BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037M24

Length=722
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630346.1|  PREDICTED: diphosphomevalonate decarboxylase...    262   1e-81   Nicotiana tomentosiformis
ref|XP_006361468.1|  PREDICTED: diphosphomevalonate decarboxylase...    261   4e-81   Solanum tuberosum [potatoes]
ref|XP_009795010.1|  PREDICTED: diphosphomevalonate decarboxylase...    260   6e-81   Nicotiana sylvestris
ref|XP_009792788.1|  PREDICTED: diphosphomevalonate decarboxylase...    260   6e-81   Nicotiana sylvestris
emb|CDO99902.1|  unnamed protein product                                260   7e-81   Coffea canephora [robusta coffee]
ref|NP_001234815.1|  mevalonate disphosphate decarboxylase              260   9e-81   Solanum lycopersicum
ref|XP_009619582.1|  PREDICTED: diphosphomevalonate decarboxylase...    259   2e-80   Nicotiana tomentosiformis
gb|ABV02028.1|  mevalonate diphosphate decarboxylase                    258   4e-80   Nicotiana langsdorffii x Nicotiana sanderae
gb|AII99848.1|  mevalonate disphosphate decarboxylase                   257   1e-79   Nicotiana tabacum [American tobacco]
ref|XP_002266399.1|  PREDICTED: diphosphomevalonate decarboxylase       257   1e-79   Vitis vinifera
gb|AGZ15316.1|  mevalonate decarboxylase                                256   2e-79   Platycodon grandiflorus [balloon-flower]
gb|ADR65113.1|  mevalonate 5-diphosphate decarboxylase                  256   2e-79   Catharanthus roseus [chatas]
dbj|BAF98285.1|  diphosphomevelonate decarboxylase                      255   7e-79   Hevea brasiliensis [jebe]
ref|XP_010032077.1|  PREDICTED: diphosphomevalonate decarboxylase...    255   8e-79   Eucalyptus grandis [rose gum]
gb|AAL18927.1|AF429386_1  mevalonate disphosphate decarboxylase         253   4e-78   Hevea brasiliensis [jebe]
ref|XP_004236810.1|  PREDICTED: diphosphomevalonate decarboxylase...    253   5e-78   Solanum lycopersicum
gb|AEZ55675.1|  mevalonate diphosphate decarboxylase                    252   1e-77   Salvia miltiorrhiza [Chinese salvia]
gb|KDP35789.1|  hypothetical protein JCGZ_10425                         251   2e-77   Jatropha curcas
gb|AFK38744.1|  unknown                                                 243   2e-77   Medicago truncatula
ref|XP_002315441.1|  mevalonate disphosphate decarboxylase family...    248   4e-76   Populus trichocarpa [western balsam poplar]
gb|KEH44325.1|  mevalonate diphosphate decarboxylase                    246   1e-75   Medicago truncatula
ref|XP_002311015.1|  mevalonate disphosphate decarboxylase family...    246   2e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011024216.1|  PREDICTED: diphosphomevalonate decarboxylase...    246   2e-75   Populus euphratica
ref|XP_003555870.1|  PREDICTED: diphosphomevalonate decarboxylase...    246   3e-75   Glycine max [soybeans]
ref|XP_002521172.1|  diphosphomevalonate decarboxylase, putative        245   4e-75   Ricinus communis
ref|XP_003536712.1|  PREDICTED: diphosphomevalonate decarboxylase...    244   7e-75   Glycine max [soybeans]
ref|XP_006359351.1|  PREDICTED: diphosphomevalonate decarboxylase...    244   9e-75   
gb|KHN11470.1|  Diphosphomevalonate decarboxylase                       244   2e-74   Glycine soja [wild soybean]
gb|AFM77982.1|  mevalonate diphosphate decarboxylase                    243   4e-74   Eleutherococcus senticosus
ref|XP_004497159.1|  PREDICTED: diphosphomevalonate decarboxylase...    243   4e-74   Cicer arietinum [garbanzo]
gb|KHN37414.1|  Diphosphomevalonate decarboxylase                       248   1e-73   Glycine soja [wild soybean]
ref|XP_007010314.1|  GHMP kinase family protein isoform 1               241   2e-73   
ref|XP_010676219.1|  PREDICTED: diphosphomevalonate decarboxylase...    240   3e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|AID51442.1|  mevalonate diphosphate decarboxylase                    240   3e-73   Astragalus membranaceus
ref|XP_011032862.1|  PREDICTED: diphosphomevalonate decarboxylase...    237   4e-72   Populus euphratica
ref|XP_010244659.1|  PREDICTED: diphosphomevalonate decarboxylase...    237   7e-72   Nelumbo nucifera [Indian lotus]
ref|XP_007211744.1|  hypothetical protein PRUPE_ppa006290mg             237   8e-72   Prunus persica
emb|CDX73494.1|  BnaC08g25090D                                          236   1e-71   
ref|XP_010504223.1|  PREDICTED: diphosphomevalonate decarboxylase...    236   2e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010088787.1|  Diphosphomevalonate decarboxylase                  235   2e-71   
gb|EYU19775.1|  hypothetical protein MIMGU_mgv1a007068mg                235   3e-71   Erythranthe guttata [common monkey flower]
ref|XP_008345749.1|  PREDICTED: diphosphomevalonate decarboxylase...    235   3e-71   
ref|XP_006291202.1|  hypothetical protein CARUB_v10017330mg             235   4e-71   Capsella rubella
ref|XP_009139253.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   5e-71   Brassica rapa
emb|CDX76157.1|  BnaA04g04210D                                          234   5e-71   
ref|XP_009116111.1|  PREDICTED: diphosphomevalonate decarboxylase       234   7e-71   Brassica rapa
ref|XP_007010315.1|  GHMP kinase family protein isoform 2               234   9e-71   
ref|XP_009356125.1|  PREDICTED: diphosphomevalonate decarboxylase       234   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_006403599.1|  hypothetical protein EUTSA_v10010411mg             234   1e-70   Eutrema salsugineum [saltwater cress]
emb|CDY65399.1|  BnaCnng46900D                                          233   2e-70   Brassica napus [oilseed rape]
ref|XP_008232018.1|  PREDICTED: diphosphomevalonate decarboxylase...    233   2e-70   Prunus mume [ume]
ref|XP_002877963.1|  hypothetical protein ARALYDRAFT_906831             233   3e-70   Arabidopsis lyrata subsp. lyrata
gb|AAM65192.1|  diphosphomevalonate decarboxylase-like protein          233   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566995.1|  diphosphomevalonate decarboxylase                     233   3e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427097.1|  PREDICTED: diphosphomevalonate decarboxylase...    233   3e-70   Camelina sativa [gold-of-pleasure]
emb|CAB70999.1|  DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein         232   4e-70   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34679.1|  hypothetical protein AALP_AA5G177200                    232   5e-70   Arabis alpina [alpine rockcress]
ref|XP_008364764.1|  PREDICTED: diphosphomevalonate decarboxylase...    232   6e-70   
ref|XP_011469322.1|  PREDICTED: diphosphomevalonate decarboxylase       232   7e-70   Fragaria vesca subsp. vesca
gb|KDO47063.1|  hypothetical protein CISIN_1g014714mg                   227   8e-70   Citrus sinensis [apfelsine]
ref|XP_010515945.1|  PREDICTED: diphosphomevalonate decarboxylase...    231   9e-70   Camelina sativa [gold-of-pleasure]
ref|XP_008356850.1|  PREDICTED: diphosphomevalonate decarboxylase...    231   1e-69   
ref|XP_011084229.1|  PREDICTED: diphosphomevalonate decarboxylase...    231   2e-69   
gb|ABG24207.2|  mevalonate disphosphate decarboxylase                   231   2e-69   Arnebia euchroma
gb|KJB78629.1|  hypothetical protein B456_013G012400                    229   1e-68   Gossypium raimondii
ref|XP_006391873.1|  hypothetical protein EUTSA_v10023484mg             228   1e-68   Eutrema salsugineum [saltwater cress]
gb|KDO47062.1|  hypothetical protein CISIN_1g014714mg                   227   2e-68   Citrus sinensis [apfelsine]
gb|KDO47059.1|  hypothetical protein CISIN_1g014714mg                   227   4e-68   Citrus sinensis [apfelsine]
ref|XP_006445713.1|  hypothetical protein CICLE_v10015368mg             227   4e-68   Citrus clementina [clementine]
ref|XP_007142839.1|  hypothetical protein PHAVU_007G021200g             226   1e-67   Phaseolus vulgaris [French bean]
ref|XP_010536295.1|  PREDICTED: diphosphomevalonate decarboxylase...    223   3e-66   Tarenaya hassleriana [spider flower]
gb|AEM42974.1|  diphosphomevalonate decarboxylase                       222   4e-66   Siraitia grosvenorii [arhat fruit]
gb|KHG20401.1|  Mvd                                                     222   4e-66   Gossypium arboreum [tree cotton]
gb|KHG20400.1|  Mvd                                                     223   5e-66   Gossypium arboreum [tree cotton]
gb|ACW83616.2|  mevalonate diphosphate decarboxylase                    221   6e-66   Panax ginseng [Asiatic ginseng]
ref|XP_010536297.1|  PREDICTED: diphosphomevalonate decarboxylase...    220   1e-65   Tarenaya hassleriana [spider flower]
ref|XP_002452980.1|  hypothetical protein SORBIDRAFT_04g035950          219   7e-65   Sorghum bicolor [broomcorn]
ref|XP_010536296.1|  PREDICTED: diphosphomevalonate decarboxylase...    219   8e-65   Tarenaya hassleriana [spider flower]
gb|ADI80345.1|  mevalonate diphosphate decarboxylase                    217   3e-64   Panax ginseng [Asiatic ginseng]
ref|XP_010554524.1|  PREDICTED: diphosphomevalonate decarboxylase...    217   4e-64   Tarenaya hassleriana [spider flower]
ref|XP_004954217.1|  PREDICTED: diphosphomevalonate decarboxylase...    217   4e-64   Setaria italica
gb|AIK21783.1|  mevalonate diphosphate decarboxylase                    216   9e-64   Panax notoginseng [san-qi]
gb|AEA72605.1|  mevalonate 5-diphosphate decarboxylase                  216   1e-63   Houttuynia cordata [chameleon-plant]
ref|XP_009404708.1|  PREDICTED: diphosphomevalonate decarboxylase...    215   2e-63   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW73864.1|  hypothetical protein ZEAMMB73_421648                    213   9e-63   
ref|XP_004150845.1|  PREDICTED: diphosphomevalonate decarboxylase...    213   1e-62   Cucumis sativus [cucumbers]
gb|AFO67223.1|  putative mevalonate diphosphate decarboxylase           203   2e-62   Aralia elata
ref|XP_003565147.1|  PREDICTED: diphosphomevalonate decarboxylase...    212   2e-62   Brachypodium distachyon [annual false brome]
ref|XP_004963234.1|  PREDICTED: diphosphomevalonate decarboxylase...    212   2e-62   Setaria italica
ref|NP_001149256.1|  LOC100282878                                       212   3e-62   Zea mays [maize]
ref|XP_008446768.1|  PREDICTED: diphosphomevalonate decarboxylase       212   3e-62   Cucumis melo [Oriental melon]
emb|CAN82519.1|  hypothetical protein VITISV_042700                     211   1e-61   Vitis vinifera
ref|XP_008665378.1|  PREDICTED: diphosphomevalonate decarboxylase...    210   1e-61   Zea mays [maize]
gb|ACN41090.1|  unknown                                                 209   6e-61   Picea sitchensis
gb|EMT01953.1|  Diphosphomevalonate decarboxylase                       209   6e-61   
gb|EPS58605.1|  hypothetical protein M569_16208                         201   1e-60   Genlisea aurea
ref|XP_008665377.1|  PREDICTED: diphosphomevalonate decarboxylase...    209   2e-60   Zea mays [maize]
dbj|BAD27942.1|  putative mevalonate disphosphate decarboxylase         207   3e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006836043.1|  hypothetical protein AMTR_s00114p00051110          206   6e-60   Amborella trichopoda
gb|AAV32433.1|  mevalonate disphosphate decarboxylase                   206   9e-60   Ginkgo biloba [ginkgo]
gb|AGT17596.1|  mevalonate diphosphate decarboxylase                    205   1e-59   Picrorhiza kurrooa
emb|CDM86983.1|  unnamed protein product                                202   2e-58   Triticum aestivum [Canadian hard winter wheat]
gb|KFK36776.1|  hypothetical protein AALP_AA4G169000                    202   2e-58   Arabis alpina [alpine rockcress]
gb|EMS47869.1|  Diphosphomevalonate decarboxylase                       201   2e-58   Triticum urartu
gb|AAM64988.1|  mevalonate diphosphate decarboxylase                    200   6e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_181404.1|  mevalonate diphosphate decarboxylase 1                200   7e-58   Arabidopsis thaliana [mouse-ear cress]
tpg|DAA51253.1|  TPA: hypothetical protein ZEAMMB73_408503              209   2e-57   
ref|XP_010067136.1|  PREDICTED: diphosphomevalonate decarboxylase...    199   2e-57   Eucalyptus grandis [rose gum]
ref|XP_006294305.1|  hypothetical protein CARUB_v10023314mg             199   3e-57   Capsella rubella
ref|XP_002881611.1|  hypothetical protein ARALYDRAFT_482881             198   5e-57   
ref|XP_010509167.1|  PREDICTED: diphosphomevalonate decarboxylase...    193   3e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010505522.1|  PREDICTED: diphosphomevalonate decarboxylase...    192   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010907122.1|  PREDICTED: diphosphomevalonate decarboxylase...    190   6e-54   Elaeis guineensis
ref|XP_006646770.1|  PREDICTED: diphosphomevalonate decarboxylase...    188   3e-53   Oryza brachyantha
ref|XP_008788072.1|  PREDICTED: diphosphomevalonate decarboxylase...    182   6e-51   Phoenix dactylifera
ref|XP_011102052.1|  PREDICTED: diphosphomevalonate decarboxylase...    170   2e-49   Sesamum indicum [beniseed]
ref|XP_001773902.1|  predicted protein                                  167   5e-45   
ref|XP_001774493.1|  predicted protein                                  162   2e-43   
gb|KJB78632.1|  hypothetical protein B456_013G012400                    138   8e-35   Gossypium raimondii
gb|ADE77000.1|  unknown                                                 125   3e-32   Picea sitchensis
ref|XP_002992344.1|  hypothetical protein SELMODRAFT_135101             132   3e-32   Selaginella moellendorffii
ref|XP_002979347.1|  hypothetical protein SELMODRAFT_268244             131   4e-32   Selaginella moellendorffii
ref|XP_006411092.1|  hypothetical protein EUTSA_v10016888mg             108   6e-24   Eutrema salsugineum [saltwater cress]
gb|ACO35356.1|  mevalonate pyrophosphate decarboxylase                  102   8e-23   Elaeis oleifera
ref|XP_010067138.1|  PREDICTED: diphosphomevalonate decarboxylase...  99.8    6e-21   
ref|XP_002592260.1|  hypothetical protein BRAFLDRAFT_277163           90.9    9e-18   Branchiostoma floridae
ref|XP_010996740.1|  PREDICTED: diphosphomevalonate decarboxylase...  80.5    3e-15   Camelus dromedarius [camel]
ref|XP_005424871.1|  PREDICTED: diphosphomevalonate decarboxylase     81.6    5e-15   
ref|XP_002735076.1|  PREDICTED: diphosphomevalonate decarboxylase...  82.0    1e-14   Saccoglossus kowalevskii
ref|XP_010739786.1|  PREDICTED: diphosphomevalonate decarboxylase     81.3    2e-14   Larimichthys crocea [croceine croaker]
ref|XP_010966484.1|  PREDICTED: diphosphomevalonate decarboxylase     80.9    3e-14   Camelus bactrianus [camel]
ref|XP_002192545.2|  PREDICTED: diphosphomevalonate decarboxylase     78.6    4e-14   Taeniopygia guttata
ref|XP_004666010.1|  PREDICTED: diphosphomevalonate decarboxylase     80.5    4e-14   Jaculus jaculus
gb|AAH81784.1|  Mevalonate (diphospho) decarboxylase                  80.5    4e-14   Rattus norvegicus [brown rat]
ref|NP_112324.1|  diphosphomevalonate decarboxylase                   80.5    4e-14   Rattus norvegicus [brown rat]
ref|XP_004356734.1|  diphosphomevalonate decarboxylase                80.5    5e-14   Acanthamoeba castellanii str. Neff
ref|XP_006173825.1|  PREDICTED: diphosphomevalonate decarboxylase     80.5    5e-14   
ref|XP_008300019.1|  PREDICTED: diphosphomevalonate decarboxylase     80.1    5e-14   Stegastes partitus
ref|XP_010625831.1|  PREDICTED: diphosphomevalonate decarboxylase     80.1    5e-14   Fukomys damarensis [Damara mole rat]
gb|EIE86507.1|  diphosphomevalonate decarboxylase                     80.1    6e-14   Rhizopus delemar RA 99-880
ref|XP_008838768.1|  PREDICTED: diphosphomevalonate decarboxylase     79.7    7e-14   Nannospalax galili
ref|XP_009089159.1|  PREDICTED: diphosphomevalonate decarboxylase     79.3    9e-14   Serinus canaria [canary]
ref|XP_008403677.1|  PREDICTED: diphosphomevalonate decarboxylase     79.3    1e-13   Poecilia reticulata
ref|XP_010792093.1|  PREDICTED: diphosphomevalonate decarboxylase     79.3    1e-13   Notothenia coriiceps [yellowbelly rockcod]
emb|CAF99534.1|  unnamed protein product                              79.0    1e-13   Tetraodon nigroviridis
ref|XP_004437181.1|  PREDICTED: diphosphomevalonate decarboxylase     78.6    2e-13   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_003228605.1|  PREDICTED: diphosphomevalonate decarboxylase     78.6    2e-13   Anolis carolinensis [Carolina anole]
ref|XP_005805001.1|  PREDICTED: diphosphomevalonate decarboxylase...  78.2    2e-13   Xiphophorus maculatus
gb|ACO09861.1|  Diphosphomevalonate decarboxylase                     78.2    2e-13   Osmerus mordax
ref|XP_005411152.1|  PREDICTED: diphosphomevalonate decarboxylase     78.6    3e-13   
ref|XP_004539436.1|  PREDICTED: diphosphomevalonate decarboxylase...  77.8    3e-13   Maylandia zebra
ref|XP_010716493.1|  PREDICTED: diphosphomevalonate decarboxylase     77.8    3e-13   Meleagris gallopavo [common turkey]
ref|XP_003970115.1|  PREDICTED: diphosphomevalonate decarboxylase...  77.8    3e-13   Takifugu rubripes [tiger puffer]
gb|EHH60647.1|  hypothetical protein EGM_12056                        77.4    3e-13   Macaca fascicularis [crab eating macaque]
ref|XP_008564101.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  77.8    4e-13   Galeopterus variegatus [Malayan flying lemur]
ref|XP_004584295.1|  PREDICTED: diphosphomevalonate decarboxylase     77.4    4e-13   Ochotona princeps [southern American pika]
ref|XP_005592827.1|  PREDICTED: diphosphomevalonate decarboxylase...  77.4    4e-13   Macaca fascicularis [crab eating macaque]
ref|NP_001068892.1|  diphosphomevalonate decarboxylase                77.4    4e-13   Bos taurus [bovine]
ref|NP_001247472.1|  diphosphomevalonate decarboxylase                77.4    4e-13   Macaca mulatta [rhesus macaque]
gb|EAW66791.1|  mevalonate (diphospho) decarboxylase, isoform CRA_b   74.7    4e-13   Homo sapiens [man]
dbj|GAM24015.1|  hypothetical protein SAMD00019534_071900             77.4    5e-13   Acytostelium subglobosum LB1
ref|XP_006721255.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.1    5e-13   
ref|XP_005504910.1|  PREDICTED: diphosphomevalonate decarboxylase     76.6    5e-13   
ref|XP_007549941.1|  PREDICTED: diphosphomevalonate decarboxylase     77.0    6e-13   Poecilia formosa
gb|EAW66790.1|  mevalonate (diphospho) decarboxylase, isoform CRA_a   75.5    6e-13   Homo sapiens [man]
ref|XP_008468875.1|  PREDICTED: diphosphomevalonate decarboxylase     77.0    7e-13   
gb|KIK39127.1|  hypothetical protein CY34DRAFT_808602                 77.0    7e-13   Suillus luteus UH-Slu-Lm8-n1
ref|XP_006212468.1|  PREDICTED: diphosphomevalonate decarboxylase     77.0    7e-13   Vicugna pacos
ref|XP_002111980.1|  hypothetical protein TRIADDRAFT_55561            76.6    7e-13   Trichoplax adhaerens
ref|XP_008490184.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    8e-13   Calypte anna
ref|XP_004753891.1|  PREDICTED: diphosphomevalonate decarboxylase     76.6    9e-13   Mustela putorius furo [black ferret]
ref|XP_003460964.1|  PREDICTED: diphosphomevalonate decarboxylase     76.6    9e-13   Cavia porcellus [guinea pig]
ref|XP_005335532.1|  PREDICTED: diphosphomevalonate decarboxylase     76.3    1e-12   
ref|XP_005531982.1|  PREDICTED: diphosphomevalonate decarboxylase     76.3    1e-12   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005862568.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.9    1e-12   Myotis brandtii
ref|XP_008308874.1|  PREDICTED: diphosphomevalonate decarboxylase     76.3    1e-12   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003442298.1|  PREDICTED: diphosphomevalonate decarboxylase...  76.3    1e-12   Oreochromis niloticus
ref|XP_006987448.1|  PREDICTED: diphosphomevalonate decarboxylase     76.3    1e-12   Peromyscus maniculatus bairdii
ref|XP_007887516.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    1e-12   Callorhinchus milii [Australian ghost shark]
gb|EFA74532.1|  diphosphomevalonate decarboxylase                     75.9    1e-12   Heterostelium album PN500
dbj|BAC40852.1|  unnamed protein product                              75.9    1e-12   Mus musculus [mouse]
ref|XP_006259868.1|  PREDICTED: diphosphomevalonate decarboxylase     73.9    1e-12   
ref|XP_005892469.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    1e-12   Bos mutus
ref|XP_006780089.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.9    1e-12   Neolamprologus brichardi [lyretail cichlid]
ref|XP_006043222.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    1e-12   
ref|XP_005753004.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.9    1e-12   Pundamilia nyererei
ref|XP_010842266.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    1e-12   Bison bison bison
ref|NP_619597.2|  diphosphomevalonate decarboxylase                   75.9    1e-12   Mus musculus [mouse]
ref|XP_011188872.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    2e-12   Zeugodacus cucurbitae [melon fruit fly]
emb|CAC35731.1|  diphosphomevalonate decarboxylase                    75.9    2e-12   Mus musculus [mouse]
ref|XP_003917347.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    2e-12   Papio anubis [baboon]
ref|XP_005862569.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.9    2e-12   Myotis brandtii
ref|XP_004905145.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  75.9    2e-12   
ref|XP_003758532.1|  PREDICTED: diphosphomevalonate decarboxylase     75.9    2e-12   Sarcophilus harrisii
ref|XP_006762260.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.5    2e-12   Myotis davidii
ref|XP_009561527.1|  PREDICTED: diphosphomevalonate decarboxylase     75.5    2e-12   Cuculus canorus
ref|XP_007992523.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.9    2e-12   Chlorocebus sabaeus
emb|CEI99330.1|  Putative Diphosphomevalonate decarboxylase           75.9    2e-12   Rhizopus microsporus
ref|XP_423130.3|  PREDICTED: diphosphomevalonate decarboxylase is...  75.5    2e-12   Gallus gallus [bantam]
ref|XP_006097406.1|  PREDICTED: diphosphomevalonate decarboxylase     75.5    2e-12   Myotis lucifugus
ref|XP_003922886.1|  PREDICTED: diphosphomevalonate decarboxylase     75.5    2e-12   Saimiri boliviensis boliviensis
ref|XP_004842741.1|  PREDICTED: diphosphomevalonate decarboxylase     75.5    2e-12   Heterocephalus glaber [naked mole rat]
emb|CEG85085.1|  Putative Diphosphomevalonate decarboxylase           74.7    2e-12   Rhizopus microsporus
ref|XP_006762259.1|  PREDICTED: diphosphomevalonate decarboxylase...  75.5    2e-12   Myotis davidii
ref|XP_004015005.1|  PREDICTED: diphosphomevalonate decarboxylase     75.1    2e-12   
ref|XP_005345851.1|  PREDICTED: diphosphomevalonate decarboxylase     75.1    3e-12   Microtus ochrogaster [prairie voles]
ref|XP_005073260.1|  PREDICTED: diphosphomevalonate decarboxylase     75.1    3e-12   Mesocricetus auratus [Syrian golden hamster]
ref|XP_001488083.1|  PREDICTED: diphosphomevalonate decarboxylase     75.1    3e-12   Equus caballus [domestic horse]
ref|XP_008506971.1|  PREDICTED: diphosphomevalonate decarboxylase     75.1    3e-12   Equus przewalskii [Przewalski horse]
ref|XP_004362385.1|  diphosphomevalonate decarboxylase                75.1    3e-12   Cavenderia fasciculata
ref|XP_005819249.1|  mevalonate pyrophosphate decarboxylase           75.1    3e-12   Guillardia theta CCMP2712
ref|XP_005256369.1|  PREDICTED: diphosphomevalonate decarboxylase...  74.7    3e-12   
gb|AAP36301.1|  Homo sapiens mevalonate (diphospho) decarboxylase     75.1    3e-12   synthetic construct
ref|NP_002452.1|  diphosphomevalonate decarboxylase                   75.1    3e-12   Homo sapiens [man]
ref|XP_004310733.1|  PREDICTED: diphosphomevalonate decarboxylase     74.7    3e-12   
ref|XP_009079223.1|  PREDICTED: diphosphomevalonate decarboxylase     72.4    3e-12   Acanthisitta chloris
ref|XP_004280113.1|  PREDICTED: diphosphomevalonate decarboxylase     74.7    3e-12   Orcinus orca [Orca]
ref|XP_003418108.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  74.7    4e-12   Loxodonta africana [African bush elephant]
ref|XP_006734134.1|  PREDICTED: diphosphomevalonate decarboxylase     74.7    4e-12   Leptonychotes weddellii
ref|XP_006888835.1|  PREDICTED: diphosphomevalonate decarboxylase     74.7    4e-12   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003495141.1|  PREDICTED: diphosphomevalonate decarboxylase...  74.7    4e-12   Cricetulus griseus [Chinese hamsters]
ref|XP_004058175.1|  PREDICTED: diphosphomevalonate decarboxylase     74.7    4e-12   
gb|AAH08526.1|  Mevalonate (diphospho) decarboxylase                  74.7    4e-12   Mus musculus [mouse]
ref|XP_009902760.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  74.7    4e-12   Picoides pubescens
emb|CDQ87522.1|  unnamed protein product                              74.7    4e-12   Oncorhynchus mykiss
ref|XP_005915248.1|  PREDICTED: diphosphomevalonate decarboxylase...  74.7    4e-12   Haplochromis burtoni
