGMDCGPIQANGACFNPNTVRAHASYAMNSWYQSKG  95

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
            R  F CDFSGT  ITS+DPS+GSC +LS
Sbjct  96   RNDFDCDFSGTGAITSSDPSNGSCSFLS  123



>ref|XP_011029669.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=448

 Score =   141 bits (355),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 12/124 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VGI++            N        P+P ++ K+C PKA ATD  LQANI+YV
Sbjct  336  FTPVYDVGIMR------------NGQSNRPTPPSPTKSKKWCVPKADATDKALQANIDYV  383

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG+DC+PIQ GGACF+PN VRSHA+Y+MN++YQ+ GR  F CDFS TA +T++DPSHG
Sbjct  384  CSQGMDCKPIQAGGACFSPNNVRSHASYIMNSYYQSHGRNDFNCDFSQTAVLTTSDPSHG  443

Query  294  SCKY  283
            +CKY
Sbjct  444  TCKY  447



>ref|XP_010690542.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=488

 Score =   141 bits (356),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/85 (74%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  ATDAQLQANINYVC QGVDC+PIQPGGACFNPN VR+HA Y+MNTFYQTKGRQ
Sbjct  382  WCVPKPQATDAQLQANINYVCSQGVDCKPIQPGGACFNPNNVRAHATYVMNTFYQTKGRQ  441

Query  354  PFQCDFSGTATITSTDPSHGSCKYL  280
            PFQCDFS TA +++ +PS   C  L
Sbjct  442  PFQCDFSHTAMLSNRNPSKYRCSSL  466



>gb|EYU33213.1| hypothetical protein MIMGU_mgv1a006294mg [Erythranthe guttata]
Length=449

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 88/126 (70%), Gaps = 7/126 (6%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP Y+ GI++     A   P   P P    K       K+C PKA A+D++LQ NI+YV
Sbjct  331  FTPAYDAGIMRVGSTAAPVQPIKRPTPAQDGK-------KWCVPKAEASDSELQKNIDYV  383

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QGVDC PIQPGGACF+PNTVRSHA+++MN FYQ +GR  F C+FSG+  ITSTDPS G
Sbjct  384  CSQGVDCGPIQPGGACFDPNTVRSHASFVMNAFYQREGRHDFNCNFSGSGLITSTDPSTG  443

Query  294  SCKYLS  277
            +CKYL+
Sbjct  444  NCKYLA  449



>ref|XP_011091523.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=457

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 4/126 (3%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY++G+L+             P P+P          K+C PK  ATDA+LQANI+YV
Sbjct  336  FTPVYDIGVLR----QGTAAAPQQPVPRPALPAPAQEGKKWCVPKPDATDAELQANIDYV  391

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG++C+PIQPGG CF+PNTVR+HA+++MNT+YQ++GR  F CDFSG+  +T TDPS+G
Sbjct  392  CSQGLNCQPIQPGGPCFDPNTVRAHASFVMNTYYQSEGRHDFNCDFSGSGVLTFTDPSNG  451

Query  294  SCKYLS  277
             CKY+S
Sbjct  452  PCKYVS  457



>emb|CAN83700.1| hypothetical protein VITISV_027546 [Vitis vinifera]
Length=325

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 13/126 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY++GILK              +    P PT     K+C PK  ATD  LQ+NINYV
Sbjct  213  FTPVYDIGILK-------------QSAGGAPTPTVPSGKKWCVPKPDATDEALQSNINYV  259

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC+PIQPGGAC++PNT+RSHA+Y MN +YQT GR  F CDF+ T  + ++DPSHG
Sbjct  260  CSTGVDCKPIQPGGACYDPNTIRSHASYAMNAYYQTSGRHDFNCDFANTGVLATSDPSHG  319

Query  294  SCKYLS  277
             C+Y+S
Sbjct  320  PCQYIS  325



>emb|CBI31680.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 13/126 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY++GILK              +    P PT     K+C PK  ATD  LQ+NINYV
Sbjct  294  FTPVYDIGILK-------------QSAGGAPTPTVPSGKKWCVPKPDATDEALQSNINYV  340

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC+PIQPGGAC++PNT+RSHA+Y MN +YQT GR  F CDF+ T  + ++DPSHG
Sbjct  341  CSTGVDCKPIQPGGACYDPNTIRSHASYAMNAYYQTSGRHDFNCDFANTGVLATSDPSHG  400

Query  294  SCKYLS  277
             C+Y+S
Sbjct  401  PCQYIS  406



>ref|NP_001275174.1| glucan endo-1,3-beta-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52649.1| beta-1,3-glucanase 14 [Solanum tuberosum]
Length=462

 Score =   140 bits (352),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 89/129 (69%), Gaps = 3/129 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphp---rpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANI  484
            FTPVY+VG+LKA+ A   P     +           TP    KFC PK  ATDAQLQ+NI
Sbjct  334  FTPVYDVGVLKAKQAHPTPSLPPPKTGGGGNKGQPKTPAENKKFCMPKVGATDAQLQSNI  393

Query  483  NYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDP  304
            NYVC QGVDC PIQ GG+CF PNT+RSHAA+ MN++YQ +GR  F CDF+GT  + ++DP
Sbjct  394  NYVCSQGVDCTPIQVGGSCFKPNTIRSHAAFAMNSYYQREGRNNFNCDFAGTGVVAASDP  453

Query  303  SHGSCKYLS  277
            S+G+CK+ S
Sbjct  454  SYGTCKFES  462



>gb|AHL24654.1| Fra e 9.01 allergen [Fraxinus excelsior]
Length=462

 Score =   139 bits (351),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 90/127 (71%), Gaps = 3/127 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VGI++                 PKP     +  K+C PKA ATDAQLQ+NI+YV
Sbjct  338  FTPVYDVGIMRGTAGVPDQPVPTPSPSVPKPPTQGNK--KWCVPKAEATDAQLQSNIDYV  395

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            C QG +DC PIQ  GACFNPNTVR+HA+Y+MN++YQ+KGR  F CDFSGT  +TS+DPS+
Sbjct  396  CSQGGMDCGPIQANGACFNPNTVRAHASYVMNSWYQSKGRNDFGCDFSGTGAVTSSDPSN  455

Query  297  GSCKYLS  277
            GSC +LS
Sbjct  456  GSCSFLS  462



>ref|XP_010256938.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=455

 Score =   139 bits (350),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA A+D  LQANINYVCG GVDC+ IQPGG CF+PNT+RSHA+Y+MN +YQT GR 
Sbjct  370  WCVPKAEASDEALQANINYVCGTGVDCKLIQPGGNCFDPNTIRSHASYVMNAYYQTAGRH  429

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
             F CDFS TA +T+TDPSHG+C+Y+S
Sbjct  430  SFNCDFSHTAVLTTTDPSHGTCQYIS  455



>gb|EYU19897.1| hypothetical protein MIMGU_mgv1a006105mg [Erythranthe guttata]
Length=457

 Score =   139 bits (349),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FT VY+VGI++             P+      P  G   K+C PKA ATDA LQ NINY 
Sbjct  333  FTAVYDVGIMRGGSGGGGGGGGAAPSKPTPAPPVTGSN-KWCVPKAGATDAALQNNINYA  391

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CGQG+DC+PIQPGGACFNP TVR+HA+++MNT+Y  KG Q F CDFSGT  +TS+DPS  
Sbjct  392  CGQGIDCQPIQPGGACFNPPTVRAHASFVMNTYYHAKGLQDFNCDFSGTGVVTSSDPSTS  451

Query  294  SCKYLS  277
            +CKY+S
Sbjct  452  TCKYVS  457



>gb|AHL24655.1| Fra e 9.02 allergen [Fraxinus excelsior]
Length=468

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 89/132 (67%), Gaps = 6/132 (5%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgr-----tGKFCTPKAAATDAQLQA  490
            FTPVY+VGI++                 P P     +       K+C PKA ATDAQLQ+
Sbjct  337  FTPVYDVGIMRGTAGVPDQPVPTPSPSVPTPSSPVPKPPTQGNKKWCVPKAEATDAQLQS  396

Query  489  NINYVCGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITS  313
            NI+YVC QG +DCRPIQ  GACFNPNT R+HA+Y+MN++YQ+KGR  F C+FSGT  ITS
Sbjct  397  NIDYVCSQGGMDCRPIQANGACFNPNTARAHASYVMNSWYQSKGRNDFDCNFSGTGAITS  456

Query  312  TDPSHGSCKYLS  277
            +DPS+GSC +LS
Sbjct  457  SDPSNGSCSFLS  468



>ref|XP_009610601.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana tomentosiformis]
Length=494

 Score =   139 bits (350),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVC-GQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            KFC PK  ATDAQLQAN++++C  QGVDCRP+Q GG CFNPNTVRSHA+++MN++YQTKG
Sbjct  407  KFCMPKPEATDAQLQANLDWICTNQGVDCRPVQVGGLCFNPNTVRSHASFVMNSYYQTKG  466

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
            R  F CDFSG+A I   DPS+G+CKYLS
Sbjct  467  RNDFNCDFSGSAVIVFADPSYGTCKYLS  494



>ref|XP_002283647.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=447

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 84/126 (67%), Gaps = 13/126 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY++GILK              +    P PT     K+C PK  ATD  LQ+NINYV
Sbjct  335  FTPVYDIGILK-------------QSAGGAPTPTVPSGKKWCVPKPDATDEALQSNINYV  381

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC+PIQPGGAC++PNT+RSHA+Y MN +YQT GR  F CDF+ T  + ++DPSHG
Sbjct  382  CSTGVDCKPIQPGGACYDPNTIRSHASYAMNAYYQTSGRHDFNCDFANTGVLATSDPSHG  441

Query  294  SCKYLS  277
             C+Y+S
Sbjct  442  PCQYIS  447



>gb|ABK95730.1| unknown [Populus trichocarpa]
Length=448

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 12/124 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VGI++            N        P+P ++ K+C PKA ATD  LQANI+YV
Sbjct  336  FTPVYDVGIMR------------NGQSSRPTPPSPTKSKKWCVPKADATDKALQANIDYV  383

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG+DC+PIQ GGACF+PN +RSHA+Y+MN++YQ+ G   F CDFS TA +T++DPSHG
Sbjct  384  CSQGMDCKPIQAGGACFSPNNIRSHASYIMNSYYQSHGSNDFNCDFSQTAVLTTSDPSHG  443

Query  294  SCKY  283
            +CKY
Sbjct  444  TCKY  447



>ref|XP_002312097.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
 gb|EEE89464.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
Length=448

 Score =   138 bits (348),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 88/124 (71%), Gaps = 12/124 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VGI++            N        P+P ++ K+C PKA ATD  LQANI+YV
Sbjct  336  FTPVYDVGIMR------------NGQSSRPTPPSPTKSKKWCVPKADATDKALQANIDYV  383

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG+DC+PIQ GGACF+PN +RSHA+Y+MN++YQ+ G   F CDFS TA +T++DPSHG
Sbjct  384  CSQGMDCKPIQAGGACFSPNNIRSHASYIMNSYYQSHGSNDFNCDFSQTAVLTTSDPSHG  443

Query  294  SCKY  283
            +CKY
Sbjct  444  TCKY  447



>ref|XP_009791207.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=490

 Score =   138 bits (347),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVC-GQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            KFC PK  ATDAQLQ NI+++C  QGVDCRP+Q GG CF+PNTVRSHAA++MN++YQTKG
Sbjct  403  KFCMPKPEATDAQLQTNIDWICTNQGVDCRPVQAGGLCFDPNTVRSHAAFVMNSYYQTKG  462

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
            R  F CDFSG+A I   DPS+G+CKYLS
Sbjct  463  RNDFNCDFSGSAVIVFADPSYGTCKYLS  490



>ref|NP_001234416.1| beta-glucosidase 08 precursor [Solanum lycopersicum]
 gb|ACH56716.1| beta-glucosidase 08 [Solanum lycopersicum]
Length=459

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 91/129 (71%), Gaps = 3/129 (2%)
 Frame = -1

Query  654  FTPVYNVGILK---AqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANI  484
            FTPVY+VG+LK   A P P+LP P+           TP    KFC PK  ATDAQLQ+NI
Sbjct  331  FTPVYDVGVLKSNQAHPTPSLPPPKTGGGGNKGQPKTPAENKKFCMPKVEATDAQLQSNI  390

Query  483  NYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDP  304
            NYVC QGVDC PIQ GG+CF PNT+RSHAA+ MN++YQ +GR  F CDF+GT  +  +DP
Sbjct  391  NYVCSQGVDCTPIQVGGSCFKPNTIRSHAAFAMNSYYQKEGRNNFNCDFAGTGVVAFSDP  450

Query  303  SHGSCKYLS  277
            S+G+CK+ S
Sbjct  451  SYGTCKFES  459



>ref|XP_010264453.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=454

 Score =   137 bits (344),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 79/125 (63%), Gaps = 12/125 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVYNVGI++ Q     P                    K+C PKA A+D  LQANI+YV
Sbjct  341  LTPVYNVGIMRGQSGGPTPTTPSGSGK------------KWCVPKADASDGALQANIDYV  388

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDCRPIQ GG CFNPNT+RSHA+Y MN +YQT GR  F CDF+ T  ITS DPSH 
Sbjct  389  CSLGVDCRPIQAGGDCFNPNTIRSHASYAMNAYYQTSGRHDFNCDFAHTGVITSLDPSHD  448

Query  294  SCKYL  280
            +C+Y+
Sbjct  449  TCRYM  453



>ref|XP_002530863.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31537.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=457

 Score =   135 bits (340),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 85/125 (68%), Gaps = 1/125 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVYN+GI+     P            P+P P  G   ++C PK  A D  LQANINY 
Sbjct  334  FSPVYNIGIMH-NGQPIGGRHGGRNRRGPRPAPRVGGGKRWCVPKTGANDQALQANINYA  392

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QGVDCRPIQ GGACF+PN VRSHA+++MN+FYQT GRQ F CDF+ T  +TS +PSHG
Sbjct  393  CSQGVDCRPIQAGGACFDPNNVRSHASFIMNSFYQTHGRQDFACDFAHTGFLTSLNPSHG  452

Query  294  SCKYL  280
            +C+YL
Sbjct  453  ACRYL  457



>gb|AAX95269.1| glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1-3)-beta-glucan 
endohydrolase) ((1-3)-beta-glucanase) (beta-1,3-endoglucanase) 
[Oryza sativa Japonica Group]
 gb|ABG22610.1| Glucan endo-1,3-beta-glucosidase precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG94836.1| unnamed protein product [Oryza sativa Japonica Group]
Length=431

 Score =   133 bits (335),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP+Y++G+L+       P+P PNP+P P PKP P   GK+C PKA A+D  LQ NINY 
Sbjct  307  FTPIYDLGLLRQSSDSGAPNPSPNPSPNPSPKPAPSGGGKWCVPKAGASDTDLQNNINYA  366

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG  VDC+PIQ GGACF+PN V+SHAA++MN FYQ  GR  + CDF GT  +TS DPS+G
Sbjct  367  CGY-VDCKPIQSGGACFDPNNVQSHAAFVMNAFYQANGRHDYDCDFKGTGAVTSNDPSYG  425

Query  294  SCKYLS  277
            SCKY+S
Sbjct  426  SCKYVS  431



>emb|CDP00093.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 87/126 (69%), Gaps = 9/126 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VGI++   +         P  Q K         K+C PKA ATDA LQ+NI+YV
Sbjct  336  FTPVYDVGIMRGGQSSQPVPVPAAPALQGK---------KWCVPKAGATDAALQSNIDYV  386

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG+DC PIQ  GACFNPN VRSHAA++MN++YQ+KG+  + CDFS T  +TST+PS+G
Sbjct  387  CSQGLDCSPIQAEGACFNPNNVRSHAAFVMNSWYQSKGKADYNCDFSQTGFLTSTNPSYG  446

Query  294  SCKYLS  277
            +C+Y S
Sbjct  447  TCQYTS  452



>ref|XP_011101632.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=456

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 85/126 (67%), Gaps = 4/126 (3%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+ GI++    P    P P     P          K+C PK+ A+ A LQANI+YV
Sbjct  335  FSPVYDAGIMRVAANPVKSAPIPTLPVAPTTTGGK----KWCVPKSDASYAALQANIDYV  390

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG+DC+PIQ GGACF P+TVRSHA++ MN++YQTKGR  F CDFSGT  +TS DPS G
Sbjct  391  CSQGIDCKPIQAGGACFTPSTVRSHASFAMNSYYQTKGRSDFNCDFSGTGFLTSNDPSIG  450

Query  294  SCKYLS  277
             CKY+S
Sbjct  451  GCKYVS  456



>ref|NP_001068545.2| Os11g0704600 [Oryza sativa Japonica Group]
 gb|AAX95270.1| glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1-3)-beta-glucan 
endohydrolase) ((1-3)-beta-glucanase) (beta-1,3-endoglucanase) 
[Oryza sativa Japonica Group]
 gb|ABA95507.2| Glucan endo-1,3-beta-glucosidase precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAG86935.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF28908.2| Os11g0704600 [Oryza sativa Japonica Group]
Length=472

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP+Y++G+L+       P+P PNP+P P PKP P   GK+C PKA A+D  LQ NINY 
Sbjct  348  FTPIYDLGLLRQSSDSGAPNPSPNPSPNPSPKPAPSGGGKWCVPKAGASDTDLQNNINYA  407

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG  VDC+PIQ GGACF+PN V+SHAA++MN FYQ  GR  + CDF GT  +TS DPS+G
Sbjct  408  CGY-VDCKPIQSGGACFDPNNVQSHAAFVMNAFYQANGRHDYDCDFKGTGAVTSNDPSYG  466

Query  294  SCKYLS  277
            SCKY+S
Sbjct  467  SCKYVS  472



>gb|EEC68648.1| hypothetical protein OsI_37085 [Oryza sativa Indica Group]
Length=472

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP+Y++G+L+       P+P PNP+P P PKP P   GK+C PKA A+D  LQ NINY 
Sbjct  348  FTPIYDLGLLRQSSDSGAPNPSPNPSPNPSPKPAPSGGGKWCVPKAGASDTDLQNNINYA  407