emb|CEG64400.1|  Putative Diphosphomevalonate decarboxylase           74.7    4e-12   Rhizopus microsporus
ref|XP_010353864.1|  PREDICTED: diphosphomevalonate decarboxylase...  74.3    5e-12   Rhinopithecus roxellana
ref|XP_008137975.1|  PREDICTED: diphosphomevalonate decarboxylase     74.3    5e-12   Eptesicus fuscus
ref|XP_003287684.1|  hypothetical protein DICPUDRAFT_32847            74.3    5e-12   Dictyostelium purpureum
ref|XP_007670945.1|  PREDICTED: diphosphomevalonate decarboxylase     74.7    5e-12   
ref|XP_011497479.1|  PREDICTED: diphosphomevalonate decarboxylase     74.3    5e-12   Ceratosolen solmsi marchali
ref|XP_003805806.1|  PREDICTED: diphosphomevalonate decarboxylase     74.3    5e-12   Pan paniscus [bonobo]
pdb|3F0N|A  Chain A, Mus Musculus Mevalonate Pyrophosphate Decarb...  74.3    5e-12   Mus musculus [mouse]
gb|ELU38465.1|  diphosphomevalonate decarboxylase                     74.3    5e-12   Rhizoctonia solani AG-1 IA
ref|XP_003800873.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  74.3    5e-12   
ref|XP_523460.3|  PREDICTED: diphosphomevalonate decarboxylase        74.3    5e-12   
ref|XP_005691918.1|  PREDICTED: diphosphomevalonate decarboxylase     74.3    5e-12   
ref|XP_001376834.1|  PREDICTED: diphosphomevalonate decarboxylase     74.3    5e-12   Monodelphis domestica
ref|XP_010577890.1|  PREDICTED: diphosphomevalonate decarboxylase     74.3    5e-12   Haliaeetus leucocephalus
ref|XP_005956369.1|  PREDICTED: diphosphomevalonate decarboxylase     74.3    6e-12   Pantholops hodgsonii [Tibetan antelope]
gb|EHH31936.1|  hypothetical protein EGK_13104                        73.9    6e-12   Macaca mulatta [rhesus macaque]
ref|XP_007651118.1|  PREDICTED: diphosphomevalonate decarboxylase...  73.9    6e-12   Cricetulus griseus [Chinese hamsters]
ref|NP_001007423.1|  diphosphomevalonate decarboxylase                74.3    6e-12   Danio rerio [leopard danio]
ref|XP_007244091.1|  PREDICTED: diphosphomevalonate decarboxylase     73.9    6e-12   
ref|NP_001133968.1|  Diphosphomevalonate decarboxylase                73.9    7e-12   Salmo salar
dbj|BAE42019.1|  unnamed protein product                              73.9    7e-12   Mus musculus [mouse]
ref|XP_004600545.1|  PREDICTED: diphosphomevalonate decarboxylase     73.9    7e-12   Sorex araneus [Eurasian shrew]
ref|XP_005235566.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  74.3    8e-12   
ref|XP_004944353.1|  PREDICTED: diphosphomevalonate decarboxylase...  74.3    9e-12   
gb|EUC58622.1|  diphosphomevalonate decarboxylase                     73.6    9e-12   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_004392172.1|  PREDICTED: diphosphomevalonate decarboxylase     73.6    1e-11   Odobenus rosmarus divergens
gb|KDN34074.1|  hypothetical protein RSAG8_12833                      73.6    1e-11   Rhizoctonia solani AG-8 WAC10335
ref|XP_006027907.1|  PREDICTED: diphosphomevalonate decarboxylase     73.6    1e-11   Alligator sinensis
emb|CCA67606.1|  probable MVD1-mevalonate pyrophosphate decarboxy...  73.6    1e-11   Serendipita indica DSM 11827
ref|XP_006008325.1|  PREDICTED: diphosphomevalonate decarboxylase...  73.2    1e-11   Latimeria chalumnae
ref|XP_002913420.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  73.2    1e-11   
ref|XP_007468497.1|  PREDICTED: diphosphomevalonate decarboxylase     73.2    1e-11   Lipotes vexillifer [baiji]
ref|XP_008925899.1|  PREDICTED: diphosphomevalonate decarboxylase...  73.2    1e-11   
ref|XP_546783.2|  PREDICTED: diphosphomevalonate decarboxylase        73.2    1e-11   Canis lupus familiaris [dogs]
ref|XP_004944354.1|  PREDICTED: diphosphomevalonate decarboxylase...  73.2    1e-11   
ref|XP_002028521.1|  GL14496                                          72.8    2e-11   Drosophila persimilis
ref|XP_004377812.1|  PREDICTED: diphosphomevalonate decarboxylase     72.8    2e-11   Trichechus manatus latirostris
gb|KIK57461.1|  hypothetical protein GYMLUDRAFT_86887                 73.2    2e-11   Gymnopus luxurians FD-317 M1
ref|XP_010877776.1|  PREDICTED: diphosphomevalonate decarboxylase     72.8    2e-11   Esox lucius
ref|XP_011370192.1|  PREDICTED: diphosphomevalonate decarboxylase     72.8    2e-11   Pteropus vampyrus
ref|XP_007407867.1|  hypothetical protein MELLADRAFT_74468            72.8    2e-11   Melampsora larici-populina 98AG31
ref|XP_002176299.1|  MPDC mevalonate diphosphate decarboxylase        72.8    2e-11   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_008072935.1|  PREDICTED: diphosphomevalonate decarboxylase     72.8    2e-11   
emb|CCO29766.1|  diphosphomevalonate decarboxylase                    72.0    2e-11   Rhizoctonia solani AG-1 IB
ref|XP_006926815.1|  PREDICTED: diphosphomevalonate decarboxylase     72.8    2e-11   Pteropus alecto
ref|XP_006152769.1|  PREDICTED: diphosphomevalonate decarboxylase     72.8    2e-11   
ref|XP_002761300.1|  PREDICTED: diphosphomevalonate decarboxylase     72.4    2e-11   Callithrix jacchus [common marmoset]
emb|CCU99826.1|  unnamed protein product                              72.4    2e-11   Malassezia sympodialis ATCC 42132
emb|CEP12016.1|  hypothetical protein                                 72.4    2e-11   Parasitella parasitica
gb|EMS24001.1|  diphosphomevalonate decarboxylase                     72.4    2e-11   Rhodotorula toruloides NP11
gb|AFS28685.1|  putative phosphomevalonate kinase                     66.6    3e-11   Olea europaea
ref|XP_003325100.1|  diphosphomevalonate decarboxylase                72.4    3e-11   Puccinia graminis f. sp. tritici CRL 75-36-700-3
emb|CEI98959.1|  Putative Diphosphomevalonate decarboxylase           72.0    3e-11   Rhizopus microsporus
ref|XP_004645091.1|  PREDICTED: diphosphomevalonate decarboxylase     72.0    3e-11   
ref|XP_006860173.1|  PREDICTED: diphosphomevalonate decarboxylase     71.6    4e-11   
ref|XP_004944352.1|  PREDICTED: diphosphomevalonate decarboxylase...  72.0    4e-11   
ref|XP_007937353.1|  PREDICTED: diphosphomevalonate decarboxylase     71.6    5e-11   
ref|XP_005182349.1|  PREDICTED: diphosphomevalonate decarboxylase     71.2    5e-11   
gb|KIY47272.1|  Diphosphomevalonate decarboxylase                     71.2    5e-11   
ref|XP_011201583.1|  PREDICTED: diphosphomevalonate decarboxylase     71.2    6e-11   
gb|EPB83704.1|  diphosphomevalonate decarboxylase                     71.2    7e-11   
emb|CDQ81132.1|  unnamed protein product                              70.9    7e-11   
gb|AFI45055.1|  diphosphomevalonate decarboxylase                     70.9    7e-11   
gb|KDR67556.1|  hypothetical protein GALMADRAFT_258221                70.9    8e-11   
gb|ERL86359.1|  hypothetical protein D910_03767                       70.9    8e-11   
gb|AEE63249.1|  unknown                                               70.9    8e-11   
ref|XP_007125574.1|  PREDICTED: diphosphomevalonate decarboxylase...  70.5    8e-11   
ref|XP_002100713.1|  GE17215                                          70.9    8e-11   
ref|XP_008190498.1|  PREDICTED: diphosphomevalonate decarboxylase...  70.9    8e-11   
ref|XP_007431690.1|  PREDICTED: diphosphomevalonate decarboxylase     70.9    8e-11   
gb|ESW97073.1|  Diphosphomevalonate decarboxylase                     70.5    9e-11   
ref|XP_970108.1|  PREDICTED: diphosphomevalonate decarboxylase is...  70.5    9e-11   
gb|KDN43409.1|  putative MVD1-mevalonate pyrophosphate decarboxylase  70.9    9e-11   
ref|XP_007125573.1|  PREDICTED: diphosphomevalonate decarboxylase...  70.5    1e-10   
gb|EYU19776.1|  hypothetical protein MIMGU_mgv1a007068mg              69.7    1e-10   
gb|KIM31275.1|  hypothetical protein M408DRAFT_64547                  70.5    1e-10   
ref|XP_001628780.1|  predicted protein                                70.5    1e-10   
ref|XP_007172621.1|  PREDICTED: diphosphomevalonate decarboxylase     70.5    1e-10   
ref|XP_007125572.1|  PREDICTED: diphosphomevalonate decarboxylase...  70.5    1e-10   
ref|XP_005292289.1|  PREDICTED: diphosphomevalonate decarboxylase     70.1    1e-10   
ref|XP_008701026.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  70.5    1e-10   
gb|ELR58766.1|  Diphosphomevalonate decarboxylase                     70.1    1e-10   
gb|EST08482.1|  mevalonate pyrophosphate decarboxylase                70.1    1e-10   
ref|XP_642143.1|  diphosphomevalonate decarboxylase                   69.7    2e-10   
ref|XP_003702160.1|  PREDICTED: diphosphomevalonate decarboxylase...  69.7    2e-10   
dbj|GAC71303.1|  mevalonate pyrophosphate decarboxylase               69.7    2e-10   
ref|XP_003484695.1|  PREDICTED: diphosphomevalonate decarboxylase...  69.7    2e-10   
ref|XP_003424007.1|  PREDICTED: diphosphomevalonate decarboxylase...  69.3    2e-10   
ref|XP_011069488.1|  PREDICTED: diphosphomevalonate decarboxylase...  65.1    2e-10   
ref|XP_002432413.1|  Diphosphomevalonate decarboxylase, putative      69.3    2e-10   
ref|XP_002075379.1|  GK17667                                          69.3    2e-10   
ref|XP_001600914.2|  PREDICTED: diphosphomevalonate decarboxylase...  69.3    3e-10   
emb|CBQ72380.1|  probable MVD1-mevalonate pyrophosphate decarboxy...  69.3    3e-10   
emb|CCF49632.1|  probable MVD1-mevalonate pyrophosphate decarboxy...  69.3    3e-10   
gb|KIJ49692.1|  hypothetical protein M422DRAFT_205223                 68.9    3e-10   
gb|ENN75638.1|  hypothetical protein YQE_07816                        68.9    3e-10   
gb|ELW62889.1|  Diphosphomevalonate decarboxylase                     68.9    3e-10   
emb|CDS06586.1|  hypothetical protein LRAMOSA09114                    68.9    3e-10   
ref|XP_007339537.1|  Diphosphomevalonate decarboxylase                68.9    4e-10   
ref|XP_011388229.1|  putative mevalonate pyrophosphate decarboxylase  68.9    4e-10   
emb|CCL99644.1|  predicted protein                                    68.6    4e-10   
gb|KIM45531.1|  hypothetical protein M413DRAFT_442202                 68.6    4e-10   
ref|XP_001200662.2|  PREDICTED: diphosphomevalonate decarboxylase...  68.6    4e-10   
gb|KII92627.1|  hypothetical protein PLICRDRAFT_102539                68.6    5e-10   
ref|XP_007059404.1|  PREDICTED: diphosphomevalonate decarboxylase     68.6    5e-10   
dbj|GAK63159.1|  diphosphomevalonate decarboxylase                    68.2    6e-10   
ref|XP_004704798.1|  PREDICTED: diphosphomevalonate decarboxylase     68.2    6e-10   
ref|XP_005497597.1|  PREDICTED: diphosphomevalonate decarboxylase     67.8    6e-10   
ref|XP_006569701.1|  PREDICTED: diphosphomevalonate decarboxylase...  67.8    6e-10   
ref|XP_009066482.1|  hypothetical protein LOTGIDRAFT_211321           68.2    6e-10   
ref|XP_007371446.1|  Diphosphomevalonate decarboxylase                67.8    7e-10   
gb|AAH63907.1|  mvd-prov protein                                      67.8    8e-10   
ref|XP_001121619.2|  PREDICTED: diphosphomevalonate decarboxylase...  67.8    8e-10   
ref|XP_002942038.1|  PREDICTED: diphosphomevalonate decarboxylase...  67.8    8e-10   
ref|XP_009029357.1|  hypothetical protein HELRODRAFT_185177           67.8    8e-10   
gb|KIS02378.1|  diphosphomevalonate decarboxylase                     67.8    8e-10   
ref|XP_004913618.1|  PREDICTED: diphosphomevalonate decarboxylase...  67.8    8e-10   
ref|XP_007878778.1|  hypothetical protein PFL1_03071                  67.8    9e-10   
ref|XP_004535245.1|  PREDICTED: diphosphomevalonate decarboxylase...  67.8    9e-10   
ref|XP_008553889.1|  PREDICTED: diphosphomevalonate decarboxylase     67.8    9e-10   
ref|XP_004535244.1|  PREDICTED: diphosphomevalonate decarboxylase...  67.8    9e-10   
ref|XP_008911959.1|  hypothetical protein PPTG_15496                  65.5    1e-09   
gb|KJE94982.1|  diphosphomevalonate decarboxylase                     67.4    1e-09   
ref|XP_004346191.2|  diphosphomevalonate decarboxylase                67.4    1e-09   
dbj|GAC92971.1|  hypothetical protein PHSY_000531                     67.4    1e-09   
ref|XP_002050863.1|  GJ19966                                          67.0    1e-09   
dbj|GAN02670.1|  diphosphomevalonate decarboxylase                    67.0    1e-09   
ref|XP_001830848.1|  diphosphomevalonate decarboxylase                67.0    1e-09   
ref|NP_001267865.1|  diphosphomevalonate decarboxylase                67.0    1e-09   
ref|XP_009495556.1|  hypothetical protein H696_03415                  67.0    2e-09   
ref|XP_002005564.1|  GI19000                                          67.0    2e-09   
ref|XP_003998380.1|  PREDICTED: diphosphomevalonate decarboxylase     66.6    2e-09   
ref|XP_007532001.1|  PREDICTED: diphosphomevalonate decarboxylase     66.6    2e-09   
ref|NP_014441.1|  diphosphomevalonate decarboxylase MVD1              66.6    2e-09   
gb|AAT93171.1|  YNR043W                                               66.6    2e-09   
gb|AJT25337.1|  Mvd1p                                                 66.6    2e-09   
ref|XP_009547604.1|  hypothetical protein HETIRDRAFT_440521           66.6    2e-09   
gb|ETK77494.1|  diphosphomevalonate decarboxylase                     66.6    2e-09   
ref|XP_001978042.1|  GG17907                                          66.2    3e-09   
ref|XP_006623086.1|  PREDICTED: diphosphomevalonate decarboxylase...  66.2    3e-09   
gb|AFR94390.1|  diphosphomevalonate decarboxylase                     66.2    3e-09   
ref|NP_573068.3|  CG8239, isoform A                                   65.9    3e-09   
ref|XP_002551773.1|  KLTH0A07238p                                     65.9    3e-09   
ref|XP_001904058.1|  hypothetical protein                             65.9    3e-09   
gb|KIY64502.1|  Diphosphomevalonate decarboxylase                     65.9    4e-09   
ref|XP_773574.1|  hypothetical protein CNBI1880                       65.9    4e-09   
gb|KJA27615.1|  hypothetical protein HYPSUDRAFT_130498                65.9    4e-09   
ref|XP_003672668.1|  hypothetical protein NDAI_0K02340                65.5    4e-09   
ref|XP_006403598.1|  hypothetical protein EUTSA_v10010411mg           65.1    4e-09   
emb|CDH14431.1|  related to Diphosphomevalonate decarboxylase         63.2    5e-09   
ref|XP_568247.1|  diphosphomevalonate decarboxylase                   65.5    5e-09   
gb|KIR46285.1|  diphosphomevalonate decarboxylase                     65.1    6e-09   
ref|XP_002497180.1|  ZYRO0D17270p                                     65.1    6e-09   
ref|XP_002174502.2|  diphosphomevalonate decarboxylase                65.1    6e-09   
gb|KIR59630.1|  diphosphomevalonate decarboxylase                     65.1    6e-09   
gb|ETL84188.1|  diphosphomevalonate decarboxylase                     65.1    7e-09   
gb|KDO31253.1|  diphosphomevalonate decarboxylase                     64.7    7e-09   
gb|AJP70489.1|  diphosphomevalonate decarboxylase                     65.1    8e-09   
emb|CDK26220.1|  unnamed protein product                              65.1    8e-09   
gb|KIK02242.1|  hypothetical protein K443DRAFT_677763                 65.1    8e-09   
ref|XP_001646609.1|  hypothetical protein Kpol_1028p24                65.1    8e-09   
gb|KDQ55805.1|  hypothetical protein JAAARDRAFT_195621                64.7    8e-09   
gb|ETI37283.1|  diphosphomevalonate decarboxylase                     65.1    8e-09   
gb|KGB78727.1|  diphosphomevalonate decarboxylase                     64.7    8e-09   
gb|EPX71457.1|  diphosphomevalonate decarboxylase                     64.7    8e-09   
ref|XP_008613422.1|  hypothetical protein SDRG_09280                  64.7    9e-09   
ref|XP_002980943.1|  hypothetical protein SELMODRAFT_420483           61.6    9e-09   
gb|ETL30939.1|  diphosphomevalonate decarboxylase                     64.7    9e-09   
gb|EMD33647.1|  hypothetical protein CERSUDRAFT_117755                64.7    9e-09   
gb|EPY53329.1|  diphosphomevalonate decarboxylase                     64.7    1e-08   
ref|XP_003743316.1|  PREDICTED: diphosphomevalonate decarboxylase...  64.3    1e-08   
ref|XP_009853586.1|  diphosphomevalonate decarboxylase                64.3    1e-08   
ref|XP_010014419.1|  PREDICTED: diphosphomevalonate decarboxylase     62.4    1e-08   
gb|AEB00646.1|  mevalonate pyrophosphate decarboxylase                64.3    1e-08   
gb|AJT04035.1|  Mvd1p                                                 64.3    1e-08   
gb|KFM61632.1|  Diphosphomevalonate decarboxylase                     64.3    1e-08   
ref|XP_003351303.1|  hypothetical protein SMAC_03607                  64.3    1e-08   
emb|CDI52963.1|  probable MVD1-mevalonate pyrophosphate decarboxy...  64.3    1e-08   
ref|XP_004989623.1|  diphosphomevalonate decarboxylase                64.3    1e-08   
gb|AJT16805.1|  Mvd1p                                                 63.9    1e-08   
gb|KIM80987.1|  hypothetical protein PILCRDRAFT_9034                  61.2    1e-08   
gb|AJT26802.1|  Mvd1p                                                 63.9    1e-08   
gb|EDN62849.1|  mevalonate pyrophosphate decarboxylase                63.9    1e-08   
gb|KIK91362.1|  hypothetical protein PAXRUDRAFT_830905                63.9    1e-08   
gb|AJT30847.1|  Mvd1p                                                 63.9    1e-08   
gb|KDQ27550.1|  hypothetical protein PLEOSDRAFT_1093271               63.9    1e-08   
gb|AJT04410.1|  Mvd1p                                                 63.9    2e-08   
gb|KIO19559.1|  hypothetical protein M407DRAFT_16104                  63.9    2e-08   
ref|XP_006692565.1|  diphosphomevalonate decarboxylase-like protein   63.9    2e-08   
dbj|GAA26136.1|  K7_Mvd1p                                             63.9    2e-08   
gb|AJT02547.1|  Mvd1p                                                 63.9    2e-08   
gb|AJT07024.1|  Mvd1p                                                 63.9    2e-08   
gb|EDZ69577.1|  YNR043Wp-like protein                                 63.9    2e-08   
ref|XP_003029710.1|  hypothetical protein SCHCODRAFT_69496            63.9    2e-08   
ref|XP_002898035.1|  diphosphomevalonate decarboxylase                63.9    2e-08   
gb|KIM71639.1|  hypothetical protein PILCRDRAFT_82589                 61.2    2e-08   
ref|XP_002616213.1|  hypothetical protein CLUG_03454                  63.9    2e-08   
gb|AJT22350.1|  Mvd1p                                                 63.9    2e-08   
gb|EEU08298.1|  Mvd1p                                                 63.9    2e-08   
gb|AJT18309.1|  Mvd1p                                                 63.9    2e-08   
gb|EDV12224.1|  mevalonate pyrophosphate decarboxylase                63.9    2e-08   
gb|EPT04682.1|  hypothetical protein FOMPIDRAFT_1140388               63.5    2e-08   
ref|XP_008862510.1|  diphosphomevalonate decarboxylase                63.5    2e-08   
gb|EMT05412.1|  Diphosphomevalonate decarboxylase                     61.2    2e-08   
ref|XP_001728068.1|  diphosphomevalonate decarboxylase                63.5    2e-08   
ref|XP_011416922.1|  PREDICTED: diphosphomevalonate decarboxylase...  63.5    2e-08   
pdb|1FI4|A  Chain A, The X-Ray Crystal Structure Of Mevalonate 5-...  63.5    2e-08   
emb|CDO69145.1|  hypothetical protein BN946_scf185042.g47             63.5    2e-08   
ref|XP_005769632.1|  mevalonate-5-diphosphate decarboxylase           63.5    2e-08   
gb|KDE07680.1|  diphosphomevalonate decarboxylase                     63.5    2e-08   
gb|KIM44772.1|  hypothetical protein M413DRAFT_442732                 63.5    3e-08   
gb|ESA02764.1|  hypothetical protein GLOINDRAFT_337188                63.2    3e-08   
ref|XP_007835624.1|  Diphosphomevalonate decarboxylase                63.2    3e-08   
ref|XP_001731467.1|  hypothetical protein MGL_1650                    63.2    3e-08   
ref|XP_001986237.1|  GH20637                                          63.2    3e-08   
ref|XP_001873551.1|  predicted protein                                63.2    3e-08   
gb|ACO11575.1|  Diphosphomevalonate decarboxylase                     62.8    4e-08   
ref|XP_456912.2|  DEHA2A13398p                                        62.8    4e-08   
gb|EMC89325.1|  Diphosphomevalonate decarboxylase                     62.0    4e-08   
gb|EKC33371.1|  Diphosphomevalonate decarboxylase                     63.2    4e-08   
ref|XP_007317911.1|  hypothetical protein SERLADRAFT_466408           62.8    5e-08   
ref|XP_008180336.1|  PREDICTED: diphosphomevalonate decarboxylase...  62.4    5e-08   
ref|XP_001228660.1|  hypothetical protein CHGG_02144                  62.8    5e-08   
dbj|GAA52910.1|  diphosphomevalonate decarboxylase                    60.8    5e-08   
ref|XP_007266924.1|  Diphosphomevalonate decarboxylase                62.4    5e-08   
ref|NP_001192100.1|  diphosphomevalonate decarboxylase                62.4    6e-08   
ref|XP_003193399.1|  diphosphomevalonate decarboxylase                62.4    6e-08   
ref|XP_003693647.1|  PREDICTED: diphosphomevalonate decarboxylase...  62.4    6e-08   
ref|XP_007381587.1|  Diphosphomevalonate decarboxylase                62.4    6e-08   
ref|XP_007334426.1|  hypothetical protein AGABI1DRAFT_116646          62.4    6e-08   
gb|KIR53986.1|  diphosphomevalonate decarboxylase                     62.4    6e-08   
ref|XP_007001967.1|  hypothetical protein TREMEDRAFT_67459            62.4    6e-08   
gb|KIL66419.1|  hypothetical protein M378DRAFT_389057                 62.4    6e-08   
ref|XP_007372031.1|  hypothetical protein SPAPADRAFT_132255           62.0    7e-08   
emb|CBJ48557.1|  Diphosphomevalonate decarboxylase                    62.0    7e-08   
ref|XP_002287031.1|  mevalonate disphosphate decarboxylase-like p...  62.0    7e-08   
ref|XP_009527984.1|  hypothetical protein PHYSODRAFT_500398           62.0    7e-08   
ref|XP_445335.1|  hypothetical protein                                62.0    7e-08   
ref|XP_009821608.1|  diphosphomevalonate decarboxylase                61.6    9e-08   
ref|XP_009460469.1|  PREDICTED: diphosphomevalonate decarboxylase     59.7    9e-08   
ref|XP_007308164.1|  Diphosphomevalonate decarboxylase                61.6    9e-08   
gb|KFH65647.1|  diphosphomevalonate decarboxylase                     61.6    1e-07   
gb|EKG21526.1|  Diphosphomevalonate decarboxylase                     61.6    1e-07   
gb|KIL85051.1|  diphosphomevalonate decarboxylase                     61.6    1e-07   
ref|XP_003654883.1|  diphosphomevalonate decarboxylase                61.6    1e-07   
gb|KDO47060.1|  hypothetical protein CISIN_1g014714mg                 61.2    1e-07   
gb|EMP36260.1|  Diphosphomevalonate decarboxylase                     61.6    1e-07   
gb|EJT51120.1|  diphosphomevalonate decarboxylase                     61.6    1e-07   
ref|XP_005432373.1|  PREDICTED: diphosphomevalonate decarboxylase     60.8    1e-07   
ref|XP_007821634.1|  Diphosphomevalonate decarboxylase                61.2    1e-07   
ref|XP_003663678.1|  diphosphomevalonate decarboxylase                61.2    1e-07   
gb|EHN00406.1|  Mvd1p                                                 61.2    1e-07   
gb|EKC98468.1|  diphosphomevalonate decarboxylase                     61.2    1e-07   
ref|XP_003688208.1|  hypothetical protein TPHA_0M01990                61.2    2e-07   
ref|XP_004067388.1|  PREDICTED: diphosphomevalonate decarboxylase     60.8    2e-07   
gb|KID80423.1|  diphosphomevalonate decarboxylase                     61.2    2e-07   
emb|CCF47485.1|  diphosphomevalonate decarboxylase                    60.8    2e-07   
gb|KFG78069.1|  diphosphomevalonate decarboxylase                     60.8    2e-07   
ref|XP_003645059.1|  hypothetical protein Ecym_2521                   60.5    2e-07   
ref|XP_006457330.1|  hypothetical protein AGABI2DRAFT_196085          60.8    2e-07   
gb|KFO95652.1|  Diphosphomevalonate decarboxylase                     59.7    2e-07   
ref|XP_001880930.1|  predicted protein                                60.8    2e-07   
ref|XP_005052358.1|  PREDICTED: diphosphomevalonate decarboxylase     60.5    2e-07   
ref|XP_005592828.1|  PREDICTED: diphosphomevalonate decarboxylase...  60.5    2e-07   
ref|XP_006445714.1|  hypothetical protein CICLE_v10015368mg           60.5    2e-07   
ref|XP_011126590.1|  hypothetical protein AOL_s00188g39               60.5    3e-07   
ref|XP_002549983.1|  diphosphomevalonate decarboxylase                60.5    3e-07   
ref|XP_007992525.1|  PREDICTED: diphosphomevalonate decarboxylase...  60.5    3e-07   
ref|XP_003383859.1|  PREDICTED: diphosphomevalonate decarboxylase...  60.1    3e-07   
ref|XP_009275590.1|  PREDICTED: diphosphomevalonate decarboxylase     58.9    3e-07   
ref|XP_005105464.1|  PREDICTED: diphosphomevalonate decarboxylase...  60.1    3e-07   
ref|XP_007010316.1|  GHMP kinase family protein isoform 3             60.1    3e-07   
ref|XP_009821609.1|  diphosphomevalonate decarboxylase, variant       60.1    3e-07   
ref|XP_003868196.1|  Mvd mevalonate diphosphate decarboxylase         60.1    3e-07   