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG  VDC+PIQ GGACF+PN V+SHAA++MN FYQ  GR  + CDF GT  +TS DPS+G
Sbjct  408  CGY-VDCKPIQSGGACFDPNNVQSHAAFVMNAFYQANGRHDYDCDFKGTGAVTSNDPSYG  466

Query  294  SCKYLS  277
            SCKY+S
Sbjct  467  SCKYVS  472



>ref|XP_011029787.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=451

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 80/125 (64%), Gaps = 7/125 (6%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP+Y+ GIL+     +              K       ++C PK   +D  LQANI+Y 
Sbjct  334  FTPIYDAGILRNGQRGSGRGGGRQRPRPTPGK-------QWCVPKPGVSDQALQANIDYA  386

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QGVDC+PIQPGGACF+PN VRSHA+Y+MN FYQT GRQ F CDFS T  +T+ +P HG
Sbjct  387  CSQGVDCKPIQPGGACFDPNNVRSHASYVMNFFYQTHGRQAFNCDFSNTGVLTAVNPGHG  446

Query  294  SCKYL  280
            +C+Y+
Sbjct  447  TCRYI  451



>ref|XP_007016411.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY34030.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=497

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 79/124 (64%), Gaps = 6/124 (5%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVYNVG+L+              +  P        +GK+C PK+ AT A LQANI+YV
Sbjct  336  LTPVYNVGVLR------NEQGLGPASAPPTATAPSSGSGKWCVPKSDATVAALQANIDYV  389

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  G+DCRPIQ GGACFNPN VRSHA+Y MN +YQ  GR  F CDF+ T  ITSTDPSH 
Sbjct  390  CSTGLDCRPIQAGGACFNPNNVRSHASYAMNAYYQANGRHDFNCDFNHTGVITSTDPSHE  449

Query  294  SCKY  283
            +C Y
Sbjct  450  ACNY  453



>ref|XP_009364443.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=470

 Score =   131 bits (330),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D+QLQANI+YVCG G DC PIQPGG+CF PNTV+SHA Y MN  YQT GR+
Sbjct  382  YCVPKAGVSDSQLQANIDYVCGHGFDCTPIQPGGSCFEPNTVKSHATYAMNLLYQTAGRE  441

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+ SC Y
Sbjct  442  PWNCDFSQTATLTSNNPSYDSCNY  465



>ref|XP_002530862.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31536.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=447

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 78/118 (66%), Gaps = 13/118 (11%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVYNVG+L+                   P P P    K+C PKA A D QLQANI+YV
Sbjct  335  FSPVYNVGVLR-------------NEQTNTPNPNPTTGKKWCVPKAEANDQQLQANIDYV  381

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPS  301
            C QGVDC+PIQ GGACF+PN +RSHA++ MN+FYQT GR  F CDFS TA IT+ DPS
Sbjct  382  CSQGVDCKPIQAGGACFDPNNIRSHASFAMNSFYQTHGRNDFNCDFSHTAVITTADPS  439



>ref|XP_006345964.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=504

 Score =   131 bits (329),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVC-GQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            KFC PK  ATDAQLQA++++ C  QGVDC P+Q GG CFNPNTVRSHAAY+MN++YQ KG
Sbjct  417  KFCMPKPQATDAQLQASLDWACTNQGVDCGPVQAGGPCFNPNTVRSHAAYVMNSYYQIKG  476

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
            +  F CDFSG+A I   DPS+G+CKYLS
Sbjct  477  KNDFNCDFSGSAAIVFADPSYGTCKYLS  504



>gb|EEE52578.1| hypothetical protein OsJ_34867 [Oryza sativa Japonica Group]
Length=842

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 92/126 (73%), Gaps = 1/126 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP+Y++G+L+       P+P PNP+P P PKP P   GK+C PKA A+D  LQ NINY 
Sbjct  718  FTPIYDLGLLRQSSDSGAPNPSPNPSPNPSPKPAPSGGGKWCVPKAGASDTDLQNNINYA  777

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG  VDC+PIQ GGACF+PN V+SHAA++MN FYQ  GR  + CDF GT  +TS DPS+G
Sbjct  778  CGY-VDCKPIQSGGACFDPNNVQSHAAFVMNAFYQANGRHDYDCDFKGTGAVTSNDPSYG  836

Query  294  SCKYLS  277
            SCKY+S
Sbjct  837  SCKYVS  842



>ref|XP_008377338.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=473

 Score =   130 bits (328),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D+QLQANI+YVCG G DC PIQPGG+CF PNTV+SHA Y MN  YQT GR 
Sbjct  382  YCVPKAGVSDSQLQANIDYVCGHGFDCTPIQPGGSCFEPNTVKSHATYAMNLLYQTAGRN  441

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+ SC Y
Sbjct  442  PWNCDFSQTATLTSNNPSYDSCNY  465



>ref|XP_002312098.1| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89465.1| glucan endo-1 family protein [Populus trichocarpa]
Length=454

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C PK   +D  LQANI+Y C QGVDC+PIQPGGACF+PN VRSHA+Y+MN FYQT GR
Sbjct  369  QWCVPKPGVSDQALQANIDYACSQGVDCKPIQPGGACFDPNNVRSHASYVMNFFYQTHGR  428

Query  357  QPFQCDFSGTATITSTDPSHGSCKYL  280
            Q F CDFS T  +T+ +P HG+C+++
Sbjct  429  QAFNCDFSNTGVLTAVNPGHGTCRFV  454



>gb|KHF99783.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=510

 Score =   129 bits (325),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K+ A+DA LQANI+YVC  GVDC+PIQ GGACFNPN VRSHA+Y MN +YQ  GR
Sbjct  383  KWCVAKSNASDAALQANIDYVCSSGVDCKPIQSGGACFNPNNVRSHASYAMNVYYQANGR  442

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDF+ T  ITSTDPSH +C Y
Sbjct  443  HDFNCDFNRTGVITSTDPSHAACNY  467



>ref|XP_010034118.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW50205.1| hypothetical protein EUGRSUZ_J00013 [Eucalyptus grandis]
Length=451

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/125 (48%), Positives = 82/125 (66%), Gaps = 3/125 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY +GIL+++            + +           ++C  K   +D  +QANI+YV
Sbjct  330  FTPVYKIGILRSERHRRGRRGGRGGHRRAPRPGGGK---RWCVLKQGVSDQAVQANIDYV  386

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDCRPIQ GGACF+PN VR+ A+Y+MN++YQTKGRQP  CDFSG+  +TS +PSHG
Sbjct  387  CSTGVDCRPIQSGGACFDPNNVRARASYIMNSYYQTKGRQPSNCDFSGSGVLTSVNPSHG  446

Query  294  SCKYL  280
            +C Y+
Sbjct  447  ACIYI  451



>ref|XP_002282736.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X2 [Vitis 
vinifera]
 emb|CBI19687.3| unnamed protein product [Vitis vinifera]
Length=465

 Score =   128 bits (322),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  ++AQLQAN++Y CGQG+DCRP+QPGGACF PNTV SHAAY MN FYQ   R 
Sbjct  377  WCVPKSVVSNAQLQANLDYACGQGIDCRPVQPGGACFEPNTVASHAAYAMNLFYQNSARN  436

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+  C Y
Sbjct  437  PWNCDFSQTATLTSKNPSYKGCIY  460



>gb|AFK47562.1| unknown [Lotus japonicus]
Length=150

 Score =   122 bits (305),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 76/123 (62%), Gaps = 8/123 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY  G+L++   PA                      K+C PKA A++  LQANINYV
Sbjct  35   FTPVYESGVLRSGQRPAPVGGGVPKPAVGGQ--------KWCVPKADASNQALQANINYV  86

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C Q VDC+PIQPGG CF PN VR+ A Y MN +YQ  GR  + CDFS TA ITST+PSHG
Sbjct  87   CSQNVDCKPIQPGGTCFAPNDVRALATYAMNAYYQANGRHDYNCDFSHTAVITSTNPSHG  146

Query  294  SCK  286
            +C+
Sbjct  147  NCR  149



>pdb|2JON|A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9
Length=101

 Score =   120 bits (301),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 52/87 (60%), Positives = 66/87 (76%), Gaps = 0/87 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
             +C PK   +D QL  NINY C QG+DC PIQPGGACF PNTV++HAAY+MN +YQ  GR
Sbjct  12   SWCVPKPGVSDDQLTGNINYACSQGIDCGPIQPGGACFEPNTVKAHAAYVMNLYYQHAGR  71

Query  357  QPFQCDFSGTATITSTDPSHGSCKYLS  277
              + CDFS TAT+T+T+PS+G+C + S
Sbjct  72   NSWNCDFSQTATLTNTNPSYGACNFPS  98



>ref|XP_009405069.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   127 bits (320),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 1/87 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            K+C PK+ A DA LQANINYVC  G VDC+PIQ GGACF+PN++ SHAAY MN FY+  G
Sbjct  385  KWCVPKSDAGDAALQANINYVCSSGRVDCKPIQDGGACFSPNSLHSHAAYAMNAFYKAAG  444

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYL  280
            +  F CDFSG+A IT+TDPS+G+CKY+
Sbjct  445  QHEFDCDFSGSAIITTTDPSYGTCKYM  471



>ref|XP_006488330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Citrus 
sinensis]
Length=502

 Score =   127 bits (320),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 82/126 (65%), Gaps = 2/126 (2%)
 Frame = -1

Query  654  FTPVYNVGIL--KAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANIN  481
            FTPVY+VGIL  K  PA A     P   P  KP        K+C PK+ A+DA LQANI+
Sbjct  338  FTPVYDVGILRNKQGPAKAPGGRPPTEAPVAKPPSGAVTGRKWCVPKSDASDAALQANID  397

Query  480  YVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPS  301
            YVCG GVDC+PIQ GG CFNPN VRSHAAY MN FYQ  G   + CDF+ T  +TS DPS
Sbjct  398  YVCGTGVDCKPIQAGGPCFNPNNVRSHAAYAMNAFYQANGLHDYACDFNKTGVLTSADPS  457

Query  300  HGSCKY  283
            + +C Y
Sbjct  458  YEACDY  463



>sp|Q94G86.1|ALL9_OLEEU RecName: Full=Glucan endo-1,3-beta-D-glucosidase; AltName: Full=Major 
pollen allergen Ole e 9; AltName: Allergen=Ole e 9; 
Flags: Precursor [Olea europaea]
 gb|AAK58515.1|AF249675_1 beta-1,3-glucanase-like protein [Olea europaea]
Length=460

 Score =   127 bits (318),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +D QL  NINY CGQG+DC PIQPGGACF PNTV++HAAY+MN +YQ+ GR 
Sbjct  372  WCVPKPGVSDDQLTGNINYACGQGIDCGPIQPGGACFEPNTVKAHAAYVMNLYYQSAGRN  431

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
             + CDFS TAT+T+T+PS+G+C + S
Sbjct  432  SWNCDFSQTATLTNTNPSYGACNFPS  457



>ref|XP_010922329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=447

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 79/127 (62%), Gaps = 13/127 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVYNVG++K             P+             K+C PK+ A+DA LQANINY 
Sbjct  333  LTPVYNVGLMK------------TPSGGGGGATPAPSGRKWCVPKSDASDAALQANINYA  380

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            C  G VDC+PIQ GGACF PN++R+HAA+ MN +YQ  GR  F CDFS +A ITS DPS 
Sbjct  381  CSSGIVDCKPIQEGGACFLPNSLRAHAAFAMNAYYQAAGRHNFNCDFSNSAVITSADPSS  440

Query  297  GSCKYLS  277
            GSCK+ S
Sbjct  441  GSCKFSS  447



>ref|XP_008457927.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cucumis melo]
Length=464

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA   D QLQ+N++Y CG G+DC PIQPGGACF PNTV+SHAAY MN +YQ+ G+ 
Sbjct  376  WCLPKADIPDDQLQSNLDYACGHGIDCGPIQPGGACFEPNTVKSHAAYAMNLYYQSLGKN  435

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TST+PS+ +C Y
Sbjct  436  PWNCDFSQTATLTSTNPSYNACTY  459



>ref|XP_006424832.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
 ref|XP_006488329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Citrus 
sinensis]
 gb|ESR38072.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
Length=504

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 80/128 (63%), Gaps = 4/128 (3%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprp----npnpqpkpkptpgrtGKFCTPKAAATDAQLQAN  487
            FTPVY+VGIL+ + A               P  KP        K+C PK+ A+DA LQAN
Sbjct  338  FTPVYDVGILRNKQAQGPAKAPGGRPPTEAPVAKPPSGAVTGRKWCVPKSDASDAALQAN  397

Query  486  INYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTD  307
            I+YVCG GVDC+PIQ GG CFNPN VRSHAAY MN FYQ  G   + CDF+ T  +TS D
Sbjct  398  IDYVCGTGVDCKPIQAGGPCFNPNNVRSHAAYAMNAFYQANGLHDYACDFNKTGVLTSAD  457

Query  306  PSHGSCKY  283
            PS+ +C Y
Sbjct  458  PSYEACDY  465



>gb|EYU45144.1| hypothetical protein MIMGU_mgv1a006001mg [Erythranthe guttata]
Length=461

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQLQAN++YVCGQG+DC PIQPGGACF P+TV SHA+Y MN  YQ+  ++
Sbjct  373  WCVPKGGVSDAQLQANLDYVCGQGLDCSPIQPGGACFEPSTVASHASYAMNVLYQSSEKK  432

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TST+PS+  C Y
Sbjct  433  PWNCDFSQTATLTSTNPSYDKCIY  456



>ref|XP_004239793.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Solanum lycopersicum]
Length=526

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVC-GQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            KFC PK  ATDAQLQA++++ C  QGVDC P+Q GG CF+PNTVRSHAAY+MN +YQ KG
Sbjct  439  KFCMPKPQATDAQLQASLDWACTNQGVDCGPVQAGGPCFDPNTVRSHAAYVMNAYYQIKG  498

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
            +    CDFSG+A I   DPS+G+CKYLS
Sbjct  499  KNDINCDFSGSAAIVFADPSYGTCKYLS  526



>ref|XP_011024410.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Populus euphratica]
Length=510

 Score =   126 bits (317),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+ A+DAQLQAN++Y CG+G+DC PI+PGGACF PNT+ SHAAY MN FYQT  + 
Sbjct  420  WCVPKSGASDAQLQANLDYACGRGIDCSPIEPGGACFEPNTIASHAAYAMNLFYQTSDKS  479

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
            P  CDFS +AT++S +PS+ +C Y S
Sbjct  480  PLNCDFSQSATLSSNNPSYNACTYPS  505



>gb|KDO49091.1| hypothetical protein CISIN_1g0122621mg, partial [Citrus sinensis]
 gb|KDO49092.1| hypothetical protein CISIN_1g0122621mg, partial [Citrus sinensis]
Length=222

 Score =   122 bits (306),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQA+++Y C QG+DC PIQPGGACF PNTV SHAA+ MN +YQT  + 
Sbjct  134  WCVPKAGISDAQLQASLDYACSQGIDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKN  193

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
            P+ CDFS TAT+TS +PS+  C Y S
Sbjct  194  PWNCDFSKTATLTSQNPSYNGCVYPS  219



>ref|XP_007017515.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 2 
[Theobroma cacao]
 gb|EOY14740.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 2 
[Theobroma cacao]
Length=341

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P+A  +DA+LQA+++Y CG G+DC PIQPGGACF PNT+ SHAAY MN FYQT GR 
Sbjct  253  WCVPRAGVSDAELQASLDYACGHGIDCSPIQPGGACFEPNTIASHAAYAMNLFYQTAGRN  312

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TA ++S +PS+  C Y
Sbjct  313  PWNCDFSQTAMLSSNNPSYNGCTY  336



>gb|KDP38494.1| hypothetical protein JCGZ_04419 [Jatropha curcas]
Length=461

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQAN++Y CG GVDC PIQPGGACF PNTV SHAA+ MN  YQT  R 
Sbjct  373  WCVPKAGVSDAQLQANLDYACGHGVDCSPIQPGGACFEPNTVASHAAFAMNLLYQTSDRN  432

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT++S +PS+ +C Y
Sbjct  433  PVNCDFSQTATLSSKNPSYDACTY  456



>ref|XP_010263687.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Nelumbo nucifera]
Length=465

 Score =   125 bits (315),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   ++AQLQAN++Y CGQG+DC P+QPGGAC+ PNTV SHAA+ MN FYQ   R 
Sbjct  377  WCVPKDGISEAQLQANLDYACGQGIDCSPLQPGGACYEPNTVASHAAFAMNLFYQKSARN  436

Query  354  PFQCDFSGTATITSTDPSHGSCKYL  280
            P  CDFS TAT+TS +PS+ SC YL
Sbjct  437  PLNCDFSQTATLTSNNPSYNSCIYL  461



>ref|XP_010254870.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Nelumbo nucifera]
Length=512

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQLQ+N++Y CG G+DC P+QPGGACF PNTV +HAAY MN FYQ  GR 
Sbjct  424  WCVPKDGISDAQLQSNLDYACGHGIDCGPLQPGGACFEPNTVAAHAAYAMNLFYQNAGRN  483

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+ SC Y
Sbjct  484  PWNCDFSQTATLTSNNPSYNSCIY  507



>ref|XP_007017514.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
 gb|EOY14739.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 1 
[Theobroma cacao]
Length=464

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P+A  +DA+LQA+++Y CG G+DC PIQPGGACF PNT+ SHAAY MN FYQT GR 
Sbjct  376  WCVPRAGVSDAELQASLDYACGHGIDCSPIQPGGACFEPNTIASHAAYAMNLFYQTAGRN  435

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TA ++S +PS+  C Y
Sbjct  436  PWNCDFSQTAMLSSNNPSYNGCTY  459



>ref|XP_007017516.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
 gb|EOY14741.1| Glucan endo-1,3-beta-glucosidase 7-beta-glucanase 7 isoform 3 
[Theobroma cacao]
Length=465

 Score =   125 bits (314),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P+A  +DA+LQA+++Y CG G+DC PIQPGGACF PNT+ SHAAY MN FYQT GR 
Sbjct  377  WCVPRAGVSDAELQASLDYACGHGIDCSPIQPGGACFEPNTIASHAAYAMNLFYQTAGRN  436