>ref|XP_009630346.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   262 bits (670),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHR+ISCVEKWNRSEGTPQVAYTFDAGPNAV+IARNRKAA L++QRLLF+F
Sbjct  280  PPIFYMNDTSHRVISCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKAATLMLQRLLFHF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSDTDL+SYVIGDKSIL DAGI+D+ DVEALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  340  PPNSDTDLNSYVIGDKSILKDAGIQDIKDVEALPPPPEIKDKVPAQKYKGEISYFICTRP  399

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L+D++ ALLNPETGLPK
Sbjct  400  GRGPVLLTDDSHALLNPETGLPK  422



>ref|XP_006361468.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=421

 Score =   261 bits (666),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 134/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHR+ISCVEKWNR+EGTPQVAYTFDAGPNAV+IARNRKAAAL++QRLLF+F
Sbjct  279  PPIFYMNDTSHRVISCVEKWNRAEGTPQVAYTFDAGPNAVLIARNRKAAALMLQRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSDTDL SYVIGDKSIL DAGI+DLNDVEALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  339  PPNSDTDLDSYVIGDKSILKDAGIQDLNDVEALPPPPEIKDKVPAQKCKGEISYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L DE+QALL  ETGLPK
Sbjct  399  GRGPVLLPDESQALLCLETGLPK  421



>ref|XP_009795010.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 134/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHR+I CVEKWNRSEGTPQVAYTFDAGPNAV+IARNRKAA L++QRLLF+F
Sbjct  279  PPIFYMNDTSHRVIGCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKAATLMLQRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSDTDL+SYVIGDKSIL DAGI+D+ DVEALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  339  PPNSDTDLNSYVIGDKSILKDAGIQDIKDVEALPPPPEIKDKVPAQKYKGEISYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L+D++ ALLNPETGLPK
Sbjct  399  GRGPVLLTDDSHALLNPETGLPK  421



>ref|XP_009792788.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAV+IARNR +AALL+QRLLF+F
Sbjct  279  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRTSAALLLQRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNS+TDL+SYVIGDKSIL DAGI+++ DVEALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  339  PPNSETDLNSYVIGDKSILKDAGIQEIKDVEALPPPPEIKDKVPVQKCKGEISYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV++SDE+QALLNP TGLPK
Sbjct  399  GRGPVLISDESQALLNPYTGLPK  421



>emb|CDO99902.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 136/147 (93%), Gaps = 5/147 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHR----IISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRL  549
            PPIFYMNDTSHR    IISCVEKWNRSEGTPQVAYTFDAGPNAV+IARNRK AALL+QRL
Sbjct  278  PPIFYMNDTSHRQAIWIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAALLLQRL  337

Query  548  LFYFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFI  372
            LF+FPP SD DL+SY++GDKS+L DAGI+DL DVEALPPPPEIKDN+PT K KGDVSYFI
Sbjct  338  LFHFPPQSDADLNSYIVGDKSVLMDAGIQDLKDVEALPPPPEIKDNVPTQKFKGDVSYFI  397

Query  371  CTRPGRGPVVLSDETQALLNPETGLPK  291
            CTRPGRGPV+L++E+QALLNPETGLPK
Sbjct  398  CTRPGRGPVLLTEESQALLNPETGLPK  424



>ref|NP_001234815.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
 gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
Length=422

 Score =   260 bits (664),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHR+ISCVEKWNR+EGTPQVAYTFDAGPNAV+IARNRKAA L++QRLLF+F
Sbjct  280  PPIFYMNDTSHRVISCVEKWNRAEGTPQVAYTFDAGPNAVLIARNRKAATLMLQRLLFHF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSDTDL SYVIGDKSIL DAGIKDLND+EALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  340  PPNSDTDLDSYVIGDKSILKDAGIKDLNDIEALPPPPEIKDKVPAQKCKGEISYFICTRP  399

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L DE+QALL  ETGLPK
Sbjct  400  GRGPVLLPDESQALLCLETGLPK  422



>ref|XP_009619582.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   259 bits (662),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAV+IARNR +AALL+QRLLF+F
Sbjct  279  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRTSAALLLQRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNS+TDL+SYVIGDKSIL DAGI ++ DVEALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  339  PPNSETDLNSYVIGDKSILKDAGIPEIKDVEALPPPPEIKDKVPVQKCKGEISYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV++SDE+QALLNP+TGLPK
Sbjct  399  GRGPVLISDESQALLNPDTGLPK  421



>gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=406

 Score =   258 bits (658),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 133/142 (94%), Gaps = 1/142 (1%)
 Frame = -1

Query  713  PIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFP  534
            PIFYMNDTSHR+I CVEKWNRSEGTPQVAYTFDAGPNAV+IARNRKAA L++QRLLF+FP
Sbjct  265  PIFYMNDTSHRVIGCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKAATLMLQRLLFHFP  324

Query  533  PNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPG  357
            PNSDTDL+SYVIGDKSIL DAGI+D+ DVEALPPPPEIKD +P  K KG++SYFICTRPG
Sbjct  325  PNSDTDLNSYVIGDKSILKDAGIQDIKDVEALPPPPEIKDKVPAQKYKGEISYFICTRPG  384

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPV+L+D++ ALLNPETGLPK
Sbjct  385  RGPVLLTDDSHALLNPETGLPK  406



>gb|AII99848.1| mevalonate disphosphate decarboxylase [Nicotiana tabacum]
Length=418

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHR+I CVEKWNRSEGTPQVAYT DAGPNAV+IARNRKAA L++QRLLF+F
Sbjct  276  PPIFYMNDTSHRVIGCVEKWNRSEGTPQVAYTSDAGPNAVLIARNRKAATLMLQRLLFHF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSDTDL+SYVIGDKSIL DAGI+D+ DVEALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  336  PPNSDTDLNSYVIGDKSILKDAGIQDIKDVEALPPPPEIKDKVPAQKYKGEISYFICTRP  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L+D++ ALLNPETGLPK
Sbjct  396  GRGPVLLTDDSHALLNPETGLPK  418



>ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase [Vitis vinifera]
 emb|CBI35263.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   257 bits (656),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAV+IAR+RK AA L+QRLL+YF
Sbjct  280  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARDRKVAANLLQRLLYYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP+SDTDL+SYVIGDKSILGD G++++ DVEALPPPPE KD IP  K +G VSYFICTRP
Sbjct  340  PPHSDTDLNSYVIGDKSILGDVGVEEMKDVEALPPPPETKDQIPAQKQRGAVSYFICTRP  399

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GPV+LSDE+QALLNPE+GLPK
Sbjct  400  GKGPVLLSDESQALLNPESGLPK  422



>gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus]
Length=417

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNR+EGTPQVAYTFDAGPNAV++ARNRK AALL+QRLLF+F
Sbjct  275  PPIFYMNDTSHRIISCVEKWNRAEGTPQVAYTFDAGPNAVLVARNRKTAALLLQRLLFHF  334

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP SDT+L SYVIGDK+IL D G++D+ DVEAL PPPEIKD IPT K+KGDVSYFICTRP
Sbjct  335  PPQSDTNLDSYVIGDKTILQDVGVQDMKDVEALTPPPEIKDYIPTQKSKGDVSYFICTRP  394

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVLSDE+QALL+P TGLPK
Sbjct  395  GRGPVVLSDESQALLDPVTGLPK  417



>gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharanthus roseus]
Length=421

 Score =   256 bits (655),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAV+IARNRKAA LL+QRLLFYF
Sbjct  279  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKAATLLLQRLLFYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP S  +L+SYV+GDKSIL DAGI+D+ DVE+L PPPE+KDNIP  K KGDVSYFICTRP
Sbjct  339  PPESGANLNSYVVGDKSILKDAGIQDMKDVESLCPPPEVKDNIPAQKYKGDVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L++E+Q+LLNPETGLPK
Sbjct  399  GRGPVLLTEESQSLLNPETGLPK  421



>dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   255 bits (651),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRS GTPQVAYTFDAGPNAV+IA NRKAAA L+Q+LLFYF
Sbjct  276  PPIFYMNDTSHRIISCVEKWNRSVGTPQVAYTFDAGPNAVLIAHNRKAAAQLLQKLLFYF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSDT+L+SYV+GDKSIL DAGI+DL DVEALPPPPEIKD    + KGDVSYFICTRPG
Sbjct  336  PPNSDTELNSYVLGDKSILKDAGIEDLKDVEALPPPPEIKD--APRYKGDVSYFICTRPG  393

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPV+LSDE+QALL+PETGLPK
Sbjct  394  RGPVLLSDESQALLSPETGLPK  415



>ref|XP_010032077.1| PREDICTED: diphosphomevalonate decarboxylase-like [Eucalyptus 
grandis]
 gb|KCW51467.1| hypothetical protein EUGRSUZ_J00991 [Eucalyptus grandis]
Length=418

 Score =   255 bits (651),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 135/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRII+CVEKWNRSE  PQVAYTFDAGPNAV+IARNRKAA+LL+QRLL+YF
Sbjct  276  PPIFYMNDTSHRIINCVEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAASLLIQRLLYYF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPN +TD++SYV+GDKSIL DAGI+ ++DVEALPPPPEIKD IP  KN+G+VSYFICTRP
Sbjct  336  PPNPETDMNSYVLGDKSILKDAGIQGIDDVEALPPPPEIKDKIPAQKNRGEVSYFICTRP  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVLSDE+QAL++P+TGLPK
Sbjct  396  GRGPVVLSDESQALIDPKTGLPK  418



>gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   253 bits (646),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRS GTPQVAYTFDAGPNAV+IA NRKAAA L+Q+LLFYF
Sbjct  276  PPIFYMNDTSHRIISCVEKWNRSVGTPQVAYTFDAGPNAVLIAHNRKAAAQLLQKLLFYF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSDT+L+SYV+GDKSIL DAGI+DL DVEALPPPPEIKD    + KGDVSYFICTRPG
Sbjct  336  PPNSDTELNSYVLGDKSILKDAGIEDLKDVEALPPPPEIKD--APRYKGDVSYFICTRPG  393

Query  356  RGPVVLSDETQALLNPETGLPK  291
            +GPV+LSDE+QALL+PETGLPK
Sbjct  394  QGPVLLSDESQALLSPETGLPK  415



>ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum lycopersicum]
Length=421

 Score =   253 bits (645),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 134/143 (94%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAV+IARNR  AALL+QRLLF+F
Sbjct  279  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRTYAALLLQRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNS+TDL+SYVIGDKS++ D GI+D+ D+EALPPPPEIKD +P  K KG++SYFICTRP
Sbjct  339  PPNSETDLNSYVIGDKSLMEDIGIQDIKDIEALPPPPEIKDKVPAQKYKGEISYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV++SD++QALL+P+TGLPK
Sbjct  399  GRGPVLISDDSQALLHPDTGLPK  421



>gb|AEZ55675.1| mevalonate diphosphate decarboxylase [Salvia miltiorrhiza]
Length=422

 Score =   252 bits (643),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/144 (80%), Positives = 132/144 (92%), Gaps = 1/144 (1%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
            LPPIFYMNDTSHRII CVEKWNR EG+PQVAYTFDAGPNAV+I++NRK AALL+QRLLF+
Sbjct  279  LPPIFYMNDTSHRIIGCVEKWNRHEGSPQVAYTFDAGPNAVLISKNRKTAALLLQRLLFH  338

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTR  363
            FPP SD DL+SYVIGDK+IL DAGI+DL D+EAL PPPEIK+N  T+  +GDVSYFICTR
Sbjct  339  FPPQSDADLNSYVIGDKTILKDAGIEDLKDIEALAPPPEIKENASTQRCRGDVSYFICTR  398

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
            PGRGPVVL+DE+Q+L+NPETGLPK
Sbjct  399  PGRGPVVLADESQSLINPETGLPK  422



>gb|KDP35789.1| hypothetical protein JCGZ_10425 [Jatropha curcas]
Length=415

 Score =   251 bits (641),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 131/142 (92%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISC+EKWN  EGTPQVAYTFDAGPNAV+IA+NRK AA L+Q+LLF+F
Sbjct  276  PPIFYMNDTSHRIISCIEKWNCCEGTPQVAYTFDAGPNAVLIAQNRKTAAQLLQKLLFFF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSDTDL+SYVIGDKSIL DAGI+++ DVEALPPPPEIKD   ++ KGDVSYFICTRPG
Sbjct  336  PPNSDTDLNSYVIGDKSILKDAGIQEIKDVEALPPPPEIKD--ASRYKGDVSYFICTRPG  393

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPV+LSDE+ ALLNPETGLPK
Sbjct  394  RGPVLLSDESHALLNPETGLPK  415



>gb|AFK38744.1| unknown [Medicago truncatula]
Length=191

 Score =   243 bits (621),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSE  PQVAYTFDAGPNAV+IARNRKAA LL+Q+LL+YF
Sbjct  50   PPIFYMNDTSHRIISIVEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAATLLIQKLLYYF  109

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSD DL+SY+IGDKSI  DAGI  + D+EALPPPPEIKDNIP+ K KGDVSYFICTRP
Sbjct  110  PPNSD-DLNSYIIGDKSIAKDAGINGIEDIEALPPPPEIKDNIPSQKYKGDVSYFICTRP  168

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL+DE+QALLN E GLPK
Sbjct  169  GRGPVVLTDESQALLNSENGLPK  191



>ref|XP_002315441.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEF01612.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSE TPQVAYTFDAGPNAV+IA NRKAA  L+Q+LLFYF
Sbjct  277  PPIFYMNDTSHRIISCVEKWNRSEETPQVAYTFDAGPNAVLIAHNRKAATQLLQKLLFYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP+SD DL+SYVIGDKSIL DAGI+D+ DVEAL PPPEIK+    ++KGDVSYFICT+PG
Sbjct  337  PPSSDADLNSYVIGDKSILKDAGIEDMKDVEALSPPPEIKN--AQRSKGDVSYFICTKPG  394

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPV+LSDE+QALL+PETGLPK
Sbjct  395  RGPVLLSDESQALLHPETGLPK  416



>gb|KEH44325.1| mevalonate diphosphate decarboxylase [Medicago truncatula]
Length=418

 Score =   246 bits (629),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 129/143 (90%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSE  PQVAYTFDAGPNAV+IARNRKAA LL+Q+LL+YF
Sbjct  277  PPIFYMNDTSHRIISIVEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAATLLIQKLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSD DL+SY+IGDKSI  DAGI  + D+EALPPPPEIKDNIP+ K KGDVSYFICTRP
Sbjct  337  PPNSD-DLNSYIIGDKSIAKDAGINGIEDIEALPPPPEIKDNIPSQKYKGDVSYFICTRP  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL+DE+QALLN E GLPK
Sbjct  396  GRGPVVLTDESQALLNSENGLPK  418



>ref|XP_002311015.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEE88382.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   246 bits (628),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 128/142 (90%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWN SEGTPQVAYTFDAGPNAV+IA NRKAA  L+Q+LLF F
Sbjct  277  PPIFYMNDTSHRIISCVEKWNCSEGTPQVAYTFDAGPNAVLIAHNRKAATQLMQKLLFCF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP+SD DL+SYVIGDKSIL DAGI+D+ DVEALPPPPEIKD    + KGDVSYFICT+PG
Sbjct  337  PPSSDADLNSYVIGDKSILKDAGIEDIKDVEALPPPPEIKD--AQRCKGDVSYFICTKPG  394

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGP +LSDE+QALL+PETGLPK
Sbjct  395  RGPALLSDESQALLHPETGLPK  416



>ref|XP_011024216.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   246 bits (627),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSE TPQVAYTFDAGPNAV+IA NRKAA  L+Q+LLFYF
Sbjct  277  PPIFYMNDTSHRIISCVEKWNRSEETPQVAYTFDAGPNAVLIAHNRKAATQLLQKLLFYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP+SD DL+SYVIGDKSIL DAGI+D+ DVEAL PPPEIK+    ++KGDVSYFICT+PG
Sbjct  337  PPSSDADLNSYVIGDKSILKDAGIEDMKDVEALSPPPEIKN--AQRSKGDVSYFICTKPG  394

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPV+L DE+QALL+PETGLPK
Sbjct  395  RGPVLLYDESQALLHPETGLPK  416



>ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=421

 Score =   246 bits (627),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSE  PQVAYTFDAGPNAV+IARNRKAA  L+QRLL+YF
Sbjct  280  PPIFYMNDTSHRIISIVEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAATSLIQRLLYYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSD DLSSY+IGDKSI  DAGI  + DVEALPPPPEIKDNIP+ K KGDVSYFICTRP
Sbjct  340  PPNSD-DLSSYIIGDKSIAKDAGINGIQDVEALPPPPEIKDNIPSQKYKGDVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+LSD  QALLN ETGLPK
Sbjct  399  GRGPVLLSDSIQALLNDETGLPK  421



>ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
 gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
Length=415

 Score =   245 bits (626),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 130/142 (92%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSE TPQVAYTFDAGPNAV+IA+NRK A  L+Q+LL+YF
Sbjct  276  PPIFYMNDTSHRIISCVEKWNRSEETPQVAYTFDAGPNAVLIAQNRKTAVQLLQKLLYYF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSDTDL+SYV+GDKSIL DAGI+++ DVE+LP PPEIKD    + KGDVSYFICTRPG
Sbjct  336  PPNSDTDLNSYVLGDKSILKDAGIEEMKDVESLPAPPEIKD--APRFKGDVSYFICTRPG  393

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPV+L+DE+QALLNP+TGLPK
Sbjct  394  RGPVLLTDESQALLNPQTGLPK  415



>ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=420

 Score =   244 bits (624),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS  EKWNRSE  PQVAYTFDAGPNAV+IARNRKAA  L+QRLL+YF
Sbjct  279  PPIFYMNDTSHRIISIAEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAATSLIQRLLYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNI-PTKNKGDVSYFICTRP  360
            PPNSD DLSSY+IGDKSI  DAGI  + DVEALPPPPEIKDNI P K KGDVSYFICTRP
Sbjct  339  PPNSD-DLSSYIIGDKSIAKDAGINGIQDVEALPPPPEIKDNIPPQKYKGDVSYFICTRP  397

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+LSD +QALLN ETGLPK
Sbjct  398  GRGPVLLSDSSQALLNGETGLPK  420



>ref|XP_006359351.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=429

 Score =   244 bits (624),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAV+IARNR + +LL+QRLLF+F
Sbjct  287  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARNRTSTSLLLQRLLFHF  346

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNS+TDL+SYVIGDKS++ D GI+D+ D+EALPPPPEIK  +P  K KG++SYFICTRP
Sbjct  347  PPNSETDLNSYVIGDKSLMEDIGIQDIKDIEALPPPPEIKGKVPAQKYKGEISYFICTRP  406

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV++S ++QALL+P++GLPK
Sbjct  407  GRGPVLISGDSQALLHPDSGLPK  429



>gb|KHN11470.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=421

 Score =   244 bits (622),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSE  PQVAYTFDAGPNAV+IARNR AA  L+QRLL+YF
Sbjct  280  PPIFYMNDTSHRIISIVEKWNRSEEAPQVAYTFDAGPNAVLIARNRNAATSLIQRLLYYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSD DLSSY+IGDKSI  DAGI  + DVEALPPPPEIKDNIP+ K KGDVSYFICTRP
Sbjct  340  PPNSD-DLSSYIIGDKSIAKDAGINGIQDVEALPPPPEIKDNIPSQKYKGDVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+LSD  QALLN ETGLPK
Sbjct  399  GRGPVLLSDSIQALLNDETGLPK  421



>gb|AFM77982.1| mevalonate diphosphate decarboxylase [Eleutherococcus senticosus]
Length=420

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 132/143 (92%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPI YMNDTS++II+CVEKWNRSEGTPQVAYTFDAGPNAV+IAR+RK AALL+QRLLF+F
Sbjct  279  PPISYMNDTSYKIINCVEKWNRSEGTPQVAYTFDAGPNAVLIARDRKTAALLLQRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP+SDTDL+SYVIGDKSIL D G++D+ DV+ALPPPPEIKDNIP  K+KGDVSYFICT+P
Sbjct  339  PPHSDTDLNSYVIGDKSILQDVGVQDIKDVKALPPPPEIKDNIPAQKSKGDVSYFICTKP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGP +L D +QALLNPETG PK
Sbjct  399  GRGPFLLPD-SQALLNPETGFPK  420



>ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cicer arietinum]
Length=421

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 117/143 (82%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSE  PQVAYTFDAGPNAV+IARNRKAA LL+QRLL+YF
Sbjct  280  PPIFYMNDTSHRIISIVEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAATLLIQRLLYYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSD DL+SY+IGDKSI  DAGI  + D+E LPPPPEIKDNIP+ K KG+VSYFICTRP
Sbjct  340  PPNSD-DLNSYIIGDKSIAKDAGINGIPDIETLPPPPEIKDNIPSQKYKGEVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+LSDE+QALLN E GLPK
Sbjct  399  GRGPVLLSDESQALLNSENGLPK  421



>gb|KHN37414.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=658

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/189 (70%), Positives = 143/189 (76%), Gaps = 10/189 (5%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS  EKWNRSE  PQVAYTFDAGPNAV+IARNRKAA  L+QRLL+YF
Sbjct  279  PPIFYMNDTSHRIISIAEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAATSLIQRLLYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNI-PTKNKGDVSYFICTRP  360
            PPNSD DLSSY+IGDKSI  DAGI  + DVEALPPPPEIKDNI P K KGDVSYFICTRP
Sbjct  339  PPNSD-DLSSYIIGDKSIAKDAGINGIQDVEALPPPPEIKDNIPPQKYKGDVSYFICTRP  397

Query  359  GRGPVVLSDETQALLNPETGLPK*RTKRFLSQKLPF*NGKVLCNHYNSRHFLLSFFVSS-  183
            GRGPV+LSD +QALLN ETGLPK R    L+ KL       LC  Y+S  F    F +S 
Sbjct  398  GRGPVLLSDNSQALLNGETGLPKMRPAG-LTWKL---KTLTLCKAYSSMAFHAMDFETSI  453

Query  182  ---WVPFRV  165
               W P  V
Sbjct  454  EFFWAPLLV  462



>ref|XP_007010314.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
 gb|EOY19124.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
Length=418

 Score =   241 bits (614),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEG+PQVAYTFDAGPNAV+IARNRKAAA L+QRLLFYF
Sbjct  276  PPIFYMNDTSHRIISYVEKWNRSEGSPQVAYTFDAGPNAVLIARNRKAAAQLLQRLLFYF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP SD DL SYVIGDKSIL DAG++ L DVEAL PPPEIK+N    K  G+VSYFICTRP
Sbjct  336  PPKSDIDLDSYVIGDKSILQDAGLEGLKDVEALSPPPEIKENAAAQKYPGEVSYFICTRP  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L++E  ALLNPETGLPK
Sbjct  396  GRGPVLLTNENLALLNPETGLPK  418



>ref|XP_010676219.1| PREDICTED: diphosphomevalonate decarboxylase-like [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 131/143 (92%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSH+IIS VEKWNRSE TPQVAYTFDAGPNAV+IAR+RKAA+LL+QR+LF+F
Sbjct  278  PPIFYMNDTSHKIISIVEKWNRSEETPQVAYTFDAGPNAVLIARDRKAASLLLQRMLFHF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKD-NIPTKNKGDVSYFICTRP  360
            PP ++TDL+SYVIGDKSIL DAGIK++ DVE+LP PPE+KD N   K+ GDVSYFICTRP
Sbjct  338  PPGAETDLNSYVIGDKSILQDAGIKNIKDVESLPNPPELKDANSIQKHPGDVSYFICTRP  397

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP VLSDE+Q+LLNPETGLPK
Sbjct  398  GQGPTVLSDESQSLLNPETGLPK  420



>gb|AID51442.1| mevalonate diphosphate decarboxylase [Astragalus membranaceus]
Length=420

 Score =   240 bits (613),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSE  PQVAYTFDAGPNAV+IARNRKAA +L+Q+LL+YF
Sbjct  279  PPIFYMNDTSHRIISIVEKWNRSEEAPQVAYTFDAGPNAVLIARNRKAATILIQKLLYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSD DL SY+IGDKSI  DAGI  + D+EALPPP EIKD IP+ K KGDVSYFICTRP
Sbjct  339  PPNSD-DLDSYIIGDKSIAKDAGINGIQDIEALPPPSEIKDKIPSQKYKGDVSYFICTRP  397

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGP VLSDE+QALLN E GLPK
Sbjct  398  GRGPAVLSDESQALLNSENGLPK  420



>ref|XP_011032862.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            P IFYMNDTSHRIISCVEKWN SEG PQVAYTFDAGPNAV+IA +R AA  L+Q+LLF F
Sbjct  277  PTIFYMNDTSHRIISCVEKWNCSEGMPQVAYTFDAGPNAVLIAHDRNAATQLMQKLLFCF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP+SD DL+SYVIGDKSIL DAGI+D+ DVEALPPPPEIKD    + KGDVSYFICT+PG
Sbjct  337  PPSSDADLNSYVIGDKSILKDAGIEDIKDVEALPPPPEIKD--AQRCKGDVSYFICTKPG  394

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGP +LSDE+QALL+PETGLPK
Sbjct  395  RGPALLSDESQALLHPETGLPK  416



>ref|XP_010244659.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nelumbo nucifera]
Length=421

 Score =   237 bits (604),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 128/143 (90%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRS GTPQVAYTFDAGPNAV+IARNR+ A+L++QRLLFYF
Sbjct  279  PPIFYMNDTSHRIISYVEKWNRSAGTPQVAYTFDAGPNAVLIARNREVASLMLQRLLFYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP   T+L+SYV+GDKSIL DAG++   DVEAL PPPE KDNIP+ K  GDVSYFICTRP
Sbjct  339  PPPPATELTSYVLGDKSILKDAGLEMRKDVEALSPPPETKDNIPSQKYAGDVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L+DE+QALL+PETGLPK
Sbjct  399  GRGPVLLADESQALLHPETGLPK  421



>ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
 gb|EMJ12943.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
Length=419

 Score =   237 bits (604),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNR+ GTPQVAYTFDAGPNAV+IARNR+ AALLVQ+LLF F
Sbjct  279  PPIFYMNDTSHRIISLVEKWNRAAGTPQVAYTFDAGPNAVLIARNRETAALLVQKLLFCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP SD DL+S+V+GDKSIL DAG++ L  +E+LP PPEIKD    +++GDVSYFICTRPG
Sbjct  339  PPKSDADLNSFVLGDKSILKDAGVESLEAIESLPAPPEIKDP-SQRHRGDVSYFICTRPG  397

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPVVLSDE+Q LLNPETGLPK
Sbjct  398  RGPVVLSDESQFLLNPETGLPK  419



>emb|CDX73494.1| BnaC08g25090D [Brassica napus]
Length=419

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   N VE L PPPEIKDNI T++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGENSVENLQPPPEIKDNIGTQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+PETGLPK
Sbjct  397  GRGPVVLPDQTQALLDPETGLPK  419



>ref|XP_010504223.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504224.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504225.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+ + N VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDEANGVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+VL D+TQALL+PETGLPK
Sbjct  397  GKGPIVLHDQTQALLDPETGLPK  419