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TA ++S +PS+  C Y
Sbjct  437  PWNCDFSQTAMLSSNNPSYNGCTY  460



>ref|XP_010664681.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Vitis 
vinifera]
Length=500

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 64/81 (79%), Gaps = 0/81 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  ++AQLQAN++Y CGQG+DCRP+QPGGACF PNTV SHAAY MN FYQ   R 
Sbjct  377  WCVPKSVVSNAQLQANLDYACGQGIDCRPVQPGGACFEPNTVASHAAYAMNLFYQNSARN  436

Query  354  PFQCDFSGTATITSTDPSHGS  292
            P+ CDFS TAT+TS +PS  S
Sbjct  437  PWNCDFSQTATLTSKNPSKSS  457



>ref|XP_004173544.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
Length=293

 Score =   123 bits (308),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA   D QLQ+N++Y CG G+DC PIQPGGACF PNT++SHAAY MN +YQ+ G+ 
Sbjct  205  WCLPKADIPDDQLQSNLDYACGHGIDCGPIQPGGACFEPNTIQSHAAYAMNLYYQSLGKN  264

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+ +C Y
Sbjct  265  PWNCDFSQTATLTSANPSYNACTY  288



>ref|XP_004299094.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=516

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 63/131 (48%), Positives = 85/131 (65%), Gaps = 6/131 (5%)
 Frame = -1

Query  537  KFCTPK-AAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            K+C PK +  +DAQLQAN++Y CG G+DC PIQPGGACF+PNTV SHAAY MN +Y T G
Sbjct  381  KWCVPKTSGVSDAQLQANLDYACGHGIDCSPIQPGGACFDPNTVASHAAYAMNLYYHTVG  440

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYL---S*WMHAAWAGRWRVRNNQFGGL--GC**HN  196
              P  CDFS TAT+TST+PS+ +C Y    S  +  A      + N+ F  +  G    N
Sbjct  441  TDPMNCDFSQTATLTSTNPSYNACVYPGGGSSSLPVAATKMNEISNDGFSKVRTGSSIRN  500

Query  195  EVFIHLLSWLI  163
            ++ +++  +LI
Sbjct  501  KILVYMFLFLI  511



>gb|KHN33758.1| Glucan endo-1,3-beta-glucosidase 7, partial [Glycine soja]
Length=403

 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQANI+Y C QG+DC PIQPGGACF PNTV SHAAY MN +YQT G+ 
Sbjct  315  WCIPKAGVSDAQLQANIDYACSQGIDCGPIQPGGACFEPNTVASHAAYSMNLYYQTSGKN  374

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS +AT+TS +PS+ +C Y
Sbjct  375  QWNCDFSQSATLTSQNPSYNACIY  398



>gb|KJB83778.1| hypothetical protein B456_013G263800 [Gossypium raimondii]
Length=510

 Score =   125 bits (313),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K+ A++A LQANI+YVC  GVDC+PIQ  GACFNPN VRSHA+Y MN +YQ  GR
Sbjct  383  KWCVAKSNASNAALQANIDYVCSSGVDCKPIQSAGACFNPNNVRSHASYAMNAYYQANGR  442

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDF+ T  ITSTDPSH +C Y
Sbjct  443  HDFNCDFNRTGVITSTDPSHAACNY  467



>emb|CDP21469.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 77/126 (61%), Gaps = 10/126 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VGIL+                     P      K+C PK  A+D  LQ+NI+YV
Sbjct  343  FSPVYDVGILR----------NQQGVGPAPVTPAAPDDKKWCVPKDDASDGALQSNIDYV  392

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG GVDC+PIQ GG CF PNTVRSHAAY MN +YQ  GR  + CDF GTA IT+ +PS+ 
Sbjct  393  CGSGVDCQPIQNGGPCFEPNTVRSHAAYAMNAYYQAHGRNDYNCDFIGTAAITTANPSYQ  452

Query  294  SCKYLS  277
             C Y++
Sbjct  453  GCTYVA  458



>ref|XP_007220315.1| hypothetical protein PRUPE_ppa005160m2g, partial [Prunus persica]
 gb|EMJ21514.1| hypothetical protein PRUPE_ppa005160m2g, partial [Prunus persica]
Length=144

 Score =   119 bits (297),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K  AT+  LQANI+YVCG+GVDC+PIQPGG CF+ N V++ A+YLMN +YQ  GR
Sbjct  59   KWCVAKPGATNQALQANIDYVCGKGVDCKPIQPGGTCFD-NDVKARASYLMNAYYQANGR  117

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDFS T  +TS DPSHGSCKY
Sbjct  118  HDFNCDFSKTGQLTSADPSHGSCKY  142



>ref|XP_004151673.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 ref|XP_004168987.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 gb|KGN65723.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=489

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 78/124 (63%), Gaps = 7/124 (6%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VGIL+         P   P              ++C PK  A+D  LQ NI+YV
Sbjct  330  FTPVYDVGILQ-------NPPAMGPTSPVGGPKPSDEEREWCVPKTDASDEALQKNIDYV  382

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC PIQ GGAC++PNTVRSHA+Y MN ++QT GR  F CDF+ TA +TSTDPS+ 
Sbjct  383  CSSGVDCGPIQEGGACYDPNTVRSHASYAMNAYFQTAGRHEFNCDFNHTAILTSTDPSYE  442

Query  294  SCKY  283
            +C Y
Sbjct  443  ACSY  446



>ref|XP_003522947.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Glycine max]
Length=459

 Score =   124 bits (312),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQANI+Y C QG+DC PIQPGGACF PNTV SHAAY MN +YQT G+ 
Sbjct  371  WCIPKAGVSDAQLQANIDYACSQGIDCGPIQPGGACFEPNTVASHAAYSMNLYYQTSGKN  430

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS +AT+TS +PS+ +C Y
Sbjct  431  QWNCDFSQSATLTSQNPSYNACIY  454



>ref|XP_009365605.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Pyrus x bretschneideri]
Length=483

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D+QLQANI+YVCG+G DC PIQPGG+CF PN V+SHAAY MN  YQT G  
Sbjct  395  YCVPKAGVSDSQLQANIDYVCGRGFDCTPIQPGGSCFEPNNVKSHAAYAMNLLYQTTGGD  454

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT++S +PS+ SC Y
Sbjct  455  PQNCDFSQTATLSSNNPSYDSCNY  478



>ref|XP_006663687.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Oryza brachyantha]
Length=459

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 92/126 (73%), Gaps = 2/126 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP+Y++G+L+ Q     P+P PNP+P P PKP P   G++C  KA A+D  LQ NINY 
Sbjct  336  FTPIYDLGLLR-QSDSGAPNPAPNPSPNPSPKPAPSGGGQWCVAKAGASDTDLQNNINYA  394

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG  VDC+PIQ GGACF+PN V+SHAA++MN FYQ  GR  + CDF GT  +TS DPS+G
Sbjct  395  CGY-VDCKPIQSGGACFDPNNVQSHAAFVMNAFYQANGRHDYDCDFKGTGVVTSNDPSYG  453

Query  294  SCKYLS  277
            SCKY+S
Sbjct  454  SCKYVS  459



>gb|KHG11479.1| hypothetical protein F383_06303 [Gossypium arboreum]
Length=456

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ++++Y CGQG+DC PIQPGGACF PNT+ SHAAY MN +YQ+  + 
Sbjct  368  WCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTIASHAAYAMNLYYQSSAKN  427

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+ +C Y
Sbjct  428  PWNCDFSQTATLTSQNPSYNNCIY  451



>ref|XP_003552703.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Glycine max]
Length=454

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 75/123 (61%), Gaps = 0/123 (0%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+ GIL+   A     P P     P          K+C PKA A++  LQANINYV
Sbjct  331  FTPVYDSGILRNGQAVTPARPTPTRPAAPTKPAPAVGGQKWCVPKADASNQALQANINYV  390

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QGVDCRPIQPGG CF  N V++ A Y MN +YQ  GR  F CDFS T  IT+T+PSH 
Sbjct  391  CSQGVDCRPIQPGGDCFAANNVKALATYAMNAYYQANGRHDFNCDFSQTGVITTTNPSHD  450

Query  294  SCK  286
             CK
Sbjct  451  KCK  453



>ref|XP_011083694.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Sesamum indicum]
Length=462

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ N++Y CGQG+DC  IQPGGACF P TV SHA Y MN  YQT G+ 
Sbjct  374  WCVPKAGVSDAQLQENLDYACGQGIDCSAIQPGGACFEPMTVASHATYAMNLLYQTSGKN  433

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TST+PS+  C Y
Sbjct  434  PWDCDFSQTATLTSTNPSYDKCSY  457



>gb|KEH40123.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=479

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  TD QLQAN++Y CGQG+DC  IQPGGACF PNT+ +HAAY MN FY T G+ 
Sbjct  391  WCVPKAGLTDVQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTVGQN  450

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS +PS+ SC Y
Sbjct  451  PLTCDFSQTATLTSNNPSYNSCIY  474



>ref|XP_004500813.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Cicer arietinum]
Length=440

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D QLQ+NI+Y CGQG+DC PI+PGGACF PNTV SHAA++MN +YQT GR 
Sbjct  355  WCIPKAGVSDTQLQSNIDYACGQGIDCGPIKPGGACFEPNTVASHAAFVMNLYYQTFGRN  414

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS TAT+TS +PS+ +C Y
Sbjct  415  QWNCDFSQTATLTSQNPSYNACIY  438



>ref|XP_002509479.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF50866.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=460

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+   DAQLQA+++Y CGQG+DC PIQPGGACF PNT+ SHAAY MN +YQT  + 
Sbjct  372  WCMPKSGVPDAQLQASLDYACGQGIDCSPIQPGGACFEPNTLASHAAYAMNLYYQTSSKN  431

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+  C Y
Sbjct  432  PWNCDFSQTATLTSKNPSYNGCVY  455



>gb|KCW67838.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=352

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  +DAQLQAN++Y CGQG+DCRPIQPGGACF PNT+ +HAAY MN +YQ   R 
Sbjct  264  WCIPKSGVSDAQLQANLDYACGQGIDCRPIQPGGACFEPNTLAAHAAYAMNLYYQNSNRS  323

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
            P  CDFS +AT +S +PS+  C Y S
Sbjct  324  PTNCDFSQSATFSSNNPSYNGCVYPS  349



>ref|XP_004148850.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
 gb|KGN61789.1| hypothetical protein Csa_2G246520 [Cucumis sativus]
Length=464

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA   D QLQ+N++Y CG G+DC PIQPGGACF PNT++SHAAY MN +YQ+ G+ 
Sbjct  376  WCLPKADIPDDQLQSNLDYACGHGIDCGPIQPGGACFEPNTIQSHAAYAMNLYYQSLGKN  435

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+ +C Y
Sbjct  436  PWNCDFSQTATLTSANPSYNACTY  459



>gb|KJB32498.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=323

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ++++Y CGQG+DC PIQPGGACF PNTV SHAAY MN +YQ   + 
Sbjct  235  WCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKN  294

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +P++ +C Y
Sbjct  295  PWNCDFSQTATLTSQNPTYNNCIY  318



>ref|XP_006423251.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
 ref|XP_006487152.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Citrus sinensis]
 gb|ESR36491.1| hypothetical protein CICLE_v10028372mg [Citrus clementina]
Length=467

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQA+++Y C QG+DC PIQPGGACF PNTV SHAA+ MN +YQT  + 
Sbjct  379  WCVPKAGISDAQLQASLDYACSQGIDCSPIQPGGACFEPNTVVSHAAFAMNLYYQTSAKN  438

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
            P+ CDFS TAT+TS +PS+  C Y S
Sbjct  439  PWNCDFSKTATLTSQNPSYNGCVYPS  464



>ref|XP_010060942.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X2 [Eucalyptus 
grandis]
 gb|KCW67837.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=474

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  +DAQLQAN++Y CGQG+DCRPIQPGGACF PNT+ +HAAY MN +YQ   R 
Sbjct  386  WCIPKSGVSDAQLQANLDYACGQGIDCRPIQPGGACFEPNTLAAHAAYAMNLYYQNSNRS  445

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
            P  CDFS +AT +S +PS+  C Y S
Sbjct  446  PTNCDFSQSATFSSNNPSYNGCVYPS  471



>ref|XP_007201010.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
 gb|EMJ02209.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
Length=464

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQAN++Y CG G+DC  IQPGGACF+PNTV SHAAY MN +Y T G  
Sbjct  376  WCVPKAGVSDAQLQANLDYACGHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGTI  435

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS++PS+ +C Y
Sbjct  436  PLNCDFSQTATLTSSNPSYNACTY  459



>ref|XP_008783477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Phoenix dactylifera]
Length=464

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C PK  ATD +LQAN++Y CGQ GVDC PIQPGGAC+ PNT+RSHAAY MN  YQ  GR
Sbjct  376  WCVPKEGATDEELQANLDYACGQAGVDCGPIQPGGACYEPNTLRSHAAYAMNQLYQVAGR  435

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDFS +A +TS +PS+ +C Y
Sbjct  436  NPWNCDFSQSAALTSANPSYATCVY  460



>gb|KJB32496.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=456

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ++++Y CGQG+DC PIQPGGACF PNTV SHAAY MN +YQ   + 
Sbjct  368  WCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKN  427

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +P++ +C Y
Sbjct  428  PWNCDFSQTATLTSQNPTYNNCIY  451



>ref|XP_007042210.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOX98041.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=459

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQA+++Y C QG+DC PIQPGGACF PNTV SHAAY MN +YQT G+ 
Sbjct  371  WCVPKAGISDAQLQASLDYACSQGIDCGPIQPGGACFEPNTVASHAAYAMNLYYQTSGKN  430

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS TAT+TS +PS+ +C Y
Sbjct  431  LWNCDFSQTATVTSQNPSYNNCIY  454



>emb|CDP07525.1| unnamed protein product [Coffea canephora]
Length=467

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQAN++Y C  G DC  IQPGGACF PNT+ SHA Y MN  YQT GR 
Sbjct  378  WCVPKAGVSDAQLQANLDYACSHGTDCSSIQPGGACFEPNTIASHATYAMNLLYQTAGRN  437

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+++T+PS+ +C+Y
Sbjct  438  PWNCDFSQTATLSTTNPSYNACQY  461



>ref|XP_004499144.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Cicer arietinum]
Length=485

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   TDAQLQAN++Y CGQG+DC  IQPGGACF PNT+ +HAAY MN FY T G+ 
Sbjct  397  WCVPKPGVTDAQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTVGQN  456

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+T+ +PS+ SC Y
Sbjct  457  PLTCDFSQTATLTTNNPSYNSCIY  480



>ref|XP_008220789.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Prunus mume]
Length=480

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D+QLQANI+YVCG G DC PIQ GGACF PNTV+SHAAY MN  YQT G  
Sbjct  392  WCLPKAGVSDSQLQANIDYVCGHGFDCSPIQQGGACFEPNTVQSHAAYAMNLLYQTAGGD  451

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT++S +PS+  C Y
Sbjct  452  PLNCDFSQTATLSSNNPSYDGCHY  475



>ref|XP_007222662.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
 gb|EMJ23861.1| hypothetical protein PRUPE_ppa004976mg [Prunus persica]
Length=483

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D+QLQANI+YVCG G DC PIQ GGACF PNTV+SHAAY MN  YQT G  
Sbjct  395  WCLPKAGVSDSQLQANIDYVCGHGFDCSPIQQGGACFEPNTVQSHAAYAMNLLYQTAGGD  454

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT++S +PS+  C Y
Sbjct  455  PLNCDFSQTATLSSNNPSYDGCHY  478



>dbj|BAD94999.1| beta-1,3-glucanase - like protein [Arabidopsis thaliana]
Length=149

 Score =   117 bits (292),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 9/124 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L+                +P         GK+C  ++ AT+ QLQ +IN+V
Sbjct  35   FSPVYDVGLLR---------NGQGGGGRPALPAPSTAGGKWCVARSGATNTQLQDSINWV  85

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CGQGVDC+PIQ GG+CFNP+++R+HA+++MN ++Q+ GR    C+FSGT  I   +PS+G
Sbjct  86   CGQGVDCKPIQAGGSCFNPSSLRTHASFVMNAYFQSHGRTDGACNFSGTGMIVGNNPSNG  145

Query  294  SCKY  283
            +CKY
Sbjct  146  ACKY  149



>ref|XP_002510373.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF52560.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=461

 Score =   122 bits (306),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQ QAN++Y CGQG+DC PIQPGGACF PNTV SHAAY MN  YQT  + 
Sbjct  373  WCVPKEGVSDAQFQANLDYACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLLYQTSEKN  432

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TA ++S +PS+ SC Y
Sbjct  433  PSTCDFSQTAILSSENPSYNSCTY  456



>emb|CDP05033.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 76/125 (61%), Gaps = 1/125 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGK-FCTPKAAATDAQLQANINY  478
             TPVY++GIL+       P           P P P    K +C PK  A +  LQ N++Y
Sbjct  335  MTPVYDIGILRPTAKANFPSYPTPQAVPVNPSPIPASGAKRWCLPKTGAKEDTLQKNLDY  394

Query  477  VCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            VCG G+DC+PIQ GGAC+ PNTVR HAAY MN +YQ  GR  + CDF GT  IT  DPS+
Sbjct  395  VCGLGMDCKPIQEGGACYLPNTVRGHAAYAMNAYYQATGRNDYACDFGGTGAITKLDPSY  454

Query  297  GSCKY  283
            GSCKY
Sbjct  455  GSCKY  459



>gb|KJB34916.1| hypothetical protein B456_006G090600 [Gossypium raimondii]
Length=448

 Score =   122 bits (305),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ++++Y CGQG+DC PIQPGGACF PN V SHAAY MN +YQ   + 
Sbjct  360  WCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNIVASHAAYAMNLYYQNSAKN  419

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+ +C Y
Sbjct  420  PWNCDFSQTATLTSQNPSYNNCIY  443



>ref|XP_011037536.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
 ref|XP_011037537.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQA+++Y CGQG+DC PIQPGGACF PNTV SHA+Y MN +YQ   + 
Sbjct  368  WCVPKAGVSDAQLQASLDYACGQGIDCGPIQPGGACFEPNTVASHASYAMNLYYQKSAKN  427

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+T  +PS+  C Y
Sbjct  428  PWNCDFSETATLTFKNPSYNGCTY  451



>ref|XP_006384505.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
 gb|ABK95331.1| unknown [Populus trichocarpa]
 gb|ERP62302.1| hypothetical protein POPTR_0004s16120g [Populus trichocarpa]
Length=456

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQA+++Y CGQG+DC PIQPGGACF PNTV SHA+Y MN +YQ   + 
Sbjct  368  WCVPKAGVSDAQLQASLDYACGQGIDCGPIQPGGACFEPNTVASHASYAMNLYYQKSAKN  427

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+T  +PS+  C Y
Sbjct  428  PWNCDFSETATLTFKNPSYNGCTY  451



>ref|XP_010942826.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Elaeis guineensis]
Length=464

 Score =   122 bits (305),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C PK  ATD +LQ N++Y CGQ GVDC PIQPGGAC+ PNTVRSHAAY MN  YQ  GR
Sbjct  376  WCVPKEGATDEELQTNLDYACGQAGVDCGPIQPGGACYEPNTVRSHAAYAMNQLYQMSGR  435

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS +PS+ +C Y
Sbjct  436  NPWNCDFQQSATLTSANPSYSTCVY  460



>ref|XP_008802734.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=451

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 81/127 (64%), Gaps = 10/127 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVYNVG+ K                   P P+ G + K+C PK+ A++A LQA+INYV
Sbjct  334  LTPVYNVGLTK---------TPSGGRGGAAPAPSVGSSRKWCVPKSGASEAALQADINYV  384

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            C  G VDC+PIQ GGACF PNT+++HAA+ MN +YQ  GR  F CDFS +A IT+ DPS 
Sbjct  385  CSSGIVDCKPIQEGGACFLPNTIQAHAAFAMNAYYQAAGRHDFNCDFSNSAVITTADPSL  444

Query  297  GSCKYLS  277
            GSCK  S
Sbjct  445  GSCKLSS  451



>emb|CAN61862.1| hypothetical protein VITISV_043447 [Vitis vinifera]
Length=479

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQLQAN++Y C QG+DC PIQPGGACF PNTV SHAAY MN  YQ+ G+ 
Sbjct  393  WCVPKTGVSDAQLQANLDYACSQGIDCTPIQPGGACFEPNTVASHAAYAMNLLYQSSGKN  452

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF+ TAT+TS++PS+ +C +
Sbjct  453  SWNCDFTQTATLTSSNPSYNACTF  476



>gb|AFS50098.1| glucan endo-1,3-beta-glucosidase [Elaeis guineensis]
Length=465

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C PK  ATD +LQ N++Y CGQ GVDC PIQPGGAC+ PNTVRSHAAY MN  YQ  GR
Sbjct  377  WCVPKEGATDEELQTNLDYACGQAGVDCGPIQPGGACYEPNTVRSHAAYAMNQLYQMSGR  436

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS +PS+ +C Y
Sbjct  437  NPWNCDFQQSATLTSANPSYSTCVY  461



>ref|XP_008377317.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=459

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C PK+  +DAQLQAN++Y CG G+DC  IQPGGACF+PNTV SHAAY MN +Y T G 
Sbjct  370  QWCVPKSGVSDAQLQANLDYACGHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGT  429

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P  CDFS TA +TS++PS+ +C Y
Sbjct  430  VPLNCDFSQTAMLTSSNPSYNACSY  454



>ref|XP_011088385.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Sesamum 
indicum]
Length=506

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P+   +DAQLQAN++Y CGQG+DC PIQPGGACF P TV SHAAY MN  YQ+ GR 
Sbjct  418  WCVPRPGISDAQLQANLDYACGQGIDCSPIQPGGACFEPTTVASHAAYAMNLLYQSAGRN  477

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF  TATIT+T+PS+ +C Y
Sbjct  478  SWNCDFLHTATITTTNPSYNACVY  501



>ref|XP_009374179.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Pyrus x bretschneideri]
Length=459

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C PK+  +DAQLQAN++Y CG G+DC  IQPGGACF+PNTV SHAAY MN +Y T G 
Sbjct  370  QWCVPKSGVSDAQLQANLDYACGHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGT  429

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P  CDFS TA +TS++PS+ +C Y
Sbjct  430  VPLNCDFSQTAMLTSSNPSYNACSY  454



>ref|XP_009357727.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=454

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K+AA++  LQ+NI+YVC  GVDC+ IQPGGACF+ N VR+ A+YLMN +YQ  GR
Sbjct  369  KWCVAKSAASNQALQSNIDYVCSTGVDCKSIQPGGACFD-NDVRARASYLMNAYYQVNGR  427

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDFSG+  IT+TDPSHGSCKY
Sbjct  428  HDFNCDFSGSGQITTTDPSHGSCKY  452



>ref|XP_008371690.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=454

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 68/87 (78%), Gaps = 1/87 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K+AA++  LQ+NI+YVC  GVDC+ IQPGGACF+ N VR+ A+YLMN +YQ  GR
Sbjct  369  KWCVAKSAASNQALQSNIDYVCSTGVDCKSIQPGGACFD-NDVRARASYLMNAYYQANGR  427

Query  357  QPFQCDFSGTATITSTDPSHGSCKYLS  277
              F CDFSG+  IT+TDPSHGSCKY S
Sbjct  428  HDFNCDFSGSGQITTTDPSHGSCKYNS  454



>ref|XP_008457482.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=573

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 77/124 (62%), Gaps = 7/124 (6%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VGIL+         P   P              ++C PK  A+D  LQ NI+YV
Sbjct  410  FTPVYDVGILR-------NPPTMGPTSPVGGPKPSDEGRRWCVPKTDASDEALQKNIDYV  462

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC PIQ GGAC++PNTVRSHA+Y MN ++QT GR  F CDF+ TA +T TDPS+ 
Sbjct  463  CSSGVDCGPIQEGGACYDPNTVRSHASYAMNAYFQTAGRHDFNCDFNHTAILTFTDPSYE  522

Query  294  SCKY  283
            +C Y
Sbjct  523  ACSY  526



>ref|XP_008236880.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Prunus mume]
Length=463

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQAN++Y CG G+DC  IQPGGACF+PNTV SHAAY MN +Y T G  
Sbjct  375  WCVPKAGVSDAQLQANLDYACGHGIDCSAIQPGGACFDPNTVASHAAYAMNLYYHTVGTI  434

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+ S++PS+ +C Y
Sbjct  435  PLNCDFSQTATLISSNPSYNACTY  458



>ref|XP_003631648.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Vitis vinifera]
 emb|CBI32582.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQLQAN++Y C QG+DC PIQPGGACF PNTV SHAAY MN  YQ+ G+ 
Sbjct  404  WCVPKTGVSDAQLQANLDYACSQGIDCTPIQPGGACFEPNTVASHAAYAMNLLYQSSGKN  463

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF+ TAT+TS++PS+ +C +
Sbjct  464  SWNCDFTQTATLTSSNPSYNACTF  487



>ref|XP_010096392.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXB63955.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=467

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQANI+Y CG GVDC  IQ GGACF PNTV SHA Y MN  YQT GR 
Sbjct  379  WCVPKAGVSDAQLQANIDYACGHGVDCSAIQHGGACFEPNTVASHATYAMNLLYQTAGRN  438

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+++ +PS+  C Y
Sbjct  439  PWNCDFSQTATLSTNNPSYNGCSY  462



>ref|XP_002878033.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54292.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 84/124 (68%), Gaps = 9/124 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L+                +P         GK+C  ++AAT+AQLQ NIN+V
Sbjct  335  FSPVYDVGLLR---------NGQGGGGRPALPAPSTAGGKWCVARSAATNAQLQDNINWV  385

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CGQGVDC+PIQ GG+CFNP+++R+HA+++MN ++Q+ GR    C+FSGT  +   +PS+G
Sbjct  386  CGQGVDCKPIQAGGSCFNPSSLRTHASFVMNAYFQSHGRTDGACNFSGTGMVVGNNPSNG  445

Query  294  SCKY  283
            +CKY
Sbjct  446  ACKY  449



>ref|XP_004169494.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
Length=478

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQLQAN++Y CG+G+DC  IQPGGACF PNT+ SHAAY MN F+Q  GR 
Sbjct  390  WCLPKGGVSDAQLQANLDYACGRGLDCSAIQPGGACFEPNTIASHAAYAMNLFFQNGGRD  449

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS +AT++S +PS+  C Y
Sbjct  450  PWTCDFSQSATLSSNNPSYNGCNY  473



>ref|XP_004499143.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Cicer arietinum]
Length=520

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   TDAQLQAN++Y CGQG+DC  IQPGGACF PNT+ +HAAY MN FY T G+ 
Sbjct  397  WCVPKPGVTDAQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTVGQN  456

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+T+ +PS  SC +
Sbjct  457  PLTCDFSQTATLTTNNPSKSSCDF  480



>gb|ACM45718.1| endo-1,3-beta-glucanase [Pyrus pyrifolia]
Length=454

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 67/85 (79%), Gaps = 1/85 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K+AA++  LQ+NI+YVC  GVDC+ IQPGGACF+ N VR+ A+YLMN +YQ  GR
Sbjct  369  KWCVVKSAASNQALQSNIDYVCSTGVDCKSIQPGGACFD-NDVRARASYLMNAYYQANGR  427

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDFSG+  IT+TDPSHGSCKY
Sbjct  428  HDFDCDFSGSGQITTTDPSHGSCKY  452



>ref|XP_004147788.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Cucumis sativus]
 gb|KGN59949.1| hypothetical protein Csa_3G855430 [Cucumis sativus]
Length=478

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQLQAN++Y CG+G+DC  IQPGGACF PNT+ SHAAY MN F+Q  GR 
Sbjct  390  WCLPKGGVSDAQLQANLDYACGRGLDCSAIQPGGACFEPNTIASHAAYAMNLFFQNGGRD  449

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS +AT++S +PS+  C Y
Sbjct  450  PWTCDFSQSATLSSNNPSYNGCNY  473



>ref|XP_008466580.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Cucumis melo]
Length=478

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQLQAN++Y CG+G+DC  IQPGGACF PNT+ SHAAY MN F+Q  GR 
Sbjct  390  WCLPKGGVSDAQLQANLDYACGRGLDCSAIQPGGACFEPNTIASHAAYAMNLFFQNGGRD  449

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS +AT++S +PS+  C Y
Sbjct  450  PWTCDFSQSATLSSNNPSYDGCNY  473



>gb|KEH40124.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=486

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  TD QLQAN++Y CGQG+DC  IQPGGACF PNT+ +HAAY MN FY T G+ 
Sbjct  391  WCVPKAGLTDVQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTVGQN  450

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS +PS  SC +
Sbjct  451  PLTCDFSQTATLTSNNPSKFSCGF  474



>ref|XP_006386924.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
 gb|ERP64721.1| hypothetical protein POPTR_0002s26290g [Populus trichocarpa]
Length=463

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  +DAQLQ N++Y CG+G+DC PI+PGGACF PNT+ SHAAY MN FYQ   + 
Sbjct  373  WCVPKSGVSDAQLQDNLDYACGRGIDCSPIEPGGACFEPNTLASHAAYAMNLFYQASDKN  432

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
            P  CDFS +AT++S +PS+ +C Y S
Sbjct  433  PLNCDFSQSATLSSNNPSYNACTYPS  458



>ref|XP_008233624.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=478

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K  AT+  LQANI+YVCG+G+DC+PIQPGG CF+ N V++ A+YLMN +YQ  GR
Sbjct  393  KWCVAKPGATNQALQANIDYVCGKGIDCKPIQPGGTCFD-NDVKARASYLMNAYYQANGR  451

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDFS T  +TS DPSHGSCKY
Sbjct  452  HDFNCDFSKTGQLTSADPSHGSCKY  476



>gb|KDP46246.1| hypothetical protein JCGZ_10086 [Jatropha curcas]
Length=459

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  +DAQLQA+++Y CGQG+DC PIQPGGACF PN + SHAAY MN +YQ   + 
Sbjct  371  WCMPKSGVSDAQLQASLDYACGQGIDCGPIQPGGACFEPNNLVSHAAYAMNLYYQASSKN  430

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+  C Y
Sbjct  431  PWNCDFSQTATLTSKNPSYNGCVY  454



>ref|XP_010412786.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=135

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 82/125 (66%), Gaps = 10/125 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L           +     +P         GK+C  ++ ATD QLQ NIN+V
Sbjct  20   FSPVYDVGLL---------LKKQGGGGRPALPAPSTAGGKWCVARSGATDKQLQDNINWV  70

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            CGQG VDC+PIQ GG+CFNP++VR+HA+++MN ++Q+ GR    C+FSGT  +   +PS+
Sbjct  71   CGQGGVDCKPIQAGGSCFNPSSVRTHASFVMNAYFQSHGRTDGTCNFSGTGMVVGNNPSN  130

Query  297  GSCKY  283
            G+CK+
Sbjct  131  GACKF  135



>ref|XP_009374190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=459

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C PK+  +DAQLQAN++Y CG G+DC  IQPGG+CF+PNTV SHAAY MN +Y T G 
Sbjct  370  QWCVPKSGVSDAQLQANLDYACGHGIDCSAIQPGGSCFDPNTVASHAAYAMNLYYHTVGT  429

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P  CDFS TA +TS++PS+ +C Y
Sbjct  430  IPLNCDFSQTAMLTSSNPSYNACSY  454



>ref|XP_002532848.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF29526.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=488

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 81/124 (65%), Gaps = 10/124 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+VG+L+           P       P P+  +  K+C PK+ A++  LQ NI+YV
Sbjct  331  FTPVYDVGVLR----------NPRAKGPTAPAPSSSQGKKWCVPKSDASEDALQKNIDYV  380

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDCR IQ GG CF+PNTVRSHA+Y MN +YQT GRQ + CDF+ T  +T++DPS+ 
Sbjct  381  CSTGVDCRAIQAGGPCFDPNTVRSHASYAMNAYYQTFGRQDYNCDFNHTGRLTNSDPSYE  440

Query  294  SCKY  283
            +C Y
Sbjct  441  ACSY  444



>ref|XP_009804916.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
sylvestris]
Length=480

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C PK    DA+LQAN++Y C Q G+DC PIQ GGACF PNTV SHAAY MN  YQT GR
Sbjct  391  WCMPKPGTPDAELQANLDYACSQAGIDCTPIQAGGACFEPNTVASHAAYAMNLLYQTAGR  450

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDFS TA +TST+PS+G C Y
Sbjct  451  NPWNCDFSQTAALTSTNPSYGGCTY  475



>ref|XP_008377425.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Malus domestica]
Length=474

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/84 (63%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D+QLQANI+YVCG G DC PIQPGG+CF PN V+SHAAY MN  YQT G  
Sbjct  386  YCVPKAGVSDSQLQANIDYVCGSGFDCTPIQPGGSCFEPNNVKSHAAYAMNLLYQTTGGD  445

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDFS TAT++S +PS+ SC Y
Sbjct  446  TQNCDFSQTATLSSNNPSYDSCNY  469



>ref|XP_007013797.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31416.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
Length=483

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 79/125 (63%), Gaps = 7/125 (6%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             +P+YNVG+L+                 P P         +C P+  AT AQLQ+N++Y 
Sbjct  366  LSPIYNVGLLR-------HGQSVPTPTNPSPSTPAPSGKSYCVPQKEATYAQLQSNLDYA  418

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CGQG+DC PIQPGG C+ PNT++SHAA+ MN++Y+TKG+    CDF+GT  IT+ DPS+ 
Sbjct  419  CGQGIDCTPIQPGGLCYEPNTIQSHAAFAMNSYYRTKGQSYLSCDFAGTGQITAVDPSYI  478

Query  294  SCKYL  280
            +C YL
Sbjct  479  NCHYL  483



>ref|XP_009406752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C P+  ATDA+LQAN++Y CGQ GVDCRPIQ GGAC+ PNTVRSHAAY MN FYQ  GR
Sbjct  374  WCVPREGATDAELQANLDYACGQPGVDCRPIQEGGACYLPNTVRSHAAYAMNQFYQASGR  433

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              ++C FS +A +T+ +PS+ +C Y
Sbjct  434  NSWECGFSDSAVLTTDNPSYATCVY  458



>gb|KJB53907.1| hypothetical protein B456_009G010800 [Gossypium raimondii]
Length=443

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 57/126 (45%), Positives = 82/126 (65%), Gaps = 12/126 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TP+Y+VG+L+              +      P P  +  FC PK   ++ QLQ+N++Y 
Sbjct  329  LTPIYDVGLLR-----------RGQSAPTPATPAPSSSKNFCVPKVDVSNTQLQSNLDYA  377

Query  474  CGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            CGQ G+DC PIQPGGAC+ PNT+R+HAA+ MNT+Y+TKG   F CDF+GT  IT+ DPS+
Sbjct  378  CGQEGIDCTPIQPGGACYEPNTLRAHAAFAMNTYYRTKGESYFSCDFAGTGQITTVDPSY  437

Query  297  GSCKYL  280
             +C+++
Sbjct  438  PNCRFV  443



>ref|XP_010107844.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
 gb|EXC17244.1| Glucan endo-1,3-beta-glucosidase 7 [Morus notabilis]
Length=479

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C PKA  +DAQLQ N++Y C   +DC  IQPGGACF PNTV SHAAY MN +YQT G+
Sbjct  390  QWCVPKAGVSDAQLQTNLDYACSHSIDCGLIQPGGACFEPNTVASHAAYAMNLYYQTYGK  449

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDFS TAT+TS +PS+ +C Y
Sbjct  450  NPWNCDFSQTATVTSANPSYNACNY  474



>ref|XP_010065396.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Eucalyptus 
grandis]
 gb|KCW62850.1| hypothetical protein EUGRSUZ_G00445 [Eucalyptus grandis]
Length=470