>ref|XP_010088787.1| Diphosphomevalonate decarboxylase [Morus notabilis]
 gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis]
Length=400

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/134 (84%), Positives = 123/134 (92%), Gaps = 1/134 (1%)
 Frame = -1

Query  689  SHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLS  510
            S++IIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK AALL+QRLLFYFPPNSD DL+
Sbjct  267  SNQIISIVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAALLLQRLLFYFPPNSDADLN  326

Query  509  SYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSD  333
            SY+ GDKSIL DAG+  L DVEALPPPPEIKDNIP+ K +GDVSYFICTRPGRGPV LSD
Sbjct  327  SYIHGDKSILQDAGLAGLKDVEALPPPPEIKDNIPSQKYRGDVSYFICTRPGRGPVYLSD  386

Query  332  ETQALLNPETGLPK  291
            E+QALLNPETGLPK
Sbjct  387  ESQALLNPETGLPK  400



>gb|EYU19775.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=421

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
            LPPIFYMNDTSH+IISCVEKWNR EGTPQVAYTFDAGPNAV+I+ NRK AALL+QRLLF 
Sbjct  279  LPPIFYMNDTSHKIISCVEKWNRHEGTPQVAYTFDAGPNAVLISHNRKTAALLLQRLLFL  338

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            FPP SDTDL SYVIGDK+IL DAGI ++ DVEAL PPPE+K+N PT+NKGDVSYFICTRP
Sbjct  339  FPPQSDTDLDSYVIGDKTILKDAGIHEMKDVEALAPPPELKENAPTRNKGDVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL+DE+++L+N ETGLPK
Sbjct  399  GRGPVVLNDESRSLINSETGLPK  421



>ref|XP_008345749.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN++EGTPQVAYTFDAGPNAV+IARNRK AALLVQ+LLF F
Sbjct  279  PPIFYMNDTSHRIISLVEKWNKAEGTPQVAYTFDAGPNAVLIARNRKTAALLVQKLLFCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSD DL+S+V+GDKSIL DAG++   D+E LPPPPEIKD    K +GDVSYFICTRPG
Sbjct  339  PPNSDADLNSFVLGDKSILKDAGVESPEDIETLPPPPEIKDP-SQKFRGDVSYFICTRPG  397

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPVVLSDE+  LLNPETGLPK
Sbjct  398  RGPVVLSDESH-LLNPETGLPK  418



>ref|XP_006291202.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
 gb|EOA24100.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
Length=419

 Score =   235 bits (599),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTDL SYV+GD SIL +AG+ + + VE L PPPEIKDNI T++ KG+VSYFICTRP
Sbjct  337  PPKSDTDLKSYVVGDNSILKEAGLDEASGVENLQPPPEIKDNIGTQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+V+ D+TQALL+PETGLPK
Sbjct  397  GKGPIVIHDQTQALLDPETGLPK  419



>ref|XP_009139253.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brassica rapa]
Length=419

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   N VE L PPPEIKDNI +++ KG+VSYFICT+P
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGANSVENLQPPPEIKDNIGSQDQKGEVSYFICTKP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+PETGLPK
Sbjct  397  GRGPVVLPDQTQALLDPETGLPK  419



>emb|CDX76157.1| BnaA04g04210D [Brassica napus]
Length=419

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   N VE L PPPEIKDNI +++ KG+VSYFICT+P
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGANSVENLQPPPEIKDNIGSQDQKGEVSYFICTKP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+PETGLPK
Sbjct  397  GRGPVVLPDQTQALLDPETGLPK  419



>ref|XP_009116111.1| PREDICTED: diphosphomevalonate decarboxylase [Brassica rapa]
 emb|CDX78223.1| BnaA09g34180D [Brassica napus]
Length=419

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   N VE L PPPEI+DNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGENSVENLQPPPEIRDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+PETGLPK
Sbjct  397  GRGPVVLPDQTQALLDPETGLPK  419



>ref|XP_007010315.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY19125.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
Length=417

 Score =   234 bits (596),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 125/143 (87%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEG+P VAYTFDAGPNAV+IARNRKAAA L+QRLLFYF
Sbjct  276  PPIFYMNDTSHRIISYVEKWNRSEGSP-VAYTFDAGPNAVLIARNRKAAAQLLQRLLFYF  334

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP SD DL SYVIGDKSIL DAG++ L DVEAL PPPEIK+N    K  G+VSYFICTRP
Sbjct  335  PPKSDIDLDSYVIGDKSILQDAGLEGLKDVEALSPPPEIKENAAAQKYPGEVSYFICTRP  394

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L++E  ALLNPETGLPK
Sbjct  395  GRGPVLLTNENLALLNPETGLPK  417



>ref|XP_009356125.1| PREDICTED: diphosphomevalonate decarboxylase [Pyrus x bretschneideri]
Length=418

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN++EGTPQVAYTFDAGPNAV+IARNRK AALL+Q+LLF F
Sbjct  279  PPIFYMNDTSHRIISLVEKWNKAEGTPQVAYTFDAGPNAVLIARNRKTAALLIQKLLFCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSD DLSS+V+GDKSIL DAG++   D+E LP PPEIKD    K +GDVSYFICTRPG
Sbjct  339  PPNSDADLSSFVLGDKSILKDAGVESPGDIETLPAPPEIKDP-SQKFRGDVSYFICTRPG  397

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPVVLSDE+  LLNPETGLPK
Sbjct  398  RGPVVLSDESH-LLNPETGLPK  418



>ref|XP_006403599.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45052.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=419

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+I+RNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLISRNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   N VE+L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMRSYVVGDHSILKEAGLDGENSVESLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+T ALL+PETGLPK
Sbjct  397  GRGPVVLPDQTHALLHPETGLPK  419



>emb|CDY65399.1| BnaCnng46900D [Brassica napus]
Length=419

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP S+TD+ SYV+GD SIL +AG+   N VE L PPPEIKDNI +++ KG+VSYFICT+P
Sbjct  337  PPKSETDMKSYVVGDNSILKEAGLDGANSVENLQPPPEIKDNIGSQDQKGEVSYFICTKP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+PETGLPK
Sbjct  397  GRGPVVLPDQTQALLDPETGLPK  419



>ref|XP_008232018.1| PREDICTED: diphosphomevalonate decarboxylase-like [Prunus mume]
Length=419

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN + GTPQVAYTFDAGPNAV+IARNR+ AALLVQ+LLF F
Sbjct  279  PPIFYMNDTSHRIISLVEKWNCAAGTPQVAYTFDAGPNAVLIARNRETAALLVQKLLFCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP SD DL+S+V+GDKSIL DAG++ L  +E+LP PPEIKD    +++GDVSYFICTRPG
Sbjct  339  PPKSDADLNSFVLGDKSILKDAGVESLEAIESLPAPPEIKDP-SQRHRGDVSYFICTRPG  397

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPVVLSDE+Q LLNPETGLPK
Sbjct  398  RGPVVLSDESQFLLNPETGLPK  419



>ref|XP_002877963.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54222.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV GD SIL +AG+   + VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVAGDNSILKEAGLDGASGVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+VL D+TQALLNPETGLPK
Sbjct  397  GKGPIVLHDQTQALLNPETGLPK  419



>gb|AAM65192.1| diphosphomevalonate decarboxylase-like protein [Arabidopsis thaliana]
Length=419

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   + VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGASGVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+VL D+TQALL+PETGLPK
Sbjct  397  GKGPIVLHDQTQALLDPETGLPK  419



>ref|NP_566995.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
 gb|AEE79204.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
Length=419

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   + VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGASGVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+VL D+TQALL+PETGLPK
Sbjct  397  GKGPIVLHDQTQALLDPETGLPK  419



>ref|XP_010427097.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010427098.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   + VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGASGVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+VL D+TQALL+PETGLPK
Sbjct  397  GKGPIVLHDQTQALLDPETGLPK  419



>emb|CAB70999.1| DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein [Arabidopsis thaliana]
Length=413

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  271  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  330

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   + VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  331  PPKSDTDMKSYVVGDNSILKEAGLDGASGVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  390

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+VL D+TQALL+PETGLPK
Sbjct  391  GKGPIVLHDQTQALLDPETGLPK  413



>gb|KFK34679.1| hypothetical protein AALP_AA5G177200 [Arabis alpina]
Length=419

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SIL +AG+   N VE+L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKPDTDMRSYVVGDTSILKEAGLDGANSVESLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+P TGLPK
Sbjct  397  GRGPVVLHDQTQALLDPVTGLPK  419



>ref|XP_008364764.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 125/142 (88%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN +EGTPQVAYTFDAGPNAV+IARNR+ AALL+Q+LLF F
Sbjct  279  PPIFYMNDTSHRIISLVEKWNXAEGTPQVAYTFDAGPNAVLIARNRETAALLIQKLLFCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSD DL+S+V+GDKSIL DAG++   D+E LPPPPEIKD    K +GDVSYFICTRPG
Sbjct  339  PPNSDADLNSFVLGDKSILKDAGVESPEDIETLPPPPEIKDP-SQKFRGDVSYFICTRPG  397

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPVVLSDE+  LLNPETGLPK
Sbjct  398  RGPVVLSDESH-LLNPETGLPK  418



>ref|XP_011469322.1| PREDICTED: diphosphomevalonate decarboxylase [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   232 bits (591),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 124/142 (87%), Gaps = 3/142 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAVMIAR+RK A LL+Q+LL+ F
Sbjct  280  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVMIARDRKTATLLLQKLLYTF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSD DL+S+V+GDKSIL DAGI    D+ +LPPPPEIK     + KGDVSYFICTRPG
Sbjct  340  PPNSDADLNSFVLGDKSILKDAGINCPEDIASLPPPPEIKGQ---QYKGDVSYFICTRPG  396

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPVVLSDET+ LL+PETG+PK
Sbjct  397  RGPVVLSDETKFLLDPETGMPK  418



>gb|KDO47063.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
 gb|KDO47064.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=277

 Score =   227 bits (579),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VE+WNRS G+PQVAYTFDAGPNAV+IARNRK A  L+QRLLF+F
Sbjct  134  PPIFYMNDTSHRIISYVERWNRSVGSPQVAYTFDAGPNAVLIARNRKIATELLQRLLFFF  193

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNS+TDL+SYV+GDKSIL DAGI  + D+EALP PPEI +    K  GDV+YFICTRPG
Sbjct  194  PPNSETDLNSYVLGDKSILRDAGIDGMKDIEALPLPPEINNISAQKYSGDVNYFICTRPG  253

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GPV+LSD+++ALLNP++GLPK
Sbjct  254  GGPVLLSDDSKALLNPKSGLPK  275



>ref|XP_010515945.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515946.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515947.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   231 bits (590),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 125/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IARNRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIARNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SIL +AG+ + + VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKPDTDMKSYVVGDNSILKEAGLDEASSVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP+VL D+TQALL+PETGLPK
Sbjct  397  GKGPIVLHDQTQALLDPETGLPK  419



>ref|XP_008356850.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN +EGTPQVAYTFDAGPNAV+IARNR  AALL+Q+LLF F
Sbjct  279  PPIFYMNDTSHRIISLVEKWNXAEGTPQVAYTFDAGPNAVLIARNRXTAALLIQKLLFCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNSD DL+S+V+GDKSIL DAG++   D+E LPPPPEIKD    K +GDVSYFICTRPG
Sbjct  339  PPNSDADLNSFVLGDKSILKDAGVESPEDIETLPPPPEIKDP-SQKFRGDVSYFICTRPG  397

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPVVLSDE+  LLNPETGLPK
Sbjct  398  RGPVVLSDESH-LLNPETGLPK  418



>ref|XP_011084229.1| PREDICTED: diphosphomevalonate decarboxylase-like [Sesamum indicum]
Length=422

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 132/143 (92%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIISCVEKWNR EGTPQVAYTFDAGPNAV+I+ NRKAAALL+QRLLFYF
Sbjct  280  PPIFYMNDTSHRIISCVEKWNRFEGTPQVAYTFDAGPNAVLISNNRKAAALLLQRLLFYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP +D DL+SYVIGDK+IL DAGI+++ D+EAL PPPEIKDN  T K +GDVSYFICTRP
Sbjct  340  PPQADADLNSYVIGDKTILQDAGIQNVKDIEALTPPPEIKDNTQTQKYRGDVSYFICTRP  399

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL+DE+++L+NPETGLPK
Sbjct  400  GRGPVVLTDESRSLINPETGLPK  422



>gb|ABG24207.2| mevalonate disphosphate decarboxylase [Arnebia euchroma]
Length=421

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNA MIARNRK A LL+Q+LL+ F
Sbjct  279  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAAMIARNRKVATLLLQKLLYCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP +D DL SYVIGDKS+L +AG+  +NDV+AL PPPE+  ++P  + KGDVSYFICTRP
Sbjct  339  PPQADADLDSYVIGDKSLLKEAGVGTMNDVDALAPPPELTTSVPAQRTKGDVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GPV+L+DE QALL+ +TGLPK
Sbjct  399  GKGPVLLTDENQALLDSKTGLPK  421



>gb|KJB78629.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
 gb|KJB78630.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=415

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 124/143 (87%), Gaps = 2/143 (1%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
            LPPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IAR+RKAAA L+QRLLFY
Sbjct  275  LPPIFYMNDTSHRIISYVEKWNRSEGTPQVAYTFDAGPNAVLIARDRKAAAQLIQRLLFY  334

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            FPP SDTDL SY++GDK+IL DAG++ L DVEAL  PPE  +    K  GDVSYFICTRP
Sbjct  335  FPPKSDTDLDSYLLGDKTILKDAGLEGLKDVEALSSPPE--NGSAQKYPGDVSYFICTRP  392

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP++LS++  ALL+PETGLPK
Sbjct  393  GKGPILLSNDKLALLDPETGLPK  415



>ref|XP_006391873.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
 gb|ESQ29159.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
Length=419

 Score =   228 bits (582),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IA NRK A  L+Q LL+YF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGTPQVAYTFDAGPNAVLIAGNRKVAVQLLQGLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYV+GD SIL +AG+   N VE L PPPEIKDNI +++ KG+VSYFICTRP
Sbjct  337  PPKSDTDMKSYVVGDNSILKEAGLDGANSVENLQPPPEIKDNIGSQDQKGEVSYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+ +TGLPK
Sbjct  397  GRGPVVLPDQTQALLDKKTGLPK  419



>gb|KDO47062.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=378

 Score =   227 bits (578),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VE+WNRS G+PQVAYTFDAGPNAV+IARNRK A  L+QRLLF+F
Sbjct  235  PPIFYMNDTSHRIISYVERWNRSVGSPQVAYTFDAGPNAVLIARNRKIATELLQRLLFFF  294

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNS+TDL+SYV+GDKSIL DAGI  + D+EALP PPEI +    K  GDV+YFICTRPG
Sbjct  295  PPNSETDLNSYVLGDKSILRDAGIDGMKDIEALPLPPEINNISAQKYSGDVNYFICTRPG  354

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GPV+LSD+++ALLNP++GLPK
Sbjct  355  GGPVLLSDDSKALLNPKSGLPK  376



>gb|KDO47059.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=420

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VE+WNRS G+PQVAYTFDAGPNAV+IARNRK A  L+QRLLF+F
Sbjct  277  PPIFYMNDTSHRIISYVERWNRSVGSPQVAYTFDAGPNAVLIARNRKIATELLQRLLFFF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNS+TDL+SYV+GDKSIL DAGI  + D+EALP PPEI +    K  GDV+YFICTRPG
Sbjct  337  PPNSETDLNSYVLGDKSILRDAGIDGMKDIEALPLPPEINNISAQKYSGDVNYFICTRPG  396

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GPV+LSD+++ALLNP++GLPK
Sbjct  397  GGPVLLSDDSKALLNPKSGLPK  418



>ref|XP_006445713.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 ref|XP_006485205.1| PREDICTED: diphosphomevalonate decarboxylase-like [Citrus sinensis]
 gb|ESR58953.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=420

 Score =   227 bits (579),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VE+WNRS G+PQVAYTFDAGPNAV+IARNRK A  L+QRLLF+F
Sbjct  277  PPIFYMNDTSHRIISYVERWNRSVGSPQVAYTFDAGPNAVLIARNRKIATELLQRLLFFF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPNS+TDL+SYV+GDKSIL DAGI  + D+EALP PPEI +    K  GDV+YFICTRPG
Sbjct  337  PPNSETDLNSYVLGDKSILRDAGIDGMKDIEALPLPPEINNISAQKYSGDVNYFICTRPG  396

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GPV+LSD+++ALLNP++GLPK
Sbjct  397  GGPVLLSDDSKALLNPKSGLPK  418



>ref|XP_007142839.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
 gb|ESW14833.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
Length=420

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS  EKWNRSE  PQVAYTFDAGPNAV+IAR+RKAA LLVQRLL+YF
Sbjct  279  PPIFYMNDTSHRIISIAEKWNRSEEAPQVAYTFDAGPNAVLIARDRKAATLLVQRLLYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PPNSD DL SY+IGDKSI  DAGI  + DVEALPPPPEIKDNIP+ K +GD+SYFICTRP
Sbjct  339  PPNSD-DLDSYIIGDKSIAKDAGINGIQDVEALPPPPEIKDNIPSQKYRGDISYFICTRP  397

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+LSD + ALLN ETGLPK
Sbjct  398  GRGPVLLSDSSLALLNDETGLPK  420



>ref|XP_010536295.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Tarenaya hassleriana]
Length=439

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/147 (71%), Positives = 123/147 (84%), Gaps = 3/147 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS +EKWNRS+GTPQVAYTFDAGPNAVMIARNR  A  L+Q+LL  F
Sbjct  278  PPIFYMNDTSHRIISLIEKWNRSDGTPQVAYTFDAGPNAVMIARNRNVAIQLLQKLLVCF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPN DTD++SYV+GDKSIL +AG+   N VEAL PPPE+K+N+   +KG+V+YFICTRPG
Sbjct  338  PPNPDTDMNSYVLGDKSILQEAGLGGANGVEALHPPPEVKENV---HKGEVNYFICTRPG  394

Query  356  RGPVVLSDETQALLNPETGLPK*RTKR  276
            RGPV+L D+T ALL+  TGLPK R  R
Sbjct  395  RGPVLLQDQTHALLDSATGLPKSRGAR  421



>gb|AEM42974.1| diphosphomevalonate decarboxylase [Siraitia grosvenorii]
Length=418

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 124/143 (87%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEG PQVAYTFDAGPN+V+IARNRK A  L+QRLLFYF
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSEGVPQVAYTFDAGPNSVLIARNRKTAVSLLQRLLFYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PPN +TDL+SYV+GDKSIL DAGIK + D+E+L  PPEI  N P  K +GDVSYFICTRP
Sbjct  337  PPNPETDLNSYVLGDKSILQDAGIKGVEDIESLLQPPEI--NSPFQKFQGDVSYFICTRP  394

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GPVVL D +QALL+P+TGLPK
Sbjct  395  GKGPVVLPD-SQALLDPKTGLPK  416



>gb|KHG20401.1| Mvd [Gossypium arboreum]
Length=423

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 10/151 (7%)
 Frame = -1

Query  719  LPPIFYMNDTSHR--------IISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAAL  564
            LPPIFYMNDTSHR        IIS VEKWNRSEGTPQVAYTFDAGPNAV+IAR+RKAAA 
Sbjct  275  LPPIFYMNDTSHRQVLVYICWIISYVEKWNRSEGTPQVAYTFDAGPNAVLIARDRKAAAQ  334

Query  563  LVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDV  384
            L+QRLLFYFPP SDTDL SY++GDK+IL DAG++ L DV+AL PPPE  +    K  GDV
Sbjct  335  LIQRLLFYFPPKSDTDLDSYLLGDKTILKDAGLEGLEDVKALSPPPE--NGSAQKYPGDV  392

Query  383  SYFICTRPGRGPVVLSDETQALLNPETGLPK  291
            SYFICTRPG+GP++LS++  ALL+PETGLPK
Sbjct  393  SYFICTRPGKGPILLSNDKLALLDPETGLPK  423



>gb|KHG20400.1| Mvd [Gossypium arboreum]
Length=459

 Score =   223 bits (567),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 125/151 (83%), Gaps = 10/151 (7%)
 Frame = -1

Query  719  LPPIFYMNDTSHR--------IISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAAL  564
            LPPIFYMNDTSHR        IIS VEKWNRSEGTPQVAYTFDAGPNAV+IAR+RKAAA 
Sbjct  311  LPPIFYMNDTSHRQVLVYICWIISYVEKWNRSEGTPQVAYTFDAGPNAVLIARDRKAAAQ  370