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  +DAQLQA+++Y C   +DC PIQPGGACF+PNT+ SHAA+ MN +YQT GR 
Sbjct  382  WCVPKSGVSDAQLQASLDYACSNNIDCSPIQPGGACFDPNTIASHAAFAMNLYYQTLGRN  441

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+T+ +PS+  C Y
Sbjct  442  PWNCDFSQTATLTTNNPSYNGCVY  465



>ref|XP_004516968.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=450

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 74/123 (60%), Gaps = 3/123 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVYN GIL+       P          +         K+C PKA A++  LQANINYV
Sbjct  330  FTPVYNSGILR---NGQKPVAPKRGGGGGQSPSPVVGGQKWCVPKAEASNEALQANINYV  386

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QGVDC+PIQPGG C+ PN V++ A Y MN +YQ  G+  F CDFS +  +TS +PSH 
Sbjct  387  CSQGVDCKPIQPGGVCYAPNNVKALATYAMNAYYQANGKHDFNCDFSHSGVVTSINPSHD  446

Query  294  SCK  286
            +C+
Sbjct  447  NCR  449



>gb|KHN20071.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=445

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  KA  +DAQLQANI+Y C QG+DC PIQPGG+CF PNT+ SHAA+ MN +YQT G+ 
Sbjct  357  WCVAKAGVSDAQLQANIDYACSQGIDCGPIQPGGSCFEPNTIASHAAFAMNLYYQTSGKN  416

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS +AT+TS +PS+ +C Y
Sbjct  417  QWNCDFSQSATLTSQNPSYNACIY  440



>ref|XP_010447074.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  ATD QLQ+++++ CGQG+DC PIQPGGACF PN V SHAAY MN ++Q   +Q
Sbjct  371  WCVPKKGATDDQLQSSLDWACGQGIDCGPIQPGGACFEPNNVASHAAYAMNMYFQKSPKQ  430

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS +PS+ SC Y
Sbjct  431  PTDCDFSKTATVTSQNPSYNSCVY  454



>ref|XP_006581120.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=480

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  KA  +DAQLQANI+Y C QG+DC PIQPGG+CF PNT+ SHAA+ MN +YQT G+ 
Sbjct  392  WCVAKAGVSDAQLQANIDYACSQGIDCGPIQPGGSCFEPNTIASHAAFAMNLYYQTSGKN  451

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS +AT+TS +PS+ +C Y
Sbjct  452  QWNCDFSQSATLTSQNPSYNACIY  475



>gb|KJB32499.1| hypothetical protein B456_005G243100 [Gossypium raimondii]
Length=484

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 68/88 (77%), Gaps = 2/88 (2%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ++++Y CGQG+DC PIQPGGACF PNTV SHAAY MN +YQ   + 
Sbjct  368  WCVPKAGISDAQLQSSLDYACGQGIDCSPIQPGGACFEPNTVASHAAYAMNLYYQNSAKN  427

Query  354  PFQCDFSGTATITSTDPS-HGSCK-YLS  277
            P+ CDFS TAT+TS +PS + S K YLS
Sbjct  428  PWNCDFSQTATLTSQNPSKYTSLKLYLS  455



>ref|XP_010432409.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Camelina 
sativa]
Length=507

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  ATD QLQ+++++ CGQG+DC PIQPGGACF PN V SHAAY MN ++Q   +Q
Sbjct  371  WCVPKKGATDDQLQSSLDWACGQGIDCGPIQPGGACFEPNNVASHAAYAMNMYFQKSPKQ  430

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS +PS+ SC Y
Sbjct  431  PTDCDFSKTATVTSQNPSYNSCVY  454



>gb|KDO72847.1| hypothetical protein CISIN_1g0375832mg, partial [Citrus sinensis]
Length=458

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 75/121 (62%), Gaps = 4/121 (3%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprp----npnpqpkpkptpgrtGKFCTPKAAATDAQLQAN  487
            FTPVY+VGIL+ + A               P  KP        K+C PK+ A+DA LQAN
Sbjct  338  FTPVYDVGILRNKQAQGPAKAPGGRPPTEAPVAKPPSGAVTGRKWCVPKSDASDAALQAN  397

Query  486  INYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTD  307
            I+YVCG GVDC+PIQ GG CFNPN VRSHAAY MN FYQ  G   + CDF+ T  +TS D
Sbjct  398  IDYVCGTGVDCKPIQAGGPCFNPNNVRSHAAYAMNAFYQANGLHDYACDFNKTGVLTSAD  457

Query  306  P  304
            P
Sbjct  458  P  458



>gb|AES74164.2| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=325

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ NI+Y C QG+DC PI PGGACF PNTV SHAA++MN +YQT GR 
Sbjct  237  WCVPKAGVSDAQLQNNIDYACSQGIDCGPILPGGACFEPNTVASHAAFVMNLYYQTFGRN  296

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF+ TA +TS +PS+ +C Y
Sbjct  297  QWNCDFTQTAKLTSQNPSYNACNY  320



>ref|XP_006581121.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Glycine max]
Length=459

 Score =   119 bits (298),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  KA  +DAQLQANI+Y C QG+DC PIQPGG+CF PNT+ SHAA+ MN +YQT G+ 
Sbjct  371  WCVAKAGVSDAQLQANIDYACSQGIDCGPIQPGGSCFEPNTIASHAAFAMNLYYQTSGKN  430

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS +AT+TS +PS+ +C Y
Sbjct  431  QWNCDFSQSATLTSQNPSYNACIY  454



>ref|XP_007009341.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOY18151.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=440

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 79/124 (64%), Gaps = 12/124 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVYNVG+L+            N  P P+P      + KFC PK   TDAQLQ+N++Y 
Sbjct  328  FTPVYNVGVLR------------NGQPMPRPAIRAPSSKKFCVPKPGVTDAQLQSNLDYA  375

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG +C PIQPGG C  P TVRS A + MN++Y+ KG+    CDFSGTA IT+ DPS+G
Sbjct  376  CSQGANCSPIQPGGPCAQPGTVRSRATFAMNSYYRNKGQADNACDFSGTAQITTADPSYG  435

Query  294  SCKY  283
            +C Y
Sbjct  436  NCHY  439



>ref|XP_009343476.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=479

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K  ATD  LQ+NI+YVCG GVDC+ +QPGGACF+ N VR+ A+YLMNT+YQ  G 
Sbjct  394  KWCVAKPGATDQVLQSNIDYVCGTGVDCKSVQPGGACFD-NNVRARASYLMNTYYQANGL  452

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDFSG+  IT+TDPS GSCKY
Sbjct  453  HDFNCDFSGSGQITTTDPSRGSCKY  477



>ref|XP_007136171.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
 gb|ESW08165.1| hypothetical protein PHAVU_009G024000g [Phaseolus vulgaris]
Length=457

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D QLQANI+Y C QG+DC PIQPGGACF PNTV SHAA+ MN +YQT  + 
Sbjct  369  WCVPKAGISDDQLQANIDYACSQGIDCGPIQPGGACFEPNTVASHAAFAMNLYYQTSAKN  428

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDFS +AT+TS +PS+ +C Y
Sbjct  429  QWNCDFSQSATLTSQNPSYNACIY  452



>ref|XP_003603912.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES74163.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=459

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ NI+Y C QG+DC PI PGGACF PNTV SHAA++MN +YQT GR 
Sbjct  371  WCVPKAGVSDAQLQNNIDYACSQGIDCGPILPGGACFEPNTVASHAAFVMNLYYQTFGRN  430

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF+ TA +TS +PS+ +C Y
Sbjct  431  QWNCDFTQTAKLTSQNPSYNACNY  454



>ref|XP_011035318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=504

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVY+VG+L+         P            +PGR  ++C PK+ A+D  LQ NI+YV
Sbjct  343  LTPVYDVGVLR---NDKALAPTSGTAADAPSSSSPGRERRWCVPKSDASDDALQKNIDYV  399

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC+PIQ GG CF P+TV+SHA+Y MN FYQ  GR  F CDF+ T  +TS DPS+ 
Sbjct  400  CSNGVDCKPIQQGGPCFVPDTVKSHASYAMNAFYQASGRHDFDCDFNHTGVLTSIDPSYE  459

Query  294  SCKY  283
            +C Y
Sbjct  460  ACDY  463



>ref|XP_008461659.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=449

 Score =   119 bits (297),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C P++ A    LQ NI+YVC   VDCRPIQ GGACF PN VRSHAAY+MN +YQT GR
Sbjct  363  KWCVPRSGAAVEALQKNIDYVCSSKVDCRPIQAGGACFLPNDVRSHAAYVMNAYYQTSGR  422

Query  357  QPFQCDFSGTATITSTDPSHGSCKYLS  277
              + CDF  T  +T+ +PSHG C Y+S
Sbjct  423  HDYNCDFGQTGVLTTVNPSHGGCVYVS  449



>gb|AIR93908.1| glucanase [Cicer arietinum]
Length=454

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 64/82 (78%), Gaps = 0/82 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +D QLQ+NI+Y CGQG+DC PI+PGGACF PNTV SHAA++MN +YQT GR 
Sbjct  355  WCIPKAGVSDTQLQSNIDYACGQGIDCGPIKPGGACFEPNTVASHAAFVMNLYYQTFGRN  414

Query  354  PFQCDFSGTATITSTDPSHGSC  289
             + CDFS TAT+TS +PS  S 
Sbjct  415  QWNCDFSQTATLTSQNPSKYSL  436



>ref|XP_008362701.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Malus domestica]
Length=473

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K  ATD  LQ+NI+Y+CG GVDC+ +QPGGACF+ N VR+ A+YLMNT+YQ  G 
Sbjct  388  KWCVAKPGATDQALQSNIDYICGTGVDCKSVQPGGACFD-NNVRARASYLMNTYYQANGL  446

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDFSG+  IT+TDPS GSCKY
Sbjct  447  HDFNCDFSGSGQITTTDPSRGSCKY  471



>gb|KJB73919.1| hypothetical protein B456_011G260900 [Gossypium raimondii]
Length=109

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            KFC PK  ATDAQLQ N++Y CGQG+DCRPIQ GG C  P TVRS AA+ MN+++++K  
Sbjct  24   KFCVPKPEATDAQLQNNLDYACGQGIDCRPIQAGGVCVEPATVRSRAAFAMNSYFKSKLG  83

Query  357  QPFQCDFSGTATITSTDPSHGSCKYL  280
                CDF GT  +T+ DPS+G+C+Y+
Sbjct  84   VDSACDFGGTGQLTTVDPSYGNCRYV  109



>ref|XP_003603913.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=477

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DAQLQ NI+Y C QG+DC PI PGGACF PNTV SHAA++MN +YQT GR 
Sbjct  389  WCVPKAGVSDAQLQNNIDYACSQGIDCGPILPGGACFEPNTVASHAAFVMNLYYQTFGRN  448

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF+ TA +TS +PS+ +C Y
Sbjct  449  QWNCDFTQTAKLTSQNPSYNACNY  472



>ref|XP_010043555.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
 gb|KCW85569.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=501

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 76/125 (61%), Gaps = 1/125 (1%)
 Frame = -1

Query  654  FTPVYNVGILK-AqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINY  478
             TPVY+VGIL+        P             P      K+C P++ A+D  LQANI+Y
Sbjct  334  LTPVYDVGILRNEPAGGPTPASPSPTAQPSPTAPPTSSGKKWCVPRSDASDQALQANIDY  393

Query  477  VCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            VC   VDC+PIQ GGACF+PNTVRSHAAY MN +YQ+ G+  + CDF  T  +T+ DPS+
Sbjct  394  VCSAQVDCKPIQTGGACFDPNTVRSHAAYAMNAYYQSMGQHDYDCDFDKTGVVTAVDPSY  453

Query  297  GSCKY  283
             +C Y
Sbjct  454  ETCTY  458



>ref|XP_011015294.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=496

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 77/124 (62%), Gaps = 3/124 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVY+VG+L+         P            +PGR  ++C PK+ A+D  LQ NI+YV
Sbjct  335  LTPVYDVGVLR---NDKALAPTSGTAADAPSSSSPGREKQWCVPKSDASDDSLQKNIDYV  391

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC+PIQ GG CF P+TV+SHA+Y MN FYQ  GR  F CDF+ T  +TS DPS+ 
Sbjct  392  CSNGVDCKPIQQGGPCFVPDTVKSHASYAMNAFYQASGRHDFDCDFNHTGVLTSIDPSYE  451

Query  294  SCKY  283
            +C Y
Sbjct  452  ACDY  455



>gb|AAX95357.1| glucan endo-1,3-beta-glucosidase precursor (ec 3.2.1.39) ((1->3)-beta-glucan 
endohydrolase) ((1->3)-beta-glucanase) (beta-1,3-endoglucanase) 
[Oryza sativa Japonica Group]
Length=510

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 86/126 (68%), Gaps = 1/126 (1%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTP+Y++G+L+       P+P PNP+P P PKP P   GK+C PKA A+D  LQ NINY 
Sbjct  340  FTPIYDLGLLRQSSDSGAPNPSPNPSPNPSPKPAPSGGGKWCVPKAGASDTDLQNNINYA  399

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG  VDC+PIQ GGACF+PN V+SHAA++MN FYQ  GR  + CDF GT  +TS DP+  
Sbjct  400  CGY-VDCKPIQSGGACFDPNNVQSHAAFVMNAFYQANGRHDYDCDFKGTGAVTSNDPTAL  458

Query  294  SCKYLS  277
                LS
Sbjct  459  HITRLS  464



>ref|XP_008681422.1| PREDICTED: uncharacterized protein LOC100273173 isoform X2 [Zea 
mays]
Length=463

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C  +A A+DA+LQA+++Y C Q GVDC  IQPGGACF PNTVR+HAAY +N  YQ  GR
Sbjct  374  WCVARAGASDAELQADLDYACSQVGVDCSAIQPGGACFEPNTVRAHAAYAVNQLYQAAGR  433

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS DPS+G+C Y
Sbjct  434  HPWNCDFRASATLTSDDPSYGACVY  458



>ref|XP_004293211.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Fragaria vesca 
subsp. vesca]
Length=486

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/86 (63%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  A++ QLQANI+YVCG G DC PIQPGGACF PN V SHAAY MN  YQT G  
Sbjct  392  WCLPKKGASETQLQANIDYVCGHGFDCSPIQPGGACFEPNNVASHAAYAMNILYQTAGHD  451

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
               CDFS TAT++S +PS+ SC Y S
Sbjct  452  AQNCDFSQTATLSSNNPSYDSCNYPS  477



>ref|NP_001141090.1| uncharacterized protein LOC100273173 [Zea mays]
 gb|ACF85381.1| unknown [Zea mays]
 gb|AFW68016.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=324

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C  +A A+DA+LQA+++Y C Q GVDC  IQPGGACF PNTVR+HAAY +N  YQ  GR
Sbjct  235  WCVARAGASDAELQADLDYACSQVGVDCSAIQPGGACFEPNTVRAHAAYAVNQLYQAAGR  294

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS DPS+G+C Y
Sbjct  295  HPWNCDFRASATLTSDDPSYGACVY  319



>gb|KHG05533.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=443

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 81/126 (64%), Gaps = 12/126 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TP+Y+VG+L+              +      P P  +  FC PK   ++ QLQ+N++Y 
Sbjct  329  LTPIYDVGLLR-----------RGQSAPTPATPAPSSSKNFCVPKVDVSNTQLQSNLDYA  377

Query  474  CGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            CGQ G+DC PIQPGGAC+ PNT+R+HAA+ MNT+Y+ KG   F CDF+GT  IT+ DPS+
Sbjct  378  CGQEGIDCTPIQPGGACYEPNTLRAHAAFAMNTYYRIKGESYFSCDFAGTGQITTVDPSY  437

Query  297  GSCKYL  280
             +C+++
Sbjct  438  PTCRFV  443



>ref|XP_010499944.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=115

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQ NIN+ C QGVDCRPI+PGG+CF P+T+ +HA+Y+MN +YQ+ GR 
Sbjct  30   WCIATLTATNAQLQDNINFACSQGVDCRPIRPGGSCFVPDTLVNHASYVMNAYYQSHGRT  89

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  C F  T T  +TDPS+GSC Y
Sbjct  90   PEACSFKNTGTFAATDPSYGSCVY  113



>ref|XP_009796709.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Nicotiana sylvestris]
Length=436

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 73/124 (59%), Gaps = 13/124 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VGIL+                   P   P    K+C P+  ATDA LQ NI++V
Sbjct  324  FSPVYDVGILR-------------NAQTSPPAMAPEVDKKWCVPRTDATDAALQXNIDFV  370

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  G+DC+PIQ GG C+ PNTVR+HAAY MN +YQ  GR+   CDF  T  +T +DPS+ 
Sbjct  371  CSSGIDCQPIQDGGPCYEPNTVRAHAAYAMNAYYQANGRKDLDCDFINTGVVTISDPSYE  430

Query  294  SCKY  283
             C Y
Sbjct  431  ECTY  434



>ref|XP_010060941.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 isoform X1 [Eucalyptus 
grandis]
 gb|KCW67839.1| hypothetical protein EUGRSUZ_F01563 [Eucalyptus grandis]
Length=480

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 61/78 (78%), Gaps = 0/78 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  +DAQLQAN++Y CGQG+DCRPIQPGGACF PNT+ +HAAY MN +YQ   R 
Sbjct  386  WCIPKSGVSDAQLQANLDYACGQGIDCRPIQPGGACFEPNTLAAHAAYAMNLYYQNSNRS  445

Query  354  PFQCDFSGTATITSTDPS  301
            P  CDFS +AT +S +PS
Sbjct  446  PTNCDFSQSATFSSNNPS  463



>ref|XP_007160762.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
 gb|ESW32756.1| hypothetical protein PHAVU_001G014900g [Phaseolus vulgaris]
Length=473

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +DA+LQAN++Y CGQG+DC  IQ GGACF PNT+ +HAAY MN  YQT GR 
Sbjct  385  WCVPKAGVSDAELQANLDYACGQGIDCVAIQQGGACFEPNTLLNHAAYAMNLLYQTAGRN  444

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TA +++ +PS+ SC Y
Sbjct  445  PLTCDFSQTAMLSTNNPSYKSCLY  468



>ref|XP_006412222.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
 gb|ESQ53675.1| hypothetical protein EUTSA_v10024968mg [Eutrema salsugineum]
Length=504

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  ATD QLQA++++ CGQG+DC PIQPGGACF PN V SHAA+ MN ++Q   + 
Sbjct  370  WCVPKKGATDEQLQASLDWACGQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKN  429

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TATITS +PS+ SC Y
Sbjct  430  PADCDFSQTATITSQNPSYNSCVY  453



>ref|XP_010427314.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=452

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 83/125 (66%), Gaps = 10/125 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+LK          +     +P         GK+C  ++ ATD QLQ NIN+V
Sbjct  337  FSPVYDVGLLK---------NKQGGGGRPALPAPSTAGGKWCVARSEATDKQLQDNINWV  387

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            CGQG VDC+PIQ GG+CFNP++VR+HA+++MN ++Q+ GR    CDFSGT  +   +PS+
Sbjct  388  CGQGGVDCKPIQAGGSCFNPSSVRTHASFVMNAYFQSHGRTDGTCDFSGTGMVVGNNPSN  447

Query  297  GSCKY  283
            G+CK+
Sbjct  448  GACKF  452



>ref|XP_011048644.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Populus euphratica]
Length=456

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  A+ AQLQA+++Y CGQG+DC PIQPGGACF P+T+ SHAAY +N +YQ   + 
Sbjct  368  WCVPKTGASGAQLQASLDYACGQGIDCGPIQPGGACFQPDTLASHAAYAINLYYQASAKN  427

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+  C Y
Sbjct  428  PWNCDFSETATLTSKNPSYNGCTY  451



>gb|KDO84535.1| hypothetical protein CISIN_1g040787mg, partial [Citrus sinensis]
Length=436

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   T+ QLQANI+Y CG+G+DC PI PGGACF P+T+ SHAAY MN  +QT GR 
Sbjct  338  WCVPKEGVTNKQLQANIDYACGRGIDCSPIAPGGACFEPDTLASHAAYAMNLHHQTNGRN  397

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
             + CDFS TAT++S DPS+  C Y S
Sbjct  398  AWDCDFSKTATLSSKDPSYKGCIYPS  423



>ref|XP_006434974.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
 gb|ESR48214.1| hypothetical protein CICLE_v10003630mg, partial [Citrus clementina]
Length=436

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   T+ QLQANI+Y CG+G+DC PI PGGACF P+T+ SHAAY MN  +QT GR 
Sbjct  338  WCVPKEGVTNKQLQANIDYACGRGIDCSPIAPGGACFEPDTLASHAAYAMNLHHQTNGRN  397

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
             + CDFS TAT++S DPS+  C Y S
Sbjct  398  AWDCDFSKTATLSSKDPSYKGCIYPS  423



>gb|KHN13912.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=330

 Score =   116 bits (291),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 72/119 (61%), Gaps = 0/119 (0%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+ GIL+   A     P P     P          K+C PKA A++  LQANINYV
Sbjct  205  FTPVYDSGILRNGQAVTPARPTPTRPAAPTKPAPAVGGQKWCVPKADASNQALQANINYV  264

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            C QGVDCRPIQPGG CF  N V++ A Y MN +YQ  GR  F CDFS T  IT+T+PS 
Sbjct  265  CSQGVDCRPIQPGGDCFAANNVKALATYAMNAYYQANGRHDFNCDFSQTGVITTTNPSE  323



>gb|ABK24319.1| unknown [Picea sitchensis]
 gb|ACN40930.1| unknown [Picea sitchensis]
Length=491

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  K  A +  L+AN+NY CGQG+DCRPIQPGG C++PNTV  HAAY MN +YQ  GR 
Sbjct  405  WCITKPGADEKTLEANLNYACGQGIDCRPIQPGGPCYSPNTVACHAAYAMNAYYQAAGRN  464

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF+ T T+TSTDPS+G C Y
Sbjct  465  SWNCDFAQTGTLTSTDPSYGGCVY  488



>gb|AAK76666.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=449

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 83/124 (67%), Gaps = 9/124 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L++          P P+             K+C  ++ AT+ QLQ +IN+V
Sbjct  335  FSPVYDVGLLRSGQGGGGRPALPAPSTAGG---------KWCVARSGATNTQLQDSINWV  385

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CGQGVDC+PIQ GG+CFNP+++R+HA+++MN ++Q+ GR    C+FSGT  I   +PS+G
Sbjct  386  CGQGVDCKPIQAGGSCFNPSSLRTHASFVMNAYFQSHGRTDGACNFSGTGMIVGNNPSNG  445

Query  294  SCKY  283
            +CKY
Sbjct  446  ACKY  449



>ref|XP_004167482.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
Length=447

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C P++ A    LQ NI+YVC   VDCRPIQ GGACF PN VRSHAAY+MN++YQT GR
Sbjct  362  KWCVPRSDAAVDALQKNIDYVCSSNVDCRPIQAGGACFLPNDVRSHAAYVMNSYYQTSGR  421

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              + CDFS T  +T+ +PSHG C +
Sbjct  422  HDYNCDFSHTGVLTTVNPSHGGCAF  446



>ref|XP_009605959.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Nicotiana 
tomentosiformis]
Length=480

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C PK    DA+LQAN++Y C Q G+DC PIQ GGACF PNTV SHAAY MN  YQT GR
Sbjct  391  WCMPKPGTPDAELQANLDYACSQAGIDCTPIQAGGACFEPNTVASHAAYAMNLLYQTAGR  450

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDFS TA +TST+PS+  C Y
Sbjct  451  NPWNCDFSQTAALTSTNPSYDGCTY  475



>ref|XP_009112198.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Brassica rapa]
Length=506

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P+  ATD QLQA++++ CGQG+DC PIQPGGACF PN V SHAA+ MN ++Q   ++
Sbjct  369  WCVPRNGATDEQLQASLDWACGQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKK  428

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TATITS +PS+ SC Y
Sbjct  429  PTDCDFSQTATITSQNPSYNSCVY  452



>ref|XP_010690894.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=531

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   +DAQL+AN++Y CG GVDC  +Q GG C +P+TV SHAAY MN  YQT GR 
Sbjct  409  WCVPKKGVSDAQLKANLDYACGHGVDCSKLQAGGPCHDPDTVASHAAYAMNLLYQTAGRT  468

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TST+PS+GSC Y
Sbjct  469  PGSCDFSQTATVTSTNPSYGSCVY  492



>ref|NP_001118954.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
 gb|ABF59456.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82751.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
Length=114

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQANIN+ C QGVDCRPIQPGG+CF PN + +HA+++MN++YQT GR 
Sbjct  29   WCIATLIATNAQLQANINFACSQGVDCRPIQPGGSCFIPNNLANHASFVMNSYYQTHGRT  88

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
               C F  T T  +TDPS G C Y S
Sbjct  89   NQACSFKNTGTFAATDPSFGKCVYAS  114



>gb|KHN20986.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=318

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK    DAQLQAN++Y CGQG+DC  IQ GGACF PNT+ +HAAY MN  YQT GR 
Sbjct  230  WCVPKGGVADAQLQANLDYACGQGIDCTAIQQGGACFEPNTLVNHAAYAMNLLYQTAGRN  289

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TA +++ +PS+ SC Y
Sbjct  290  PLTCDFSQTAMLSTNNPSYKSCLY  313



>ref|XP_006379239.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
 gb|ABK95837.1| unknown [Populus trichocarpa]
 gb|ERP57036.1| hypothetical protein POPTR_0009s11830g [Populus trichocarpa]
Length=452

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  A++AQLQA+++Y CGQG+DC PIQPGGACF P+T+ SHAAY +N ++Q   + 
Sbjct  364  WCVPKTGASEAQLQASLDYACGQGIDCGPIQPGGACFIPDTLASHAAYAINLYFQASAKS  423

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TAT+TS +PS+  C Y
Sbjct  424  PWNCDFSETATLTSKNPSYNGCTY  447



>ref|XP_003544417.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Glycine max]
Length=484

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK    DAQLQAN++Y CGQG+DC  IQ GGACF PNT+ +HAAY MN  YQT GR 
Sbjct  396  WCVPKGGVADAQLQANLDYACGQGIDCTAIQQGGACFEPNTLVNHAAYAMNLLYQTAGRN  455

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TA +++ +PS+ SC Y
Sbjct  456  PLTCDFSQTAMLSTNNPSYKSCLY  479



>gb|ABK28115.1| unknown [Arabidopsis thaliana]
Length=115

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQANIN+ C QGVDCRPIQPGG+CF PN + +HA+++MN++YQT GR 
Sbjct  29   WCIATLIATNAQLQANINFACSQGVDCRPIQPGGSCFIPNNLANHASFVMNSYYQTHGRT  88

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
               C F  T T  +TDPS G C Y S
Sbjct  89   NQACSFKNTGTFAATDPSFGKCVYAS  114



>gb|ABK25242.1| unknown [Picea sitchensis]
Length=491

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  K  A +  L+AN+NY CGQG+DCRPIQPGG C++PNTV  HAAY MN +YQ  GR 
Sbjct  405  WCITKPGADEKTLEANLNYACGQGIDCRPIQPGGPCYSPNTVACHAAYAMNAYYQAAGRN  464

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             + CDF  T T+TSTDPS+G C Y
Sbjct  465  SWNCDFGQTGTLTSTDPSYGGCVY  488



>ref|XP_004230886.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Solanum lycopersicum]
Length=473

 Score =   117 bits (292),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK    D++LQ+N++Y C  G+DC PIQ GG CF PNTV SHAAY MN  YQT GR 
Sbjct  385  WCLPKPGIPDSELQSNLDYACSMGIDCSPIQEGGPCFEPNTVASHAAYAMNVLYQTAGRN  444

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TA++TST+PS+  C Y
Sbjct  445  PWNCDFSQTASLTSTNPSYNGCTY  468



>ref|XP_010091148.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXB42894.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=248

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/118 (49%), Positives = 74/118 (63%), Gaps = 17/118 (14%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+ GIL+                    +P  G   K+C PK+ ++   LQANI+YV
Sbjct  147  FTPVYDAGILR-----------------NGVRPGGGLGKKWCVPKSDSSTQALQANIDYV  189

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPS  301
            C  GVDCRPIQ GG CF PN +RSHA+++MN+FYQTKGR  + CDF+ T  IT T+PS
Sbjct  190  CSSGVDCRPIQGGGPCFEPNDIRSHASFVMNSFYQTKGRNDYNCDFAKTGVITYTNPS  247



>ref|XP_010534498.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Tarenaya hassleriana]
Length=449

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 81/125 (65%), Gaps = 13/125 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVYNVG+L+            N        P     GK+C  K  ATDAQLQANI++V
Sbjct  337  FSPVYNVGLLR------------NGQGGGVVPPPSTGAGKWCVAKPQATDAQLQANIDWV  384

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            C QG VDC+PIQ GG+CFNP+  RSHA+Y+MN +YQ+ GR    C+F GT  +T+ +P++
Sbjct  385  CSQGGVDCKPIQAGGSCFNPSNNRSHASYVMNAYYQSHGRTDGACNFGGTGMVTANNPTN  444

Query  297  GSCKY  283
            G+CKY
Sbjct  445  GACKY  449



>ref|XP_010461223.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=115

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQ NIN+ C QGVDCRPI+PGG+CF P+T+ +HA+++MN +YQ+ GR 
Sbjct  30   WCIATLTATNAQLQDNINFACSQGVDCRPIRPGGSCFVPDTLVNHASFVMNAYYQSHGRT  89

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  C F  T T  +TDPS+GSC Y
Sbjct  90   PEACSFKNTGTFAATDPSYGSCVY  113



>ref|NP_191103.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 emb|CAB75901.1| beta-1, 3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAN12934.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEE79383.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=449

 Score =   116 bits (291),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 9/124 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L+                +P         GK+C  ++ AT+ QLQ +IN+V
Sbjct  335  FSPVYDVGLLR---------NGQGGGGRPALPAPSTAGGKWCVARSGATNTQLQDSINWV  385

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CGQGVDC+PIQ GG+CFNP+++R+HA+++MN ++Q+ GR    C+FSGT  I   +PS+G
Sbjct  386  CGQGVDCKPIQAGGSCFNPSSLRTHASFVMNAYFQSHGRTDGACNFSGTGMIVGNNPSNG  445

Query  294  SCKY  283
            +CKY
Sbjct  446  ACKY  449



>gb|AAM66982.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=449

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 82/124 (66%), Gaps = 9/124 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L+                +P         GK+C  ++ AT+ QLQ +IN+V
Sbjct  335  FSPVYDVGLLR---------NGQGGGGRPALPAPSTAGGKWCVARSGATNTQLQDSINWV  385

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CGQGVDC+PIQ GG+CFNP+++R+HA+++MN ++Q+ GR    C+FSGT  I   +PS+G
Sbjct  386  CGQGVDCKPIQAGGSCFNPSSLRTHASFVMNAYFQSHGRTDGACNFSGTGMIVGNNPSNG  445

Query  294  SCKY  283
            +CKY
Sbjct  446  ACKY  449



>ref|XP_003622030.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES78248.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=448

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 74/123 (60%), Gaps = 4/123 (3%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+ GIL+     A     P       P       G +C PK  A++A LQANINYV
Sbjct  329  FSPVYDSGILR----NAQRPVAPVQPRPVTPVQPRPAIGSWCVPKPDASNAALQANINYV  384

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C Q VDCRPIQPGG CF  N +R+ A Y MN +YQ  GR PF CDFS +  I ST+PSH 
Sbjct  385  CSQKVDCRPIQPGGVCFAANNLRALATYAMNAYYQAMGRHPFNCDFSNSGVIVSTNPSHD  444

Query  294  SCK  286
            +C+
Sbjct  445  NCR  447



>ref|XP_008778544.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Phoenix dactylifera]
Length=455

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 13/126 (10%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVY++GIL+ +    +     +               ++C PK  A    LQ NI YV
Sbjct  343  MTPVYDIGILRTEAREQVKPMASDAK-------------RWCVPKPNADVMSLQENIEYV  389

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QG+DC PI+PGGAC+ P+T + HAAY+MN +YQ+ GR  F CDF  T  I++ DPS+G
Sbjct  390  CAQGIDCNPIRPGGACYRPDTAQGHAAYVMNEYYQSFGRNSFDCDFGQTGVISTIDPSYG  449

Query  294  SCKYLS  277
            +C Y S
Sbjct  450  NCIYRS  455



>ref|XP_004295910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=515

 Score =   117 bits (292),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK+  +DA LQ NI+YVC  GVDC+PI+ GG CF PN+V+SHAAY+MN +YQ  G Q
Sbjct  385  WCVPKSNVSDAALQKNIDYVCSSGVDCKPIKQGGPCFEPNSVKSHAAYVMNAYYQEHGPQ  444

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDF+GT  +TSTDPS+ +C Y
Sbjct  445  NINCDFNGTGVVTSTDPSYKTCTY  468



>emb|CDX75437.1| BnaA01g02650D [Brassica napus]
Length=506

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P+  ATD QLQA++++ CGQG+DC PIQPGGACF PN V SHAA+ MN ++Q   ++
Sbjct  369  WCVPRNGATDEQLQASLDWACGQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKK  428

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS +PS+ SC Y
Sbjct  429  PTDCDFSQTATLTSQNPSYNSCVY  452



>ref|XP_010444969.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
7-like [Camelina sativa]
Length=507

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  ATD QLQ+++++ CGQG+DC PIQPGGACF PN V S AAY MN ++Q   +Q
Sbjct  370  WCVPKKGATDDQLQSSLDWACGQGIDCGPIQPGGACFEPNNVASRAAYAMNMYFQKSPKQ  429

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS +PS+ SC Y
Sbjct  430  PTDCDFSKTATVTSQNPSYNSCVY  453



>ref|XP_004982218.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X2 
[Setaria italica]
Length=469

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C  +  ATDA LQA+++Y C Q GVDC  IQPGGACF PNTVR+HAAY MN  YQ  GR
Sbjct  380  WCVARDGATDADLQADLDYACAQVGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYQAAGR  439

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS +PS+G+C Y
Sbjct  440  HPWNCDFRASATLTSDNPSYGACVY  464



>ref|XP_010444207.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=112

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 61/86 (71%), Gaps = 1/86 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCG-QGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            ++C P   ATD QLQANI+YVCG Q VDC PIQPGG+C+ PNTVR HA+Y+MN +Y + G
Sbjct  25   QWCMPLPTATDKQLQANIDYVCGGQNVDCTPIQPGGSCYEPNTVRGHASYVMNAYYHSHG  84

Query  360  RQPFQCDFSGTATITSTDPSHGSCKY  283
            R    C+F+ T      DPSHGSC Y
Sbjct  85   RIESACNFAKTGCFEFVDPSHGSCVY  110



>ref|XP_010106478.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC10654.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=489

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/124 (45%), Positives = 72/124 (58%), Gaps = 6/124 (5%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVY+V +L+                  +         K+C P++ A+D  LQ NI+YV
Sbjct  334  LTPVYDVSVLR------NDQALGPTADVAQAPKAVDTRRKWCVPRSDASDEALQKNIDYV  387

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC+PIQ GG CF+PNTVRSHA+Y MN +YQ  G Q + CDF  T  IT TDPS+ 
Sbjct  388  CSAGVDCKPIQSGGPCFDPNTVRSHASYAMNAYYQAFGPQDYNCDFGHTGVITDTDPSYQ  447

Query  294  SCKY  283
            +C Y
Sbjct  448  ACTY  451



>ref|XP_010496153.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=116

 Score =   110 bits (274),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C  K  AT+AQLQ NIN+ C +GVDCRP+QPGG+CF PNT+ +HA+++MN +YQ+ GR
Sbjct  30   QWCVAKLTATNAQLQKNINFGCSEGVDCRPVQPGGSCFIPNTLINHASFVMNAYYQSHGR  89

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
                C F  T T   TDPS GSC Y
Sbjct  90   SKKACSFKKTGTFAVTDPSFGSCVY  114