Query  563  LVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDV  384
            L+QRLLFYFPP SDTDL SY++GDK+IL DAG++ L DV+AL PPPE  +    K  GDV
Sbjct  371  LIQRLLFYFPPKSDTDLDSYLLGDKTILKDAGLEGLEDVKALSPPPE--NGSAQKYPGDV  428

Query  383  SYFICTRPGRGPVVLSDETQALLNPETGLPK  291
            SYFICTRPG+GP++LS++  ALL+PETGLPK
Sbjct  429  SYFICTRPGKGPILLSNDKLALLDPETGLPK  459



>gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=417

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 131/143 (92%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+NDTSH+IISCVEKWNRS GTPQVAYTFDAGPNAV+IAR+RK AALL++RLLF+F
Sbjct  276  PPIFYINDTSHKIISCVEKWNRSVGTPQVAYTFDAGPNAVLIARDRKIAALLLRRLLFHF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP+S+TD +SYVIGDKSIL D G++D  D+E+LPPPPEIKDNIP  K+ GDVSYFICTRP
Sbjct  336  PPHSNTDSNSYVIGDKSILQDVGVQDTKDIESLPPPPEIKDNIPAQKSNGDVSYFICTRP  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L D ++ALLNPETGLPK
Sbjct  396  GRGPVLLPD-SRALLNPETGLPK  417



>ref|XP_010536297.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X3 
[Tarenaya hassleriana]
 ref|XP_010536298.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X4 
[Tarenaya hassleriana]
Length=416

 Score =   220 bits (561),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS +EKWNRS+GTPQVAYTFDAGPNAVMIARNR  A  L+Q+LL  F
Sbjct  278  PPIFYMNDTSHRIISLIEKWNRSDGTPQVAYTFDAGPNAVMIARNRNVAIQLLQKLLVCF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPN DTD++SYV+GDKSIL +AG+   N VEAL PPPE+K+N+   +KG+V+YFICTRPG
Sbjct  338  PPNPDTDMNSYVLGDKSILQEAGLGGANGVEALHPPPEVKENV---HKGEVNYFICTRPG  394

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGPV+L D+T ALL+  TGLPK
Sbjct  395  RGPVLLQDQTHALLDSATGLPK  416



>ref|XP_002452980.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
 gb|EES05956.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
Length=420

 Score =   219 bits (557),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 123/143 (86%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IA+NRK AA L+Q+LL+YF
Sbjct  279  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAQNRKTAAHLLQKLLYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PP  D DLSSY++GDKSILGDAG+  + DVEALPPPPE+K  +P  K KGDVSYFIC+R 
Sbjct  339  PPQ-DKDLSSYLVGDKSILGDAGVHSMEDVEALPPPPEMK--VPDLKFKGDVSYFICSRL  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V++DE+QAL++  TGLPK
Sbjct  396  GAGPKVIADESQALIDSVTGLPK  418



>ref|XP_010536296.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Tarenaya hassleriana]
Length=423

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 120/141 (85%), Gaps = 3/141 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS +EKWNRS+GTPQVAYTFDAGPNAVMIARNR  A  L+Q+LL  F
Sbjct  278  PPIFYMNDTSHRIISLIEKWNRSDGTPQVAYTFDAGPNAVMIARNRNVAIQLLQKLLVCF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPN DTD++SYV+GDKSIL +AG+   N VEAL PPPE+K+N+   +KG+V+YFICTRPG
Sbjct  338  PPNPDTDMNSYVLGDKSILQEAGLGGANGVEALHPPPEVKENV---HKGEVNYFICTRPG  394

Query  356  RGPVVLSDETQALLNPETGLP  294
            RGPV+L D+T ALL+  TGLP
Sbjct  395  RGPVLLQDQTHALLDSATGLP  415



>gb|ADI80345.1| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=420

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSH+IISCVEKWNRS GTPQVAYTFDAGPNAV+IAR+RK AALL++RLLF+F
Sbjct  279  PPIFYMNDTSHKIISCVEKWNRSVGTPQVAYTFDAGPNAVLIARDRKIAALLLRRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP     L+SYVIGDKSIL D G++D+ D+E+LPPPPEIKDNIP  K+ GDVSYFICTRP
Sbjct  339  PPTFQHCLNSYVIGDKSILQDVGVQDMKDIESLPPPPEIKDNIPAQKSNGDVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L D + ALLNPETGLPK
Sbjct  399  GRGPVLLPD-SGALLNPETGLPK  420



>ref|XP_010554524.1| PREDICTED: diphosphomevalonate decarboxylase-like [Tarenaya hassleriana]
Length=412

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 7/142 (5%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHR+IS +EKWNRSEG+PQVAYTFDAGPNAVMIA NRK A  L+Q+LLF F
Sbjct  278  PPIFYMNDTSHRLISLIEKWNRSEGSPQVAYTFDAGPNAVMIAPNRKVAVQLLQKLLFCF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  DTD++SYV+GDKSIL +AG +  N VE LP PPE+K+       G+VSYFICTRPG
Sbjct  338  PPKPDTDMNSYVLGDKSILQEAGFEGANGVEGLPHPPEMKE-------GEVSYFICTRPG  390

Query  356  RGPVVLSDETQALLNPETGLPK  291
            RGP+VL D+T ALL+PETGLPK
Sbjct  391  RGPIVLHDQTHALLDPETGLPK  412



>ref|XP_004954217.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=420

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IARNRK AALL+Q+L++YF
Sbjct  279  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIARNRKTAALLLQKLMYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PP  D DLSSY++GDKSILGDAG+  + DV+ALP PPE+K  +P  K KGDVSYFIC+R 
Sbjct  339  PPQ-DKDLSSYLVGDKSILGDAGLHSIEDVDALPAPPEMK--VPDQKFKGDVSYFICSRL  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V++DE QAL++  TGLPK
Sbjct  396  GAGPKVVADENQALIDSVTGLPK  418



>gb|AIK21783.1| mevalonate diphosphate decarboxylase [Panax notoginseng]
Length=420

 Score =   216 bits (549),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 127/143 (89%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSH+IISCVEKWNRSEGTPQVAYTFDAGPNAV+IAR+RK AALL++RLLF+F
Sbjct  279  PPIFYMNDTSHKIISCVEKWNRSEGTPQVAYTFDAGPNAVLIARDRKIAALLLRRLLFHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            P      L+SYVIGDKSIL D G++D+ D+E+LPPPPEIKDNIP  K+ G VSYFICTRP
Sbjct  339  PXTFQHCLNSYVIGDKSILQDVGVQDMKDIESLPPPPEIKDNIPAQKSNGGVSYFICTRP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPV+L D ++ALLNPETGLPK
Sbjct  399  GRGPVLLPD-SRALLNPETGLPK  420



>gb|AEA72605.1| mevalonate 5-diphosphate decarboxylase [Houttuynia cordata]
Length=421

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRII+ +EKWN+ EGTPQVAYTFDAGPNAV+IARNRK A  L+QRLLFYF
Sbjct  280  PPIFYMNDTSHRIINYMEKWNQLEGTPQVAYTFDAGPNAVLIARNRKTAEALLQRLLFYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTRP  360
            PP    +L+SYV+GD SIL DAG++++ DVEAL PPPE+K  IP K + GDVSYFICT+P
Sbjct  340  PP-PGAELTSYVLGDVSILHDAGLQEMKDVEALMPPPELKCQIPFKRHAGDVSYFICTKP  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGP++L+D+ QALLNP TG+P+
Sbjct  399  GRGPMILNDKNQALLNPNTGIPQ  421



>ref|XP_009404708.1| PREDICTED: diphosphomevalonate decarboxylase-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   215 bits (547),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VE+WNRSEGTPQ AYTFDAGPNAV+IA NRK+A LL+QRLLF F
Sbjct  279  PPIFYMNDTSHRIISLVERWNRSEGTPQAAYTFDAGPNAVLIAPNRKSAGLLLQRLLFCF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP +D +L+SYVIGDKSIL +AG++ + DVEALPPPP  KD  P+ K  G VSYFICTR 
Sbjct  339  PPPADNELTSYVIGDKSILHEAGLQSMKDVEALPPPPVSKDKYPSQKFPGKVSYFICTRL  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP VL+DE+ ALL+P TGLPK
Sbjct  399  GSGPRVLTDESLALLSPTTGLPK  421



>gb|AFW73864.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=390

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 119/143 (83%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IA+NRK AA L+Q+LL+YF
Sbjct  249  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAQNRKTAAHLLQKLLYYF  308

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PP  D DLSSY++GDKSILG AG+  + DVEALP PPE K  IP  K KGDVSYFIC+R 
Sbjct  309  PPQ-DNDLSSYLVGDKSILGVAGLHSMKDVEALPAPPETK--IPDQKFKGDVSYFICSRL  365

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V+SDE QAL++  TGLPK
Sbjct  366  GAGPKVVSDEGQALIDSVTGLPK  388



>ref|XP_004150845.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 ref|XP_004165172.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 gb|KGN52198.1| hypothetical protein Csa_5G615210 [Cucumis sativus]
Length=424

 Score =   213 bits (543),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNR+EG PQVAYTFDAGPN+V+IARNRKAA  L+QRLLF F
Sbjct  283  PPIFYMNDTSHRIISLVEKWNRAEGEPQVAYTFDAGPNSVLIARNRKAAVSLLQRLLFQF  342

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPN +T+L+SYV+GDK+IL DAGI  + D+E+LP PPE   +   K +GDVSYFICTRPG
Sbjct  343  PPNPETELNSYVLGDKTILQDAGINSVEDIESLPQPPEFNSS-SQKFQGDVSYFICTRPG  401

Query  356  RGPVVLSDETQALLNPETGLPK  291
            +GPVVL  E+ +LL+P+TGLPK
Sbjct  402  KGPVVLP-ESDSLLDPKTGLPK  422



>gb|AFO67223.1| putative mevalonate diphosphate decarboxylase, partial [Aralia 
elata]
Length=126

 Score =   203 bits (516),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 114/123 (93%), Gaps = 2/123 (2%)
 Frame = -1

Query  659  WNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSIL  480
            WNRSE TPQVAYTFDAGPNAV+IAR+RK AALL+QRLLF+FPP+S+TDL+SYVIGDKSIL
Sbjct  4    WNRSEETPQVAYTFDAGPNAVLIARDRKIAALLLQRLLFHFPPHSNTDLNSYVIGDKSIL  63

Query  479  GDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPET  303
             D G++D+ DVEALPPPPEIKDNIP  K+KGDVSYFICTRPGRGPV+L D ++ALLNPET
Sbjct  64   QDVGVQDMKDVEALPPPPEIKDNIPAQKSKGDVSYFICTRPGRGPVLLPD-SRALLNPET  122

Query  302  GLP  294
            GLP
Sbjct  123  GLP  125



>ref|XP_003565147.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brachypodium 
distachyon]
Length=417

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 117/142 (82%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IARNRK A LL+QRLL+ F
Sbjct  276  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIARNRKTATLLLQRLLYCF  335

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  D DL SY++GDKSIL DAG++ + DVEALP PPE+K     K KGDVSYFIC+RPG
Sbjct  336  PPQ-DNDLDSYMVGDKSILSDAGLQSIADVEALPTPPEMK-TPNQKFKGDVSYFICSRPG  393

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP VL DE+QAL++  TGL K
Sbjct  394  AGPKVLVDESQALIDSATGLAK  415



>ref|XP_004963234.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=425

 Score =   212 bits (540),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN  EG PQVAYTFDAGPNAV+IARNRK AALL+Q+LL+YF
Sbjct  282  PPIFYMNDTSHRIISLVEKWNHLEGCPQVAYTFDAGPNAVLIARNRKTAALLLQKLLYYF  341

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  D DLSSY++GDKSIL DAG+  L DVEALP PPE+K +   K KGDVSYFIC+R G
Sbjct  342  PPQ-DKDLSSYLVGDKSILSDAGLHSLEDVEALPAPPEMKIH-DQKFKGDVSYFICSRLG  399

Query  356  RGPVVLSDETQALLNPETGLPK  291
             G  V++DE+QALL+  TGLPK
Sbjct  400  VGINVVADESQALLDSVTGLPK  421



>ref|NP_001149256.1| LOC100282878 [Zea mays]
 ref|XP_008643692.1| PREDICTED: LOC100282878 isoform X1 [Zea mays]
 gb|ACG34742.1| diphosphomevalonate decarboxylase [Zea mays]
 gb|ACR36666.1| unknown [Zea mays]
 gb|AFW73865.1| diphosphomevalonate decarboxylase [Zea mays]
Length=420

 Score =   212 bits (540),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 119/143 (83%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IA+NRK AA L+Q+LL+YF
Sbjct  279  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAQNRKTAAHLLQKLLYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PP  D DLSSY++GDKSILG AG+  + DVEALP PPE K  IP  K KGDVSYFIC+R 
Sbjct  339  PPQ-DNDLSSYLVGDKSILGVAGLHSMKDVEALPAPPETK--IPDQKFKGDVSYFICSRL  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V+SDE QAL++  TGLPK
Sbjct  396  GAGPKVVSDEGQALIDSVTGLPK  418



>ref|XP_008446768.1| PREDICTED: diphosphomevalonate decarboxylase [Cucumis melo]
Length=424

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRSEG PQVAYTFDAGPN+V+IARNRK A  L+QRLLF F
Sbjct  283  PPIFYMNDTSHRIISLVEKWNRSEGEPQVAYTFDAGPNSVLIARNRKTAVSLLQRLLFQF  342

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PPN +T+L+SYV+GDKSIL DAGI  + D+E+LP PPE   +   K +GDVSYFICTRPG
Sbjct  343  PPNPETELNSYVLGDKSILQDAGINSVEDIESLPQPPEFNSS-SQKFQGDVSYFICTRPG  401

Query  356  RGPVVLSDETQALLNPETGLPK  291
            +GPVVL  E+++LL+ +TGLPK
Sbjct  402  KGPVVLP-ESESLLDLKTGLPK  422



>emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera]
Length=451

 Score =   211 bits (538),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 117/143 (82%), Gaps = 16/143 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHR               QVAYTFDAGPNAV+IAR+RK AA L+QRLL+YF
Sbjct  280  PPIFYMNDTSHR---------------QVAYTFDAGPNAVLIARDRKVAANLLQRLLYYF  324

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP+SDTDL+SYVIGDKSILGD G++++ DVEALPPPPE KD IP  K +G VSYFICTRP
Sbjct  325  PPHSDTDLNSYVIGDKSILGDVGVEEMKDVEALPPPPETKDQIPAQKQRGAVSYFICTRP  384

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP +LSDE+QALLNPE+GLPK
Sbjct  385  GKGPXLLSDESQALLNPESGLPK  407



>ref|XP_008665378.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
 gb|ACF86239.1| unknown [Zea mays]
 gb|ACN26377.1| unknown [Zea mays]
 tpg|DAA51251.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=420

 Score =   210 bits (535),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IA+NRK AA  +Q+LL+YF
Sbjct  279  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAQNRKTAAHFLQKLLYYF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PP  D DLSSY++GDKSILGDAG+  + DVEALP PP+ K  IP  K KGDVSYFIC+R 
Sbjct  339  PPQ-DNDLSSYLVGDKSILGDAGLHSMKDVEALPAPPDTK--IPDQKFKGDVSYFICSRL  395

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V+ DE QAL++  TGLPK
Sbjct  396  GAGPKVVVDEGQALIDSVTGLPK  418



>gb|ACN41090.1| unknown [Picea sitchensis]
Length=422

 Score =   209 bits (531),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 1/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRII+CVE+WNRSEGTPQVAYTFDAGPNAVM A NRK A LL+QRLLFYF
Sbjct  280  PPIFYMNDTSHRIINCVERWNRSEGTPQVAYTFDAGPNAVMYAPNRKVAGLLLQRLLFYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNK-GDVSYFICTRP  360
            PP+S    SSYVIGD SIL + G+  + DVE+L  PPE+K    +    G + YFICTRP
Sbjct  340  PPDSSKTFSSYVIGDTSILEEIGVNSMKDVESLTAPPELKSESSSSTFPGGIDYFICTRP  399

Query  359  GRGPVVLSDETQALLNPETGLP  294
            G+GP++  +E QALLNP+TG P
Sbjct  400  GKGPILFRNEDQALLNPKTGFP  421



>gb|EMT01953.1| Diphosphomevalonate decarboxylase [Aegilops tauschii]
Length=456

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IARNRK AALL+QRLL+ F
Sbjct  315  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIARNRKTAALLLQRLLYCF  374

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP  + +L SY++GDKSIL  AG++ L D+EALPPPPE+K   PT K KGDVSYFIC+RP
Sbjct  375  PPQ-ENNLDSYMVGDKSILSSAGVQSLADIEALPPPPEMK--TPTQKFKGDVSYFICSRP  431

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP VL++E   L++  TGL K
Sbjct  432  GAGPKVLTEERHTLIDSATGLAK  454



>gb|EPS58605.1| hypothetical protein M569_16208, partial [Genlisea aurea]
Length=215

 Score =   201 bits (512),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/146 (68%), Positives = 116/146 (79%), Gaps = 5/146 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS +EKWN  EG PQVAYTFDAGPNAV+I+ NRK A  L+QRLL+YF
Sbjct  71   PPIFYMNDTSHRIISYIEKWNHYEGAPQVAYTFDAGPNAVIISPNRKTATQLLQRLLYYF  130

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDN----IPTKNKGDVSYFIC  369
            P  SD DL+ YVIGD++IL DAGI  L DVEAL PPPE K N    I     GD+SYF+ 
Sbjct  131  PA-SDPDLNRYVIGDETILKDAGISTLQDVEALAPPPETKGNSNHPIGRSRGGDISYFVA  189

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            TRPGRGPVV++D T++L++P+TGLPK
Sbjct  190  TRPGRGPVVVTDGTRSLVDPQTGLPK  215



>ref|XP_008665377.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=497

 Score =   209 bits (532),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IA+NRK AA  +Q+LL+YF
Sbjct  356  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAQNRKTAAHFLQKLLYYF  415

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PP  D DLSSY++GDKSILGDAG+  + DVEALP PP+ K  IP  K KGDVSYFIC+R 
Sbjct  416  PPQ-DNDLSSYLVGDKSILGDAGLHSMKDVEALPAPPDTK--IPDQKFKGDVSYFICSRL  472

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V+ DE QAL++  TGLPK
Sbjct  473  GAGPKVVVDEGQALIDSVTGLPK  495



>dbj|BAD27942.1| putative mevalonate disphosphate decarboxylase [Oryza sativa 
Japonica Group]
 dbj|BAH01424.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56155.1| hypothetical protein OsJ_05052 [Oryza sativa Japonica Group]
Length=421

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN+SEGTPQVAYTFDAGPNAV+IA NRK A +L+Q+LL+YF
Sbjct  280  PPIFYMNDTSHRIISLVEKWNQSEGTPQVAYTFDAGPNAVLIAPNRKNATILLQKLLYYF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP  D DLSSY++GDKSIL DAG+K + DVEALP P E K  +P+ K KGDVSYFIC+R 
Sbjct  340  PPQ-DNDLSSYMVGDKSILSDAGLKSIEDVEALPAPAETK--MPSQKFKGDVSYFICSRL  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V++DE+ AL++  TGLPK
Sbjct  397  GAGPKVVTDESLALIDSVTGLPK  419



>ref|XP_006836043.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
 gb|ERM98896.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
Length=419

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 118/143 (83%), Gaps = 2/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMN+TSHRII+C+E+WN+SEGTPQV+YTFDAGPNAVM A NRK A+LL+QRLLFYF
Sbjct  278  PPIFYMNNTSHRIINCIERWNQSEGTPQVSYTFDAGPNAVMFAPNRKVASLLLQRLLFYF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDN-IPTKNKGDVSYFICTRP  360
            PP    DLSS+VIGD+SIL +AGI  + DV++L PPPE KD+   +K+ G VSYFICTRP
Sbjct  338  PPLPGDDLSSFVIGDQSILQEAGIGSMKDVQSLSPPPETKDSKFLSKHGGSVSYFICTRP  397

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGP  L     AL++P+TGLPK
Sbjct  398  GRGP-ELRAHGDALIHPQTGLPK  419



>gb|AAV32433.1| mevalonate disphosphate decarboxylase [Ginkgo biloba]
Length=430

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 115/142 (81%), Gaps = 1/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRII+C+EKWNR EGTPQV+YTFDAGPNAV+ A +RK A LL+QRLL+YF
Sbjct  283  PPIFYMNDTSHRIINCIEKWNRFEGTPQVSYTFDAGPNAVICAPSRKVAGLLLQRLLYYF  342

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK-DNIPTKNKGDVSYFICTRP  360
            PP+S  +LSSYVIGD SILG+ G+K + DVE+L  PPE +  N  + + G+V YFICTRP
Sbjct  343  PPDSSKELSSYVIGDTSILGEIGLKSMKDVESLIAPPEFRSQNSSSIHPGEVDYFICTRP  402

Query  359  GRGPVVLSDETQALLNPETGLP  294
            G+GP++L +E QA  N +TG P
Sbjct  403  GKGPIILRNEDQAFFNNKTGFP  424



>gb|AGT17596.1| mevalonate diphosphate decarboxylase [Picrorhiza kurrooa]
Length=421

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNA-VMIARNRKAAALLVQRLLF  543
            LPPIFYMNDTSHRIISCVEKWN SEGTPQVAYTFDAGP   +   +  K      +   F
Sbjct  277  LPPIFYMNDTSHRIISCVEKWNCSEGTPQVAYTFDAGPKCRINFTQTEKLLPNFFKGCSF  336

Query  542  YFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICT  366
            +FPPNSDTDL+SYVIGD++IL DAGIKDL D+EAL  PPE K+N+   K +GDVSYFICT
Sbjct  337  HFPPNSDTDLNSYVIGDQTILQDAGIKDLKDIEALSTPPETKENLSAQKYRGDVSYFICT  396

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            +PGRGP V++DE+++L+NPE GLPK
Sbjct  397  KPGRGPAVVNDESRSLINPEFGLPK  421



>emb|CDM86983.1| unnamed protein product [Triticum aestivum]
Length=419

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 114/142 (80%), Gaps = 2/142 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTP VAYTFDAGPNAV+IARNRK   LL+QRLL+ F
Sbjct  278  PPIFYMNDTSHRIISLVEKWNHSEGTPHVAYTFDAGPNAVLIARNRKTDTLLLQRLLYCF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  + DL SY++GDKSIL  AG++ + D+EALPPPPE+K     K KGDVSYFIC+RPG
Sbjct  338  PPQ-ENDLDSYMVGDKSILSGAGVQSIADIEALPPPPEMK-TPNQKFKGDVSYFICSRPG  395

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP VL++E+  L++  TGL K
Sbjct  396  AGPKVLTEESHTLIDSATGLAK  417



>gb|KFK36776.1| hypothetical protein AALP_AA4G169000 [Arabis alpina]
Length=414

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 116/143 (81%), Gaps = 7/143 (5%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNR  GTP++AYTFDAGPNAV+IA++RK A  L+Q LL+ F
Sbjct  278  PPIFYMNDTSHRIISLVEKWNRKAGTPEIAYTFDAGPNAVLIAKSRKVAVELMQGLLYCF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP SDTD+ SYVIGD SI+ +AG+      E    P EIKD I +++ KG+VSYFIC+RP
Sbjct  338  PPKSDTDMKSYVIGDTSIVKEAGL------EGREVPQEIKDKIGSQDQKGEVSYFICSRP  391

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GPVVL D+TQALL+P+TGLPK
Sbjct  392  GKGPVVLQDQTQALLHPQTGLPK  414



>gb|EMS47869.1| Diphosphomevalonate decarboxylase [Triticum urartu]
Length=364

 Score =   201 bits (510),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 116/157 (74%), Gaps = 17/157 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IARNRK A LL+QRLL+ F
Sbjct  208  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIARNRKTATLLLQRLLYTF  267

Query  536  PPNSD--------------TDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-  402
            PP  +               D  SY++GDKSIL DAG++ + DVEALP PPE+K   P  
Sbjct  268  PPQENDLDRYTTNMCTSDKHDHGSYMLGDKSILSDAGLQSIADVEALPAPPEMK--APNQ  325

Query  401  KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  291
            K KGDVSYFIC+RPG GP VL+DE  AL++  TGL K
Sbjct  326  KFKGDVSYFICSRPGAGPKVLTDEGHALIDSATGLAK  362



>gb|AAM64988.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
Length=404

 Score =   200 bits (509),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 8/143 (6%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRS GTP++AYTFDAGPNAVMIARNRK A  L+Q LL+ F
Sbjct  269  PPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFDAGPNAVMIARNRKVAVELLQGLLYCF  328

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SI+ +AG++          P  IKD I +++ KG+VSYFIC+RP
Sbjct  329  PPKPDTDMKSYVLGDTSIVKEAGLEG-------ELPQGIKDKIGSQDQKGEVSYFICSRP  381

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+P+TGLPK
Sbjct  382  GRGPVVLQDQTQALLHPQTGLPK  404



>ref|NP_181404.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
 emb|CAA74700.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 emb|CAA76803.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAC67348.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAP68208.1| At2g38700 [Arabidopsis thaliana]
 dbj|BAF00296.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AEC09574.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
Length=412

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 8/143 (6%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRS GTP++AYTFDAGPNAVMIARNRK A  L+Q LL+ F
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFDAGPNAVMIARNRKVAVELLQGLLYCF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SI+ +AG++          P  IKD I +++ KG+VSYFIC+RP
Sbjct  337  PPKPDTDMKSYVLGDTSIVKEAGLEG-------ELPQGIKDKIGSQDQKGEVSYFICSRP  389

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+P+TGLPK
Sbjct  390  GRGPVVLQDQTQALLHPQTGLPK  412



>tpg|DAA51253.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1460

 Score =   209 bits (531),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 4/143 (3%)
 Frame = -1

Query  716   PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
             PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IA+NRK AA  +Q+LL+YF
Sbjct  1319  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAQNRKTAAHFLQKLLYYF  1378

Query  536   PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
             PP  D DLSSY++GDKSILGDAG+  + DVEALP PP+ K  IP  K KGDVSYFIC+R 
Sbjct  1379  PPQ-DNDLSSYLVGDKSILGDAGLHSMKDVEALPAPPDTK--IPDQKFKGDVSYFICSRL  1435

Query  359   GRGPVVLSDETQALLNPETGLPK  291
             G GP V+ DE QAL++  TGLPK
Sbjct  1436  GAGPKVVVDEGQALIDSVTGLPK  1458



>ref|XP_010067136.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010067137.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW65201.1| hypothetical protein EUGRSUZ_G02693 [Eucalyptus grandis]
Length=419

 Score =   199 bits (506),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PP+FYMNDTSHRII+CVEK NR EG PQ AYT+DAG N  + AR+RKAAALL+QRLL+YF
Sbjct  277  PPLFYMNDTSHRIINCVEKLNRHEGVPQGAYTYDAGCNGFLFARDRKAAALLLQRLLYYF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PPN DTDLSSY++GDKSIL DAG++++NDVE LP PPEI+D +P +  +G++SYFICTRP
Sbjct  337  PPNPDTDLSSYILGDKSILKDAGLENINDVEKLPAPPEIQDEVPAQRFRGNISYFICTRP  396

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GPV++SD+ QALL+P TG PK
Sbjct  397  GPGPVMVSDQGQALLDPVTGFPK  419



>ref|XP_006294305.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
 gb|EOA27203.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
Length=412

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 115/143 (80%), Gaps = 8/143 (6%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRS GTP++AYTFDAGPNAV+IARNRK A  L+Q LL+ F
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFDAGPNAVLIARNRKVAVELLQGLLYCF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SI+ +AG++          P  IKD I +++ KG+VSYFIC+RP
Sbjct  337  PPKPDTDMKSYVLGDTSIVKEAGLEG-------ELPQGIKDKIGSQDQKGEVSYFICSRP  389

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+P+TGLPK
Sbjct  390  GRGPVVLQDQTQALLDPQTGLPK  412



>ref|XP_002881611.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57870.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (80%), Gaps = 8/143 (6%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRS GTP++AYTFDAGPNAV+IARNRK A  L+Q LL+ F
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSAGTPEIAYTFDAGPNAVLIARNRKVAVELMQGLLYCF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SI+ +AG++          P  IKD I  ++ KG+VSYFIC+RP
Sbjct  337  PPKPDTDMKSYVLGDTSIVKEAGLEG-------ELPQGIKDKIGNQDQKGEVSYFICSRP  389

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+P+TGLPK
Sbjct  390  GRGPVVLQDQTQALLHPQTGLPK  412



>ref|XP_010509167.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 113/143 (79%), Gaps = 8/143 (6%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRS  TP++AYTFDAGPNAV+IARNRK A  L+Q LL+ F
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSASTPEIAYTFDAGPNAVLIARNRKVAVELLQGLLYCF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SI+ +AG++          P  IKD I  ++ KG+VSYFIC+RP
Sbjct  337  PPKPDTDMKSYVLGDASIVKEAGLEG-------ELPQGIKDKIGRQDQKGEVSYFICSRP  389

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+T+ALL+P+TGLPK
Sbjct  390  GRGPVVLQDQTKALLHPQTGLPK  412



>ref|XP_010505522.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 112/143 (78%), Gaps = 8/143 (6%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNRS  TP++AYTFDAGPNAV+IARNRK A  L+Q LL+ F
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRSASTPEIAYTFDAGPNAVLIARNRKVAVELLQGLLYCF  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  DTD+ SYV+GD SI+ +AG++          P  IKD I  ++ KG+VSYFIC++ 
Sbjct  337  PPKPDTDMKSYVLGDASIVKEAGVEG-------ELPQGIKDKIGRQDQKGEVSYFICSKA  389

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            GRGPVVL D+TQALL+P+TGLPK
Sbjct  390  GRGPVVLQDQTQALLHPQTGLPK  412



>ref|XP_010907122.1| PREDICTED: diphosphomevalonate decarboxylase-like [Elaeis guineensis]
Length=421

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VE+WNRSEG+ QVAYTFDAGPNAV+IA NRK A LL+QRLLF F
Sbjct  279  PPIFYMNDTSHRIISLVERWNRSEGSLQVAYTFDAGPNAVLIAPNRKVAGLLLQRLLFQF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRP  360
            PP  +++L+SY++GDKSIL +AG++   DVE LPPP EIKD +P+ K  GDVSYFICTR 
Sbjct  339  PPPPESELASYILGDKSILHEAGLQSRKDVEDLPPPVEIKDKVPSQKFPGDVSYFICTRL  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP +L+DE QAL++PETG PK
Sbjct  399  GSGPRLLTDENQALISPETGCPK  421



>ref|XP_006646770.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oryza brachyantha]
Length=419

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 119/143 (83%), Gaps = 4/143 (3%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWN SEGTPQVAYTFDAGPNAV+IA NRK AALL+++LL+ F
Sbjct  278  PPIFYMNDTSHRIISLVEKWNHSEGTPQVAYTFDAGPNAVLIAPNRKNAALLLKKLLYCF  337

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN-KGDVSYFICTRP  360
            PP  D DLSSY++GDKSIL DAG+K + DVEALP P E+K   P++  KGDVSYFIC+R 
Sbjct  338  PPQ-DNDLSSYMVGDKSILSDAGVKSIEDVEALPAPAEMK--TPSQQFKGDVSYFICSRL  394

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V++DE+ AL++  TGLPK
Sbjct  395  GAGPKVVTDESLALIDSFTGLPK  417



>ref|XP_008788072.1| PREDICTED: diphosphomevalonate decarboxylase-like [Phoenix dactylifera]
Length=421

 Score =   182 bits (463),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 116/143 (81%), Gaps = 1/143 (1%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTS RIIS VE+WNRSE +PQVAYTFDAGPNAV+IA NRK A LL+QRLLF F
Sbjct  279  PPIFYMNDTSRRIISLVERWNRSEVSPQVAYTFDAGPNAVLIAPNRKVAGLLLQRLLFQF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIP-TKNKGDVSYFICTRP  360
            PP  D +L+SY++GDKSIL +AG++ + DVE LPPP EIKD  P  K  GDVSYFICTR 
Sbjct  339  PPLPDNELASYILGDKSILREAGLQSMKDVEDLPPPAEIKDKAPFQKFPGDVSYFICTRL  398

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP +L++E QAL++ ETG PK
Sbjct  399  GSGPRLLTEENQALISSETGHPK  421



>ref|XP_011102052.1| PREDICTED: diphosphomevalonate decarboxylase-like, partial [Sesamum 
indicum]
Length=149

 Score =   170 bits (431),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 106/116 (91%), Gaps = 1/116 (1%)
 Frame = -1

Query  635  QVAYTFDAGPNAVMIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDL  456
            QVAYTFDAGPNAV+I+ NRKAAALL+QRLLFYFPP +D DL+SYVIGDK+IL DAGI+++
Sbjct  34   QVAYTFDAGPNAVLISHNRKAAALLLQRLLFYFPPQADADLNSYVIGDKTILQDAGIQNV  93

Query  455  NDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVLSDETQALLNPETGLPK  291
             D+EAL PPPEIKDN  T K +GDVSYFICTRPGRGPVVL+DE+++L+NPETGLPK
Sbjct  94   KDIEALTPPPEIKDNTQTQKYRGDVSYFICTRPGRGPVVLTDESRSLINPETGLPK  149



>ref|XP_001773902.1| predicted protein [Physcomitrella patens]
 gb|EDQ61250.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   167 bits (422),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 3/144 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+NDTS ++I  VE+WNR  G PQVAYTFDAGPNAVM A+N++ AA L+QRLL+ F
Sbjct  280  PPIFYLNDTSRKLIGLVERWNRHAGEPQVAYTFDAGPNAVMFAKNKEVAAQLLQRLLYQF  339

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNK--GDVSYFICTR  363
            PP++DTD+S YV GD+SIL  AG+  L D+++L  P E+   IP   +  G+V Y ICT 
Sbjct  340  PPSADTDISRYVHGDQSILESAGVNSLKDIDSLSAPAEVA-GIPNLQRIPGEVDYLICTN  398

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G+G  VL ++   L++P +GL K
Sbjct  399  VGKGAYVLGEQGANLIDPVSGLLK  422



>ref|XP_001774493.1| predicted protein [Physcomitrella patens]
 gb|EDQ60717.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/142 (52%), Positives = 102/142 (72%), Gaps = 3/142 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+ND+S R+I  VE+WNR  G PQVAYTFDAGPNAVM A+N++ A  L++RLL+ F
Sbjct  281  PPIFYLNDSSRRLIGLVERWNRHAGEPQVAYTFDAGPNAVMFAKNKEVAVQLLKRLLYQF  340

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKD--NIPTKNKGDVSYFICTR  363
            PP+++ DLS YV+GD+S+L  AG+  L D+++L  P E     N+P +  G++ Y ICT 
Sbjct  341  PPSAEADLSRYVLGDQSVLKSAGVTSLEDIDSLSAPAEFAGVINLP-RIPGEIDYLICTS  399

Query  362  PGRGPVVLSDETQALLNPETGL  297
             G+G  VL  +  +LL+P TGL
Sbjct  400  AGKGASVLDGQIASLLDPATGL  421



>gb|KJB78632.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=345

 Score =   138 bits (347),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 63/69 (91%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
            LPPIFYMNDTSHRIIS VEKWNRSEGTPQVAYTFDAGPNAV+IAR+RKAAA L+QRLLFY
Sbjct  275  LPPIFYMNDTSHRIISYVEKWNRSEGTPQVAYTFDAGPNAVLIARDRKAAAQLIQRLLFY  334

Query  539  FPPNSDTDL  513
            FPP SDTDL
Sbjct  335  FPPKSDTDL  343



>gb|ADE77000.1| unknown [Picea sitchensis]
Length=103

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = -1

Query  596  MIARNRKAAALLVQRLLFYFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK  417
            M A NRK A LL+QRLLFYFPP+S   LSSYVIGD SILG+ G+  + DVE+L  PPE+K
Sbjct  1    MYAPNRKVAGLLLQRLLFYFPPDSSKTLSSYVIGDTSILGEIGVNSMKDVESLTAPPELK  60

Query  416  DNIPTKN-KGDVSYFICTRPGRGPVVLSDETQALLNPETGLP  294
                +    G + YFICTRPG+GP++  +E QALLNP+TG P
Sbjct  61   SESNSATFPGGIDYFICTRPGKGPILFRNEDQALLNPKTGFP  102



>ref|XP_002992344.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
 gb|EFJ06620.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
Length=403

 Score =   132 bits (331),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTS RII  VE+WN+SEG+PQ AYTFDAGPNAV+    +   ALL  RLL+ F
Sbjct  280  PPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTFDAGPNAVIFVPQKSGGALL-HRLLYEF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP    +LSSYV+G   +L   GI  L D+ +L  P  I+     +  G+++Y ICTRPG
Sbjct  339  PPPEGMNLSSYVVGSTELLEALGIDKLEDIRSLERP--IESPKRDEGHGELAYLICTRPG  396

Query  356  RG  351
             G
Sbjct  397  NG  398



>ref|XP_002979347.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
 gb|EFJ19755.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
Length=403

 Score =   131 bits (330),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 81/122 (66%), Gaps = 3/122 (2%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTS RII  VE+WN+SEG+PQ AYTFDAGPNAV+    +   ALL  RLL+ F
Sbjct  280  PPIFYMNDTSRRIIGLVERWNKSEGSPQAAYTFDAGPNAVIFVPQKSGGALL-HRLLYEF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP    +LSSYV+G   +L   GI  L D+ +L  P  I+     +  G+++Y ICTRPG
Sbjct  339  PPPEGMNLSSYVVGSTELLEALGIDKLEDIRSLERP--IESPKRDEGHGELAYLICTRPG  396

Query  356  RG  351
             G
Sbjct  397  NG  398



>ref|XP_006411092.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
 gb|ESQ52545.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
Length=341

 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/65 (75%), Positives = 55/65 (85%), Gaps = 0/65 (0%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMNDTSHRIIS VEKWNR  GTP++AYTFDAGPNAV+IAR+RK A  L+Q LL+ F
Sbjct  277  PPIFYMNDTSHRIISLVEKWNRFVGTPEIAYTFDAGPNAVLIARSRKVAVELLQGLLYCF  336

Query  536  PPNSD  522
            PP  D
Sbjct  337  PPKPD  341



>gb|ACO35356.1| mevalonate pyrophosphate decarboxylase [Elaeis oleifera]
Length=201

 Score =   102 bits (255),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 1/76 (1%)
 Frame = -1

Query  515  LSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPT-KNKGDVSYFICTRPGRGPVVL  339
            LSSY++GDKSIL +AG++ + DVE LPPP EIKD +P+ K  GDVSYFICTR G GP +L
Sbjct  126  LSSYILGDKSILHEAGLQSMKDVEDLPPPVEIKDKVPSQKFPGDVSYFICTRLGSGPRLL  185

Query  338  SDETQALLNPETGLPK  291
            +DE QAL++PETG PK
Sbjct  186  TDENQALISPETGCPK  201



>ref|XP_010067138.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Eucalyptus grandis]
Length=354

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/70 (77%), Positives = 61/70 (87%), Gaps = 0/70 (0%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PP+FYMNDTSHRII+CVEK NR EG PQ AYT+DAG N  + AR+RKAAALL+QRLL+YF
Sbjct  277  PPLFYMNDTSHRIINCVEKLNRHEGVPQGAYTYDAGCNGFLFARDRKAAALLLQRLLYYF  336

Query  536  PPNSDTDLSS  507
            PPN DTDLSS
Sbjct  337  PPNPDTDLSS  346



>ref|XP_002592260.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
 gb|EEN48271.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
Length=409

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 79/143 (55%), Gaps = 14/143 (10%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N+TS  II  V ++NR  G  + AYTFDAGPNAV+         +L     F+ 
Sbjct  277  PPIFYLNETSKHIIHLVHRYNRHHGKIKAAYTFDAGPNAVLYLLQDDVPEVLALLRHFFP  336

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTRP  360
            P +++     +V G    L DA  KDL        P E+ +++  + + G V Y I TR 
Sbjct  337  PSSTNNSEREFVQG----LPDANRKDL--------PAELLNSVGLEPSPGSVQYIIHTRA  384

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G+GP VL+D  QALL+ E G PK
Sbjct  385  GQGPQVLTDPQQALLD-EKGWPK  406



>ref|XP_010996740.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelus dromedarius]
Length=144

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  15   FPPISYLNDTSRRIIHLVHRFNALHGHTKVAYTFDAGPNAVIFTLDETVAE-FVAAVRHS  73

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G   + ++L D    +L  V  + P P           G + Y I 
Sbjct  74   FPPESNGD--KFLQGLPVEPALLSD----ELKAVLGVDPAP-----------GGIKYIIA  116

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  117  TQVGPGPQVLDDPGARLLGPD-GLPK  141



>ref|XP_005424871.1| PREDICTED: diphosphomevalonate decarboxylase [Geospiza fortis]
Length=260

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 79/147 (54%), Gaps = 18/147 (12%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ D S  II+   ++N   G  +VAY+FDAGPNAV+ A    A A  V+ +   
Sbjct  131  FPPIFYLTDVSRHIIALAHRYNAHHGHTKVAYSFDAGPNAVIFALA-DAVAEFVEVVRRS  189