>ref|XP_010267530.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=455

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C PK+ A    LQ NI+YVCG G DCRPIQ GGACF PNTV++HAAY+MN +YQ  GR
Sbjct  371  RWCLPKSDADPKALQNNIDYVCGLGFDCRPIQDGGACFLPNTVQAHAAYVMNAYYQATGR  430

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              + CDF+ T  I++ DPS+G C+Y
Sbjct  431  NAYDCDFAQTGAISTVDPSYGGCRY  455



>gb|KEH40125.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=481

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 59/77 (77%), Gaps = 0/77 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  TD QLQAN++Y CGQG+DC  IQPGGACF PNT+ +HAAY MN FY T G+ 
Sbjct  391  WCVPKAGLTDVQLQANLDYACGQGIDCSLIQPGGACFEPNTLANHAAYAMNLFYHTVGQN  450

Query  354  PFQCDFSGTATITSTDP  304
            P  CDFS TAT+TS +P
Sbjct  451  PLTCDFSQTATLTSNNP  467



>ref|XP_008223598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=517

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C P++  +DA LQANI+YVC  GVDC+ IQ GG CF PNTVRSHAAY+MN +YQ+ G 
Sbjct  395  RWCVPRSNVSDAALQANIDYVCSSGVDCKAIQKGGPCFQPNTVRSHAAYVMNAYYQSVGP  454

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
            Q + CDF  T  IT+TDPS+ +C Y
Sbjct  455  QDYNCDFKHTGFITTTDPSYDACTY  479



>gb|KFK27709.1| hypothetical protein AALP_AA8G419000, partial [Arabis alpina]
Length=441

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 73/124 (59%), Gaps = 8/124 (6%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVY++GIL+    P      P      +         ++C  K+ A    LQ NI+YV
Sbjct  320  LTPVYDIGILRPTANPENNPRSPPVRGSSEK--------RWCVTKSGAETVDLQRNIDYV  371

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG G+DCRPI+  G CF PNTV++H+AY MN FYQT G+  F CDF  T  IT+ DPS+G
Sbjct  372  CGLGLDCRPIKENGPCFLPNTVKAHSAYAMNLFYQTMGKHEFDCDFDKTGVITTIDPSYG  431

Query  294  SCKY  283
            SC Y
Sbjct  432  SCAY  435



>ref|NP_001078361.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
 gb|ABF59243.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82753.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
Length=116

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQANIN+ C QGVDCRPI+PGG+CF PN + +HA+++MN++YQT GR 
Sbjct  31   WCIATLIATNAQLQANINFACSQGVDCRPIRPGGSCFIPNNLANHASFVMNSYYQTHGRT  90

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
               C F  T T  +TDPS G C Y S
Sbjct  91   NKACSFKNTGTFAATDPSFGKCVYAS  116



>emb|CDX69064.1| BnaC01g03890D [Brassica napus]
Length=505

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P+  ATD QLQA++++ CGQG+DC PIQPGGACF PN V SHAA+ MN ++Q   ++
Sbjct  369  WCVPRNGATDQQLQASLDWACGQGIDCGPIQPGGACFEPNNVASHAAFAMNMYFQKSPKK  428

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TAT+TS +PS+ SC Y
Sbjct  429  PTDCDFSQTATLTSQNPSYNSCVY  452



>ref|XP_007205054.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
 gb|EMJ06253.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
Length=516

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C P++  +DA LQANI+YVC  GVDC+ IQ GG CF PNTVRSHAAY+MN +YQ+ G 
Sbjct  395  RWCVPRSNVSDAALQANIDYVCSSGVDCKAIQKGGPCFQPNTVRSHAAYVMNAYYQSVGP  454

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
            Q + CDF  T  IT+TDPS+ +C Y
Sbjct  455  QDYNCDFKHTGFITTTDPSYDACTY  479



>ref|XP_003629685.1| Glucan endo-1 3-beta-glucosidase [Medicago truncatula]
 gb|AET04161.1| carbohydrate-binding X8 domain protein [Medicago truncatula]
Length=116

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  +++AT   LQ  +NY C  G DC PIQPGG+CFNPNT++SHA+Y  ++FYQ+KG+ 
Sbjct  32   WCQVRSSATGPALQNALNYACSNGADCGPIQPGGSCFNPNTLQSHASYAFDSFYQSKGQN  91

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  C+F G ATI  TDPS+GSC+Y
Sbjct  92   PSACNFGGLATIAVTDPSYGSCRY  115



>ref|XP_007131842.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
 gb|ESW03836.1| hypothetical protein PHAVU_011G045800g [Phaseolus vulgaris]
Length=459

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCG-QGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            ++C PK   ++AQLQ N++Y+CG Q +DC PIQPGGAC+ PNTV SHAA+ MN +YQ  G
Sbjct  369  EWCIPKVEVSEAQLQTNVDYICGSQVIDCGPIQPGGACYEPNTVLSHAAFAMNLYYQKVG  428

Query  360  RQPFQCDFSGTATITSTDPSHGSCKY  283
            R P+ CDFS TA +TS +PS+ +C Y
Sbjct  429  RNPWNCDFSQTAMLTSQNPSYSACVY  454



>gb|KHN25369.1| Glucan endo-1,3-beta-glucosidase 7 [Glycine soja]
Length=321

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 1/86 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCG-QGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            ++C PK   T+AQLQANI+Y+CG Q VDC PIQP GAC+ PNT+ SHAA+ MN +YQ  G
Sbjct  231  QWCIPKVEVTEAQLQANIDYICGSQVVDCGPIQPEGACYEPNTISSHAAFAMNLYYQKFG  290

Query  360  RQPFQCDFSGTATITSTDPSHGSCKY  283
            R P+ CDFS TA +TS +PS+ +C Y
Sbjct  291  RNPWNCDFSQTAMLTSQNPSYNACVY  316



>ref|XP_006856026.1| hypothetical protein AMTR_s00059p00061500 [Amborella trichopoda]
 gb|ERN17493.1| hypothetical protein AMTR_s00059p00061500 [Amborella trichopoda]
Length=457

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PKA  +++ LQAN++Y CGQG+DC  +QPGGACF PNTV +HAAY MN  YQT  R 
Sbjct  370  WCMPKAGVSESDLQANLDYACGQGIDCSALQPGGACFLPNTVVAHAAYAMNLLYQTSARN  429

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDF  TA +TST+PS+  C +
Sbjct  430  PWNCDFKQTAILTSTNPSYQGCSF  453



>ref|NP_001118955.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
 ref|NP_001118957.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
 gb|ABF59381.1| unknown protein [Arabidopsis thaliana]
 gb|AEE82752.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
 gb|AEE82755.1| carbohydrate-binding X8 domain-containing protein [Arabidopsis 
thaliana]
Length=116

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQANIN+ C QGVDCRPI+PGG+CF PN + +HA+++MN++YQT GR 
Sbjct  31   WCIATLIATNAQLQANINFACSQGVDCRPIRPGGSCFIPNNLANHASFVMNSYYQTHGRT  90

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
               C F  T T  +TDPS G C Y S
Sbjct  91   NQACSFKNTGTFAATDPSFGKCVYAS  116



>ref|XP_010500533.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=115

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 62/85 (73%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C     AT+AQLQ NIN+ C QGVDC PIQPGG+CF P+T+ SHA+++MN +YQ+ GR
Sbjct  29   QWCIATLTATNAQLQDNINFACSQGVDCGPIQPGGSCFVPDTLVSHASFVMNAYYQSHGR  88

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
                C F  T TI +TDPS+GSC Y
Sbjct  89   IMKACSFKNTGTIAATDPSYGSCVY  113



>gb|ABK28052.1| unknown [Arabidopsis thaliana]
Length=117

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQANIN+ C QGVDCRPI+PGG+CF PN + +HA+++MN++YQT GR 
Sbjct  31   WCIATLIATNAQLQANINFACSQGVDCRPIRPGGSCFIPNNLANHASFVMNSYYQTHGRT  90

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
               C F  T T  +TDPS G C Y S
Sbjct  91   NQACSFKNTGTFAATDPSFGKCVYAS  116



>ref|XP_010478822.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=115

 Score =   109 bits (272),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQ NIN+ C QGVDCRPI+PGG+CF P+T+ +HA+Y+MN +YQ+ GR 
Sbjct  30   WCIATLTATNAQLQDNINFACSQGVDCRPIKPGGSCFVPDTLVNHASYVMNAYYQSHGRT  89

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               C F  T T  +TDPS+GSC Y
Sbjct  90   TEACSFKNTGTFAATDPSYGSCVY  113



>ref|NP_001148381.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 gb|ACG31222.1| glucan endo-1,3-beta-glucosidase 7 precursor [Zea mays]
 tpg|DAA50560.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=461

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C  +  A+DA+LQA+++Y C Q GVDC  IQPGGACF PNTV +HAAY MN  YQ  GR
Sbjct  372  WCVARDGASDAELQADLDYACSQVGVDCGAIQPGGACFEPNTVHAHAAYAMNQLYQAAGR  431

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
            QP+ CDF  +AT+TS +PS+G+C Y
Sbjct  432  QPWNCDFRASATLTSENPSYGACVY  456



>gb|ACN26761.1| unknown [Zea mays]
Length=323

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C  +  A+DA+LQA+++Y C Q GVDC  IQPGGACF PNTV +HAAY MN  YQ  GR
Sbjct  234  WCVARDGASDAELQADLDYACSQVGVDCGAIQPGGACFEPNTVHAHAAYAMNQLYQAAGR  293

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
            QP+ CDF  +AT+TS +PS+G+C Y
Sbjct  294  QPWNCDFRASATLTSENPSYGACVY  318



>ref|XP_009407686.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=459

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C PKA ATD  LQAN++Y C Q GVDCRPIQ GGAC+ PNTVRSHAAY MN  YQ  GR
Sbjct  370  WCVPKAEATDEDLQANLDYACAQQGVDCRPIQEGGACYLPNTVRSHAAYAMNQLYQNTGR  429

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              + CDF  TA +T  +PS+ +C Y
Sbjct  430  HGWDCDFRKTAVLTRDNPSYATCVY  454



>ref|XP_010530842.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Tarenaya hassleriana]
Length=499

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK   TD QLQA++++ CG G+DC PIQPGGAC+ PN+V SHAAY MN ++Q  G+ 
Sbjct  365  WCVPKKDVTDEQLQASLDWSCGHGIDCGPIQPGGACYEPNSVASHAAYAMNLYFQMSGKN  424

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TA +TS +PS+ +C Y
Sbjct  425  PWDCDFSQTAALTSQNPSYDNCVY  448



>emb|CDX87130.1| BnaC09g04450D [Brassica napus]
Length=465

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 72/124 (58%), Gaps = 5/124 (4%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVY++GIL+     + P      +P            ++C  K+ A    LQ NI+YV
Sbjct  342  LTPVYDIGILRPTARTSDPPENNRRSPVGGSSGK-----RWCVTKSGAETEALQRNIDYV  396

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG G+DC PI  GG CF PNTV +H+AY MN FYQT GR  F CDF  T  ITS DPS+G
Sbjct  397  CGLGLDCEPIIEGGPCFLPNTVEAHSAYAMNLFYQTMGRHEFDCDFDKTGEITSIDPSYG  456

Query  294  SCKY  283
             C+Y
Sbjct  457  DCQY  460



>ref|XP_002466692.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
 gb|EER93690.1| hypothetical protein SORBIDRAFT_01g012380 [Sorghum bicolor]
Length=475

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C  +  A+DA LQA+++Y C Q GVDC  IQPGGACF PNTVR+HAAY MN  YQ  GR
Sbjct  386  WCVARDGASDADLQADLDYACSQLGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYQAAGR  445

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS +PS+G+C Y
Sbjct  446  HPWNCDFRASATLTSENPSYGACVY  470



>ref|XP_006283912.1| hypothetical protein CARUB_v10005030mg [Capsella rubella]
 gb|EOA16810.1| hypothetical protein CARUB_v10005030mg [Capsella rubella]
Length=385

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  AT+ QLQA++++ CGQG+DC  IQPGGACF PN V SHAAY MN +YQ   +Q
Sbjct  248  WCVPKKGATNEQLQASLDWACGQGIDCGAIQPGGACFEPNNVASHAAYAMNMYYQKSPKQ  307

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDFS TAT+TS +PS+ SC Y
Sbjct  308  TTDCDFSKTATVTSQNPSYNSCVY  331



>ref|XP_004145947.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 ref|XP_004160391.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
Length=497

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 76/127 (60%), Gaps = 3/127 (2%)
 Frame = -1

Query  654  FTPVYNVGILK---AqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANI  484
             +PVY +GIL+   A  A   P              T   + ++C PK+ A++  LQ NI
Sbjct  370  LSPVYEIGILRPTVAATARTHPKTFLIIMMVSPSPSTVSESKRWCLPKSEASEEGLQRNI  429

Query  483  NYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDP  304
            +YVCG G+DC PI+  GACF PNTVR+HAAY+MN ++Q      F CDF  T T+T+ DP
Sbjct  430  DYVCGLGLDCGPIKENGACFAPNTVRAHAAYVMNAYFQATEGNDFDCDFDQTGTLTTVDP  489

Query  303  SHGSCKY  283
            S+G CKY
Sbjct  490  SYGKCKY  496



>ref|XP_006291113.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
 gb|EOA24011.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
Length=454

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 82/125 (66%), Gaps = 10/125 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L+                +P         GK+C  ++ A+D QLQ NIN+V
Sbjct  339  FSPVYDVGLLR---------NGQGGGGRPALPAPSTAGGKWCVARSGASDKQLQDNINWV  389

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            CGQG VDC+PIQ GG+CFNP++VR+HA+++MN ++Q+ GR    C+FSGT  +   +PS+
Sbjct  390  CGQGGVDCKPIQAGGSCFNPSSVRTHASFVMNAYFQSHGRSDGSCNFSGTGMVVGNNPSN  449

Query  297  GSCKY  283
            G+CK+
Sbjct  450  GACKF  454



>ref|XP_006391444.1| hypothetical protein EUTSA_v10019456mg [Eutrema salsugineum]
 gb|ESQ28730.1| hypothetical protein EUTSA_v10019456mg [Eutrema salsugineum]
Length=121

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 47/88 (53%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            ++C    +ATD Q+QANI++ C QG VDCRPI+PGGACF PN +R+HA+++MN +YQ+  
Sbjct  34   QWCVISLSATDEQMQANIDWGCSQGKVDCRPIRPGGACFEPNNLRNHASFVMNEYYQSHH  93

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
            R    CDF+GT     TDPS+G C Y+S
Sbjct  94   RTEEACDFNGTGIYIITDPSYGDCVYVS  121



>gb|KCW85570.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=460

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 73/122 (60%), Gaps = 1/122 (1%)
 Frame = -1

Query  654  FTPVYNVGILK-AqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINY  478
             TPVY+VGIL+        P             P      K+C P++ A+D  LQANI+Y
Sbjct  334  LTPVYDVGILRNEPAGGPTPASPSPTAQPSPTAPPTSSGKKWCVPRSDASDQALQANIDY  393

Query  477  VCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            VC   VDC+PIQ GGACF+PNTVRSHAAY MN +YQ+ G+  + CDF  T  +T+ DPS 
Sbjct  394  VCSAQVDCKPIQTGGACFDPNTVRSHAAYAMNAYYQSMGQHDYDCDFDKTGVVTAVDPST  453

Query  297  GS  292
             S
Sbjct  454  SS  455



>ref|XP_002872445.1| hypothetical protein ARALYDRAFT_489799 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48704.1| hypothetical protein ARALYDRAFT_489799 [Arabidopsis lyrata subsp. 
lyrata]
Length=116

 Score =   108 bits (270),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C     AT+AQLQANIN+ C QGVDCRPI+PGG+CF PNT+ +HA+++MN++YQ+ GR 
Sbjct  31   WCIATLTATNAQLQANINFGCSQGVDCRPIRPGGSCFIPNTLVNHASFVMNSYYQSHGRT  90

Query  354  PFQCDFSGTATITSTDPSHGSCKYLS  277
               C F  T T  +TDPS G C Y S
Sbjct  91   NQACSFKNTGTFAATDPSFGKCVYAS  116



>ref|XP_010662898.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 emb|CBI23036.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 74/128 (58%), Gaps = 3/128 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgr---tGKFCTPKAAATDAQLQANI  484
             TPVY++GI++     ++P                       ++C P + A    LQ NI
Sbjct  332  LTPVYDIGIMRPTARASIPWNPAPAAAPQLGPAPQQHPKGGKQWCLPTSDAHSDALQKNI  391

Query  483  NYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDP  304
            +YVCG G+DC+PIQ GGACF P+TVR+HAAY MN +YQT G   + CDF  T  +T  DP
Sbjct  392  DYVCGLGLDCKPIQEGGACFIPDTVRAHAAYAMNAYYQTTGGSEYDCDFEQTGALTDVDP  451

Query  303  SHGSCKYL  280
            S+G CKYL
Sbjct  452  SYGRCKYL  459



>ref|XP_010940752.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=462

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 62/87 (71%), Gaps = 0/87 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C PK  A    LQ NI Y C QG+DC PIQPGGAC++PNT ++HAAY+MN +YQ+ GR
Sbjct  376  RWCVPKPNADVMALQENIEYGCAQGIDCNPIQPGGACYHPNTAQAHAAYVMNEYYQSFGR  435

Query  357  QPFQCDFSGTATITSTDPSHGSCKYLS  277
              F CDF  T  I++ DPS+G+C Y S
Sbjct  436  NSFDCDFGRTGVISTIDPSYGNCMYRS  462



>ref|XP_002451320.1| hypothetical protein SORBIDRAFT_05g027690 [Sorghum bicolor]
 gb|EES10308.1| hypothetical protein SORBIDRAFT_05g027690 [Sorghum bicolor]
Length=467

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (75%), Gaps = 1/87 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K+ A+   LQ NINY CG  +DC+PIQ GGACF+PN V+SHA+Y+MN +YQ  G 
Sbjct  382  KWCVAKSGASATDLQNNINYACGY-IDCKPIQSGGACFDPNNVQSHASYVMNAYYQANGL  440

Query  357  QPFQCDFSGTATITSTDPSHGSCKYLS  277
              + C+F GT  +TS+DPS+GSCKY+S
Sbjct  441  HDYDCNFKGTGVVTSSDPSYGSCKYVS  467



>emb|CDX76097.1| BnaA04g03610D [Brassica napus]
Length=451

 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 82/125 (66%), Gaps = 9/125 (7%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L+        + +      P P       GK+C  K  A+DAQLQ NI++V
Sbjct  335  FSPVYDVGLLR--------NGQGGGGRLPAPALPAPTGGKWCVAKWGASDAQLQGNIDWV  386

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            C QG +DC+PIQ GG+CFNPN+VR+HA+++MN ++Q  GR    C+FSGT  +   +PS+
Sbjct  387  CSQGGIDCKPIQAGGSCFNPNSVRTHASFVMNAYFQRNGRTDGSCNFSGTGVVVGNNPSN  446

Query  297  GSCKY  283
            G+C+Y
Sbjct  447  GACRY  451



>ref|XP_004980076.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Setaria italica]
Length=473

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 63/87 (72%), Gaps = 1/87 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K  A    LQ NINY CG  VDC+PIQ GG CF+PN V+SHA+++MN +YQ  GR
Sbjct  388  KWCVAKTGADVTTLQNNINYACGY-VDCKPIQSGGGCFDPNNVQSHASFVMNAYYQANGR  446

Query  357  QPFQCDFSGTATITSTDPSHGSCKYLS  277
              + CDF GT  +TS+DPS+GSCKY+S
Sbjct  447  HDYDCDFKGTGMVTSSDPSYGSCKYVS  473



>emb|CDY04078.1| BnaC02g37930D [Brassica napus]
Length=120

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            FC    +ATDAQ+Q+NI++VC Q  DC PI PGG CF PN +RSHA+++MN +YQ  GR+
Sbjct  35   FCVISISATDAQMQSNIDWVCSQKFDCTPINPGGPCFEPNNLRSHASFVMNRYYQKNGRE  94

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDFS T    ++DPS+G C Y
Sbjct  95   EEACDFSNTGRFINSDPSYGDCVY  118



>ref|XP_010516112.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 82/125 (66%), Gaps = 10/125 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L           +     +P         GK+C  ++ ATD QLQ NIN+V
Sbjct  338  FSPVYDVGLL---------LKKQGGGGRPALPAPSTAGGKWCVARSGATDKQLQDNINWV  388

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            CGQG VDC+PIQ GG+CFNP++VR+HA+++MN ++Q+ GR    C+FSGT  +   +PS+
Sbjct  389  CGQGGVDCKPIQAGGSCFNPSSVRTHASFVMNAYFQSHGRTDGTCNFSGTGMVVGNNPSN  448

Query  297  GSCKY  283
            G+CK+
Sbjct  449  GACKF  453



>ref|XP_009345986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P++ A+DA LQ NI++VC  GVDC+PIQ GG CF PNTV+SHAAY+MN +YQ  G Q
Sbjct  393  WCVPRSDASDAALQKNIDFVCSSGVDCKPIQEGGPCFQPNTVKSHAAYIMNAYYQANGPQ  452

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDF  T  +T+TDPS+ +C Y
Sbjct  453  DSNCDFKHTGVVTTTDPSYDACTY  476



>ref|XP_009353665.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P++ A+DA LQ NI++VC  GVDC+PIQ GG CF PNTV+SHAAY+MN +YQ  G Q
Sbjct  393  WCVPRSDASDAALQKNIDFVCSSGVDCKPIQEGGPCFQPNTVKSHAAYIMNAYYQANGPQ  452

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDF  T  +T+TDPS+ +C Y
Sbjct  453  DSNCDFKHTGVVTTTDPSYDACTY  476



>ref|XP_009345982.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C P++ A+DA LQ NI++VC  GVDC+PIQ GG CF PNTV+SHAAY+MN +YQ  G Q
Sbjct  393  WCVPRSDASDAALQKNIDFVCSSGVDCKPIQEGGPCFQPNTVKSHAAYIMNAYYQANGPQ  452

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDF  T  +T+TDPS+ +C Y
Sbjct  453  DSNCDFKHTGVVTTTDPSYDACTY  476



>ref|XP_010421259.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 73/124 (59%), Gaps = 18/124 (15%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TP+Y++GIL+ +   + P                    ++C  KA A    LQ NI+YV
Sbjct  328  LTPLYDIGILRPKVRSSNPGS------------------RWCVAKAGAETVALQRNIDYV  369

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG G+DCRPI  GG C+ PNTV++H+ Y MN FYQT G+  F CDF  T  IT+ DPS+G
Sbjct  370  CGLGLDCRPIIEGGLCYLPNTVKAHSEYAMNLFYQTMGKYKFDCDFENTGEITTMDPSYG  429

Query  294  SCKY  283
            +C+Y
Sbjct  430  NCEY  433



>ref|XP_010479430.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=115

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 60/85 (71%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C     AT+AQLQ NI++ C QGVDC PIQPGG+CF PNT+  HA+++MN +YQ+ GR
Sbjct  29   QWCIATLTATNAQLQENIDFACSQGVDCGPIQPGGSCFIPNTIAHHASFVMNAYYQSNGR  88

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
                C F  T T+T TDPS GSC Y
Sbjct  89   IMKACSFKNTGTLTDTDPSSGSCVY  113



>ref|XP_010504397.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 82/125 (66%), Gaps = 10/125 (8%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L           +     +P         GK+C  ++ ATD QLQ NIN+V
Sbjct  338  FSPVYDVGLL---------LKKQGGGGRPALPAPSTAGGKWCVARSGATDKQLQDNINWV  388

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            CGQG VDC+PIQ GG+CFNP++VR+HA+++MN ++Q+ GR    C+FSGT  +   +PS+
Sbjct  389  CGQGGVDCKPIQAGGSCFNPSSVRTHASFVMNAYFQSHGRTDGTCNFSGTGMVVGNNPSN  448

Query  297  GSCKY  283
            G+CK+
Sbjct  449  GACKF  453



>ref|XP_002298356.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE83161.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=457

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/122 (50%), Positives = 75/122 (61%), Gaps = 3/122 (2%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TPVY+VGIL+         P P          +PGR  ++C PK+ A+D  LQ NI+YV
Sbjct  333  LTPVYDVGILR---DDKALAPTPGTAADAPSSSSPGRQRQWCVPKSDASDDALQKNIDYV  389

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C  GVDC+PIQ GG CF P+TV+SHA+Y MN FYQ  GR  + CDFS T  +TS DPS  
Sbjct  390  CSNGVDCKPIQQGGPCFVPDTVKSHASYAMNAFYQASGRHDYDCDFSHTGVLTSIDPSKL  449

Query  294  SC  289
            S 
Sbjct  450  SW  451



>ref|XP_009129295.1| PREDICTED: major pollen allergen Ole e 10-like [Brassica rapa]
Length=120

 Score =   108 bits (269),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            FC    +ATDAQ+Q+NIN+VC Q  DC PI PGG+CF PN + SHA+++MN +YQ  GR+
Sbjct  35   FCVISKSATDAQMQSNINWVCSQKFDCTPINPGGSCFEPNNLSSHASFVMNRYYQKNGRE  94

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
               CDF+ T    ++DPS+G C Y
Sbjct  95   EEACDFANTGRFINSDPSYGDCVY  118



>ref|XP_007139210.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
 gb|ESW11204.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
Length=443

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 73/123 (59%), Gaps = 11/123 (9%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            FTPVY+ GI++              N  P         GK+C PKA A DA LQANINYV
Sbjct  331  FTPVYDCGIMR-----------NGQNVAPAKPAPAVGGGKWCVPKADANDAALQANINYV  379

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            C QGVDC+PI+ GG C+  N V++ A Y MN +Y+  GR  F CDFS T  IT+T+PSH 
Sbjct  380  CSQGVDCKPIEAGGVCYAANNVKALATYAMNAYYKANGRHDFNCDFSNTGLITTTNPSHD  439

Query  294  SCK  286
             C+
Sbjct  440  KCQ  442



>ref|XP_010421258.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Camelina 
sativa]
Length=453

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 73/124 (59%), Gaps = 18/124 (15%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TP+Y++GIL+ +   + P                    ++C  KA A    LQ NI+YV
Sbjct  346  LTPLYDIGILRPKVRSSNPGS------------------RWCVAKAGAETVALQRNIDYV  387

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG G+DCRPI  GG C+ PNTV++H+ Y MN FYQT G+  F CDF  T  IT+ DPS+G
Sbjct  388  CGLGLDCRPIIEGGLCYLPNTVKAHSEYAMNLFYQTMGKYKFDCDFENTGEITTMDPSYG  447

Query  294  SCKY  283
            +C+Y
Sbjct  448  NCEY  451



>ref|NP_001275210.1| glucan endo-1,3-beta-D-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52647.1| beta-1,3-glucanase 12 [Solanum tuberosum]
Length=470

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK    D++LQ+N++Y C  G+DC PIQ GG CF P TV SHAAY MN  YQT GR 
Sbjct  382  WCLPKPGIPDSELQSNLDYACSMGIDCSPIQEGGPCFEPITVASHAAYAMNVLYQTAGRN  441

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P+ CDFS TA++TST+PS+  C Y
Sbjct  442  PWNCDFSQTASLTSTNPSYNGCTY  465



>ref|XP_006846179.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
 gb|ERN07854.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
Length=481

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK    D +LQANI+YVC QGVDC PIQ GGAC+ P+T++SHAAY MN +YQ  GR 
Sbjct  396  WCVPKPEVEDVKLQANIDYVCSQGVDCTPIQAGGACYLPDTLQSHAAYAMNAYYQFAGRN  455

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
             F CDF+ T  +TS++PS+G C +
Sbjct  456  DFNCDFAQTGVLTSSNPSYGDCNF  479



>ref|XP_009357726.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=492

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 1/85 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            K+C  K AA++  LQ+NI+YVCG GVDC+ IQPG ACF+ N +R+ A+YLMN +YQ  GR
Sbjct  407  KWCVAKPAASNQALQSNIDYVCGTGVDCKSIQPGSACFD-NDIRARASYLMNAYYQANGR  465

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
              F CDFSG+  IT+TDPS G CKY
Sbjct  466  HDFNCDFSGSGQITTTDPSRGLCKY  490



>ref|XP_006409465.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
 gb|ESQ50918.1| hypothetical protein EUTSA_v10022641mg [Eutrema salsugineum]
Length=526

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C PK  AT+ QLQA++++VCGQG+DCRPI PGGACF PN + SHAAY MN  +Q     
Sbjct  383  WCVPKEDATEEQLQASLDWVCGQGIDCRPIMPGGACFEPNNIASHAAYAMNLNFQKSPEN  442

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TA ITS +PS+ +C Y
Sbjct  443  PTDCDFSQTARITSDNPSYNNCVY  466



>ref|XP_010519110.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase [Tarenaya hassleriana]
Length=475

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCG-QGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
             +C PKA  +D+QLQANI+YVCG Q +DC  IQPGG+CF PNTV SHA Y MN  +   G
Sbjct  385  NWCVPKAGVSDSQLQANIDYVCGTQALDCSAIQPGGSCFEPNTVASHATYAMNLLFHAAG  444

Query  360  RQPFQCDFSGTATITSTDPSHGSCKYLS  277
              P+ CDFS TAT+TS +PS+  C Y S
Sbjct  445  SNPWNCDFSQTATLTSNNPSYNGCTYAS  472



>dbj|BAJ87172.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=461

 Score =   113 bits (283),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 63/85 (74%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C   A AT+AQLQ +++Y C Q GVDC  IQPGGACF PNTVR+HAAY MN  YQ  G 
Sbjct  373  WCVASAGATEAQLQTDMDYACSQVGVDCGAIQPGGACFEPNTVRAHAAYAMNQLYQAAGS  432

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TST+PS+GSC +
Sbjct  433  HPWNCDFRQSATLTSTNPSYGSCVF  457



>gb|AAP44659.1| putative beta 1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF98103.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE63416.1| hypothetical protein OsJ_18228 [Oryza sativa Japonica Group]
Length=464

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C   A AT+A LQA+++Y C Q GVDC  IQ GGACF PNTVR+HAAY MN  YQ  GR
Sbjct  376  WCVASAGATEADLQADLDYACAQVGVDCGAIQAGGACFEPNTVRAHAAYAMNQLYQAAGR  435

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS +PS+GSC Y
Sbjct  436  HPWNCDFRSSATLTSDNPSYGSCVY  460



>ref|XP_010459987.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=112

 Score =   107 bits (267),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCG-QGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKG  361
            ++C P   ATD QLQANI+Y+CG Q VDC PIQPGG+C+ PNTVR HA+Y MN +Y + G
Sbjct  25   QWCMPLPTATDQQLQANIDYICGGQNVDCTPIQPGGSCYEPNTVRDHASYAMNAYYHSHG  84

Query  360  RQPFQCDFSGTATITSTDPSHGSCKY  283
            R    C+F+ T      DPSHGSC Y
Sbjct  85   RIESACNFARTGCFEFHDPSHGSCIY  110



>emb|CDY45313.1| BnaA03g52860D [Brassica napus]
Length=892

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  K  ATD QLQ++I++ CGQG+DC PIQPGGACF PN V SHAA+ MN +YQ   ++
Sbjct  386  WCVSKKDATDEQLQSSIDWACGQGIDCGPIQPGGACFEPNNVASHAAFAMNMYYQKSPKR  445

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TATITS +PS+ SC Y
Sbjct  446  PTDCDFSQTATITSQNPSYNSCVY  469



>gb|EAY91326.1| hypothetical protein OsI_12942 [Oryza sativa Indica Group]
Length=464

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 62/85 (73%), Gaps = 1/85 (1%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQ-GVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            +C   A AT+A LQA+++Y C Q GVDC  IQ GGACF PNTVR+HAAY MN  YQ  GR
Sbjct  376  WCVASAGATEADLQADLDYACAQVGVDCGAIQAGGACFEPNTVRAHAAYAMNQLYQAAGR  435

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
             P+ CDF  +AT+TS +PS+GSC Y
Sbjct  436  HPWNCDFRSSATLTSDNPSYGSCVY  460



>ref|XP_010479435.1| PREDICTED: major pollen allergen Ole e 10-like [Camelina sativa]
Length=115

 Score =   107 bits (267),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 61/85 (72%), Gaps = 0/85 (0%)
 Frame = -1

Query  537  KFCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGR  358
            ++C     AT+AQLQ NIN+ C QGVDC PIQPGG+CF P+T+ SHA+++MN +YQ+ GR
Sbjct  29   QWCIATLTATNAQLQDNINFACSQGVDCGPIQPGGSCFIPDTLVSHASFVMNAYYQSHGR  88

Query  357  QPFQCDFSGTATITSTDPSHGSCKY  283
                C F  T T+  TDPS+GSC Y
Sbjct  89   IMKACSFKNTGTLAVTDPSYGSCVY  113



>emb|CDY02936.1| BnaC04g25500D [Brassica napus]
Length=452

 Score =   113 bits (282),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 79/125 (63%), Gaps = 8/125 (6%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
            F+PVY+VG+L+               P P         GK+C  K  A+DAQLQ NI++V
Sbjct  335  FSPVYDVGLLR-------NGQGGGGRPAPALPAPSTAGGKWCVAKWGASDAQLQGNIDWV  387

Query  474  CGQG-VDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSH  298
            C QG VDC+PIQ GG+CFNPN++R+HA+++MN ++Q  GR    C+FSGT  +   +PS+
Sbjct  388  CSQGGVDCKPIQAGGSCFNPNSMRTHASFVMNAYFQRNGRTDGSCNFSGTGVVVGNNPSN  447

Query  297  GSCKY  283
            G C+Y
Sbjct  448  GGCRY  452



>dbj|BAF02203.1| hypothetical protein [Arabidopsis thaliana]
Length=251

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 73/124 (59%), Gaps = 6/124 (5%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TP+Y++GIL+     + P   P    +           ++C  KA A    LQ NI+YV
Sbjct  131  LTPIYDIGILRPTFRSSDPVYNPRSPVRGSSSK------RWCVTKAGAETVALQRNIDYV  184

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG G+DCRPI  GG C+ PNTV++H+ Y MN +YQT  +  F CDF  T  IT+ DPS+G
Sbjct  185  CGLGLDCRPINEGGLCYLPNTVKAHSKYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSYG  244

Query  294  SCKY  283
            +C+Y
Sbjct  245  NCEY  248



>ref|XP_009138297.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like isoform X1 
[Brassica rapa]
Length=528

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = -1

Query  534  FCTPKAAATDAQLQANINYVCGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQ  355
            +C  K  ATD QLQ++I++ CGQG+DC  IQPGGACF PN V SHAA+ MN +YQ   ++
Sbjct  392  WCVSKKDATDEQLQSSIDWACGQGIDCGAIQPGGACFEPNNVASHAAFAMNMYYQKSPKR  451

Query  354  PFQCDFSGTATITSTDPSHGSCKY  283
            P  CDFS TATITS +PS+ SC Y
Sbjct  452  PTDCDFSQTATITSQNPSYNSCVY  475



>ref|XP_002874188.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50447.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
Length=443

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 74/124 (60%), Gaps = 6/124 (5%)
 Frame = -1

Query  654  FTPVYNVGILKAqpapalphprpnpnpqpkpkptpgrtGKFCTPKAAATDAQLQANINYV  475
             TP+Y++GIL+     + P        +  P+       ++C  KA A    LQ NI+YV
Sbjct  324  LTPIYDIGILRPTFRSSNPENNTATPVRASPEK------RWCVTKAGAETVALQRNIDYV  377

Query  474  CGQGVDCRPIQPGGACFNPNTVRSHAAYLMNTFYQTKGRQPFQCDFSGTATITSTDPSHG  295
            CG G+DCRPI  GG CF PNTV++H+ Y MN +YQT  +  F CDF  T  IT+ DPS+G
Sbjct  378  CGLGLDCRPINEGGLCFLPNTVKAHSEYAMNLYYQTMEKHEFDCDFDNTGEITTIDPSYG  437

Query  294  SCKY  283
            +C+Y
Sbjct  438  NCEY  441



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1014965446875