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  ++ L  V +   PPE++  + T+   G V Y + T+
Sbjct  190  FPPATN--------------GDQFVRGL-PVGSAVLPPELEGAVLTEPVPGAVQYILHTK  234

Query  362  PGRGPVVLSDETQALLNPETGLPK*RT  282
            PG GP ++ D +Q LL P+ GLP+ R 
Sbjct  235  PGPGPQLVDDPSQHLLGPD-GLPRSRA  260



>ref|XP_002735076.1| PREDICTED: diphosphomevalonate decarboxylase-like [Saccoglossus 
kowalevskii]
Length=405

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 78/141 (55%), Gaps = 15/141 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPI YMNDTS +II+ +  +N+ +G  +VAYT+DAGPNAV+   +      +V  + +YF
Sbjct  275  PPISYMNDTSRKIINMIHAFNKYQGELKVAYTYDAGPNAVLYLLDEHVPD-VVSLINYYF  333

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  D    +++ G K        ++L DV  L P P           G + Y I T+ G
Sbjct  334  PP-CDNIRETFIRGLKVDFKTDISQELKDVVPLEPSP-----------GAIKYVISTKVG  381

Query  356  RGPVVLSDETQALLNPETGLP  294
            +GP +L +E  +LLN E GLP
Sbjct  382  QGPQILPNEA-SLLN-ENGLP  400



>ref|XP_010739786.1| PREDICTED: diphosphomevalonate decarboxylase [Larimichthys crocea]
Length=397

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 56/145 (39%), Positives = 76/145 (52%), Gaps = 22/145 (15%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S ++IS V ++NR  G  +VAYTFDAGPNAV+    +      VQ +  +F
Sbjct  269  PPIFYLNSVSQQVISLVHRYNRHYGETRVAYTFDAGPNAVIFTLQQHVPE-FVQVVQHFF  327

Query  536  PPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICT  366
            PP  +T+   +  G   + + L +    +L     L P P          KG +SY I T
Sbjct  328  PP--ETNGGQFFKGLPVNHAALSE----ELKQAIGLEPMP----------KG-ISYIIST  370

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP V+ D T  LL   TGLPK
Sbjct  371  KAGPGPCVVEDPTLHLLG-STGLPK  394



>ref|XP_010966484.1| PREDICTED: diphosphomevalonate decarboxylase [Camelus bactrianus]
Length=400

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIIHLVHRFNALHGHTKVAYTFDAGPNAVIFTLDETVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G   + ++L D    +L  V  + P P           G + Y I 
Sbjct  330  FPPESNGD--KFLQGLPVEPALLSD----ELKAVLGMDPAP-----------GGIKYIIA  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  373  TQVGPGPQVLDDPGARLLGPD-GLPK  397



>ref|XP_002192545.2| PREDICTED: diphosphomevalonate decarboxylase [Taeniopygia guttata]
Length=225

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 73/146 (50%), Gaps = 16/146 (11%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ D S  II+ V ++N   G  +VAYTFDAGPNAV+ A    A A  V+ +   
Sbjct  96   FPPIFYLTDVSRHIIALVHRYNAHHGHTKVAYTFDAGPNAVIFALA-DAVAEFVEVVRRS  154

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            FPP ++              GD  ++ L    A  P   +   +     G V Y + T+P
Sbjct  155  FPPAAN--------------GDQFVRGLPVGSAALPQELLAAVLAEPLPGAVRYILHTKP  200

Query  359  GRGPVVLSDETQALLNPETGLPK*RT  282
            G GP ++ D +Q LL  + GLP+ R 
Sbjct  201  GPGPQLVDDPSQHLLGAD-GLPRSRA  225



>ref|XP_004666010.1| PREDICTED: diphosphomevalonate decarboxylase [Jaculus jaculus]
Length=400

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDK---SILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G +   S+L D    +L    A+ P P           G V Y I 
Sbjct  330  FPPTANGD--KFLKGLQVIPSLLSD----ELKAALAMEPTP-----------GGVQYIIA  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLP+
Sbjct  373  TQVGPGPQVLDDPHVHLLGPD-GLPQ  397



>gb|AAH81784.1| Mevalonate (diphospho) decarboxylase [Rattus norvegicus]
 gb|EDL92747.1| mevalonate (diphospho) decarboxylase [Rattus norvegicus]
Length=401

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 74/144 (51%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  +    E+K ++ T+ + G V Y I T+
Sbjct  331  FPPAAN--------------GDKFLKGLQ-VAPVLLSDELKTSLATEPSPGGVQYIIATQ  375

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL P+ GLP+
Sbjct  376  VGPGPQVLDDPHHHLLGPD-GLPQ  398



>ref|NP_112324.1| diphosphomevalonate decarboxylase [Rattus norvegicus]
 sp|Q62967.1|MVD1_RAT RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
 gb|AAB00192.1| mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
Length=401

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 74/144 (51%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  +    E+K ++ T+ + G V Y I T+
Sbjct  331  FPPAAN--------------GDKFLKGLQ-VAPVLLSDELKTSLATEPSPGGVQYIIATQ  375

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL P+ GLP+
Sbjct  376  VGPGPQVLDDPHHHLLGPD-GLPQ  398



>ref|XP_004356734.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR24834.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
Length=412

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 82/152 (54%), Gaps = 17/152 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+NDTS  II+ +   N+  G  ++AYTFDAGPNAV+ A  ++   LL+  +  YF
Sbjct  267  PPIFYLNDTSKTIINLITYVNKHYGKIKIAYTFDAGPNAVLYAL-KEDTPLLLHLITRYF  325

Query  536  PPNSDTDLSSYVIGD----------KSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGD  387
            PP+S  DL+ +V G           +S+      KD + VEAL    + K    T     
Sbjct  326  PPSS--DLAHFVEGSGPKECGVESIESLGAQLKAKDAS-VEALLQELDAK---FTPQPAS  379

Query  386  VSYFICTRPGRGPVVLSDETQALLNPETGLPK  291
            +   I T   +GP V++D+   L++  TGLPK
Sbjct  380  IQRVIHTTVDKGPHVVTDDALCLIDTATGLPK  411



>ref|XP_006173825.1| PREDICTED: diphosphomevalonate decarboxylase [Camelus ferus]
Length=426

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  297  FPPISYLNDTSRRIIHLVHRFNALHGHTKVAYTFDAGPNAVIFTLDETVAE-FVAAVRHS  355

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G   + ++L D    +L  V  + P P           G + Y I 
Sbjct  356  FPPESNGD--KFLQGLPVEPALLSD----ELKAVLGMDPAP-----------GGIKYIIA  398

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  399  TQVGPGPQVLDDPGARLLGPD-GLPK  423



>ref|XP_008300019.1| PREDICTED: diphosphomevalonate decarboxylase [Stegastes partitus]
Length=402

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 18/143 (13%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY++  S ++IS V ++NR  G  +VAYTFDAGPNAV+    +      V+ +  +F
Sbjct  274  PPIFYLSSVSQQVISLVHRYNRHYGETRVAYTFDAGPNAVIFTLEQHVPE-FVRVVQHFF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGI-KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            PP  DT    ++ G    +G A + ++L     L P P          KG ++Y I T+ 
Sbjct  333  PP--DTHTEDFIQGLP--VGRAALSEELRRGVGLEPMP----------KG-INYIISTKA  377

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V+ D TQ LL+ + GLPK
Sbjct  378  GPGPCVVEDPTQHLLSSD-GLPK  399



>ref|XP_010625831.1| PREDICTED: diphosphomevalonate decarboxylase [Fukomys damarensis]
 gb|KFO31855.1| Diphosphomevalonate decarboxylase [Fukomys damarensis]
Length=402

 Score = 80.1 bits (196),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 75/146 (51%), Gaps = 18/146 (12%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RI+  V ++N   G  +VAYTFDAGPNAV+       A  +V  +   
Sbjct  271  FPPISYLNDTSRRIVQLVHRFNAHHGQTKVAYTFDAGPNAVLFTLEDTMAE-IVAVVRHA  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  +P   E+K  +  +   G V Y I T+
Sbjct  330  FPPEAN--------------GDKFLKGL-PVTPVPVSDELKATLAMEPAPGGVQYVIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK*R  285
             G GP VL+D    LL P+ GLPK R
Sbjct  375  VGPGPQVLNDPDAHLLGPD-GLPKPR  399



>gb|EIE86507.1| diphosphomevalonate decarboxylase [Rhizopus delemar RA 99-880]
Length=409

 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 59/148 (40%), Positives = 81/148 (55%), Gaps = 19/148 (13%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRS--EGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLF  543
            PPIFYMNDTS  II  + ++N S  +G  + AYT+DAGPNAV+ A  +K    ++Q +  
Sbjct  272  PPIFYMNDTSRAIIQLIHEYNASSPDGQLKAAYTYDAGPNAVIYA-PKKNMPEIIQLIGH  330

Query  542  YFPPN---SDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDN-IPTKNKGDVSYF  375
            YFP N   S+     Y +   + LG+  I          P P   +N IP +  G VS  
Sbjct  331  YFPSNKEPSEFFADPYRVAQGTKLGEKFI----------PHPNFNENVIPVQPAGSVSRL  380

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            + T+   GP VL+ E ++LLN E GLPK
Sbjct  381  LHTKVDDGPRVLA-EDESLLNAE-GLPK  406



>ref|XP_008838768.1| PREDICTED: diphosphomevalonate decarboxylase [Nannospalax galili]
Length=406

 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 74/144 (51%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V  +N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  277  FPPISYLNDTSRRIIQLVHCFNTHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  335

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP+++              GD  +K L  V   P   E+K  + T+ + G V Y I T+
Sbjct  336  FPPSAN--------------GDKFLKGLQ-VTPAPLSDELKAALTTEPSPGSVQYIIATQ  380

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL P+ GLP+
Sbjct  381  VGPGPQVLDDPHVHLLGPD-GLPQ  403



>ref|XP_009089159.1| PREDICTED: diphosphomevalonate decarboxylase [Serinus canaria]
Length=399

 Score = 79.3 bits (194),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 73/145 (50%), Gaps = 16/145 (11%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ D S  II+   ++N   G  +VAY+FDAGPNAV+      A A  V+ +   
Sbjct  270  FPPIFYLTDVSRHIIALAHRYNGHHGHTKVAYSFDAGPNAVIFTLA-DAVAEFVEVVRRS  328

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            FPP ++              GD  ++ L    A  PP  +   +     G V Y + T+P
Sbjct  329  FPPATN--------------GDQFVRGLPVGSAALPPELVAAVLTEPVPGAVQYILHTKP  374

Query  359  GRGPVVLSDETQALLNPETGLPK*R  285
            G GP ++ D +Q LL P+ GLP+ R
Sbjct  375  GPGPQLVDDPSQHLLGPD-GLPRSR  398



>ref|XP_008403677.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia reticulata]
Length=403

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 80/144 (56%), Gaps = 20/144 (14%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +II  V ++N+  G  +VAY+FDAGPNAV+    ++     VQ +  +F
Sbjct  275  PPIFYLNSVSQQIIHLVHRYNKYCGETRVAYSFDAGPNAVIFIL-QQFVPEFVQLVQHFF  333

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICTR  363
            PP+ +              G+  IK L  V+    P E+K NI  +   KG ++Y I T+
Sbjct  334  PPDRN--------------GEDFIKGL-PVKCAALPMELKQNIGLEPVPKG-INYIISTK  377

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP V+ D +Q LL+ E GLPK
Sbjct  378  AGPGPRVVDDPSQHLLSAE-GLPK  400



>ref|XP_010792093.1| PREDICTED: diphosphomevalonate decarboxylase [Notothenia coriiceps]
Length=402

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 54/147 (37%), Positives = 76/147 (52%), Gaps = 26/147 (18%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S ++I+ V ++NR  G  ++AYTFDAGPNAV+    +      VQ +  +F
Sbjct  274  PPIFYLNSVSQQVINLVHRYNRHYGETRLAYTFDAGPNAVIYTLQQHVPE-FVQAVQHFF  332

Query  536  PPNSDTDLSSYVIGDKSILG-----DAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFI  372
            PP S+        G + I G      A  ++L     L P P          KG +SY I
Sbjct  333  PPESN--------GGQFIQGLPVNQAALSEELKQAIGLEPMP----------KG-ISYII  373

Query  371  CTRPGRGPVVLSDETQALLNPETGLPK  291
             T+ G GP V+ D TQ L+  + G+PK
Sbjct  374  STKAGPGPRVVEDPTQHLIGSD-GMPK  399



>emb|CAF99534.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=393

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 51/145 (35%), Positives = 79/145 (54%), Gaps = 22/145 (15%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY++  S ++I+ V ++NR  G  +V+YTFDAGPNAV+    +  +  L Q +  +F
Sbjct  268  PPIFYLSSVSQQVINLVHRYNRHYGEMRVSYTFDAGPNAVIFTLEQHVSEFL-QVVQHFF  326

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNI---PTKNKGDVSYFICT  366
            PP ++              G   I+ L  +E +  P  +K +I   P +N   +SY I T
Sbjct  327  PPEAN--------------GGHFIRGL-PIEGVSLPDALKQSIGLQPMQN--GISYVIST  369

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP V++D  + LL  + GLPK
Sbjct  370  KAGPGPCVVNDPAEHLLGSD-GLPK  393



>ref|XP_004437181.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratotherium simum 
simum]
Length=400

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  L   
Sbjct  271  FPPISYLSDTSRRIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDNTVAE-FVAALRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E+K  +      G V Y I T+
Sbjct  330  FPPESN--------------GDKFLKGL-PVRPAPLSDELKAALGMDPTPGGVKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILDDPHAHLLGPD-GLPK  397



>ref|XP_003228605.1| PREDICTED: diphosphomevalonate decarboxylase [Anolis carolinensis]
Length=406

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/148 (36%), Positives = 77/148 (52%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S +++  V ++N   G  +VAYTFDAGPNAV+       A   V+ +   
Sbjct  276  FPPIFYLNDISKQVVRLVHRFNDHYGKTKVAYTFDAGPNAVVFMMEETVAE-FVEVVKRS  334

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPE-----IKDNIPTKNKGDVSYF  375
            FPP ++              G   +K L  VEA+ PP E     +KD  P    G + Y 
Sbjct  335  FPPENN--------------GGQFLKGL-PVEAVMPPEELLSAVVKDPAP----GAIQYL  375

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            + T+PG GP +++D +  LL P+ G P+
Sbjct  376  LLTKPGPGPTIVNDGSCHLLGPD-GQPR  402



>ref|XP_005805001.1| PREDICTED: diphosphomevalonate decarboxylase-like [Xiphophorus 
maculatus]
Length=403

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 80/144 (56%), Gaps = 20/144 (14%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +II  V ++N+  G  +VAY+FDAGPNAV+    ++     VQ +  +F
Sbjct  275  PPIFYLNSVSQQIIHLVHRYNKYCGETRVAYSFDAGPNAVIFTL-QQFVPEFVQLVQHFF  333

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICTR  363
            PP+ +              G+  IK L  V+    P E+K NI  +   KG ++Y I T+
Sbjct  334  PPDRN--------------GEDFIKGL-PVKGAALPMELKQNIGLEPVPKG-INYIISTK  377

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP V+ D ++ LL+ E GLPK
Sbjct  378  AGPGPRVVDDPSEHLLSAE-GLPK  400



>gb|ACO09861.1| Diphosphomevalonate decarboxylase [Osmerus mordax]
Length=398

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 76/144 (53%), Gaps = 20/144 (14%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PP+FY+ND S RII+ V ++NR  G  +VAY+FDAGPNAV+       A    Q    +F
Sbjct  270  PPVFYLNDVSRRIINLVHRYNRHCGETRVAYSFDAGPNAVIFTLQEHTAEFF-QVGGTFF  328

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICTR  363
            PP ++              G+  +K L  +  +    E+K+ I  +   KG +SY I  +
Sbjct  329  PPETN--------------GEQFLKGL-PITGVTLSEELKEAIGMEPLVKG-ISYIISPK  372

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP V+ D  Q LL P+ GLPK
Sbjct  373  AGPGPCVMEDPPQHLLCPD-GLPK  395



>ref|XP_005411152.1| PREDICTED: diphosphomevalonate decarboxylase [Chinchilla lanigera]
Length=513

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 74/146 (51%), Gaps = 18/146 (12%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RI+  V ++N   G  +VAYTFDAGPNAV+   +    A  V  +   
Sbjct  382  FPPISYLNDTSRRIMQLVHRFNAHHGHMKVAYTFDAGPNAVIFTLD-DTVAEFVATVRHV  440

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  +P   E+K  +  +   G V Y I T+
Sbjct  441  FPPEAN--------------GDKFLKGL-PVTPVPVSDELKATLAMEPVPGGVQYIIATQ  485

Query  362  PGRGPVVLSDETQALLNPETGLPK*R  285
             G GP VL D    LL P+ GLPK R
Sbjct  486  VGAGPQVLDDPDAHLLGPD-GLPKPR  510



>ref|XP_004539436.1| PREDICTED: diphosphomevalonate decarboxylase-like [Maylandia 
zebra]
Length=402

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 75/142 (53%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +IIS V ++N+  G  +VAYTFDAGPNAV+    +      V  + F+F
Sbjct  274  PPIFYLNHVSQQIISLVHRYNKHYGETRVAYTFDAGPNAVIFTLQQHVPE-FVHMVQFFF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  +T+ + ++ G          ++L     L P P          KG ++Y I T+ G
Sbjct  333  PP--ETNEADFIKGLPVNCASLS-EELKQGIGLEPMP----------KG-INYIISTKAG  378

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP V+ D TQ LL  + G PK
Sbjct  379  PGPRVVEDPTQHLLLSD-GFPK  399



>ref|XP_010716493.1| PREDICTED: diphosphomevalonate decarboxylase [Meleagris gallopavo]
Length=398

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 76/143 (53%), Gaps = 18/143 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S RII+   ++N   G  +VAYTFDAGPNAV+           V+ +   
Sbjct  269  FPPIFYLNDISQRIIALAHRFNAHHGRTKVAYTFDAGPNAVIFMLE-DTVDEFVEVVRRS  327

Query  539  FPPNSDTDLSSYVIGDKSILGDAGI-KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTR  363
            FPPNS+ D   ++ G    +G A + ++L     + P P           G + Y + T+
Sbjct  328  FPPNSNGD--QFLRGRP--VGTAVLPEELVSAVVVDPVP-----------GAIRYILHTK  372

Query  362  PGRGPVVLSDETQALLNPETGLP  294
            PG GP +L D +Q LL P+ GLP
Sbjct  373  PGPGPQLLDDPSQHLLGPD-GLP  394



>ref|XP_003970115.1| PREDICTED: diphosphomevalonate decarboxylase-like [Takifugu rubripes]
Length=397

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 77/145 (53%), Gaps = 22/145 (15%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY++  S ++I+ V ++NR  G  +V+YTFDAGPNAV+    +     L Q +  +F
Sbjct  269  PPIFYLSSVSQQVINLVHRYNRHYGETRVSYTFDAGPNAVIFTLKQHVPEFL-QVVQHFF  327

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNI---PTKNKGDVSYFICT  366
            PP ++              G   I+ L  V+ +  P E+K +I   P  N   +SY I T
Sbjct  328  PPETN--------------GGHFIRGL-PVKRVFLPDELKQSIGLQPMDN--GISYVIST  370

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP V+ D  Q LL  + GLPK
Sbjct  371  KAGPGPCVVDDPAQHLLGSD-GLPK  394



>gb|EHH60647.1| hypothetical protein EGM_12056, partial [Macaca fascicularis]
Length=377

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 72/145 (50%), Gaps = 19/145 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  247  FPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  305

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICT  366
            FPP S+              GDA +K L  V   P   E++  +  +    G V Y I T
Sbjct  306  FPPGSN--------------GDAFLKGLQ-VRPAPLSAELQAALAMEPTTPGGVKYIIAT  350

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L D +  LL P+ GLPK
Sbjct  351  QVGPGPQILDDPSAHLLGPD-GLPK  374



>ref|XP_008564101.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Galeopterus variegatus]
Length=410

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V  +N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  281  FPPISYLNDTSRRIIQLVHCFNTHHGRTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  339

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V   P   E+K  +  +   G V Y I T+
Sbjct  340  FPPEAN--------------GDKFLKGLQ-VRPAPLSDELKAVLAVEPTPGSVRYIIATQ  384

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  385  VGPGPQILDDPNVHLLGPD-GLPK  407



>ref|XP_004584295.1| PREDICTED: diphosphomevalonate decarboxylase, partial [Ochotona 
princeps]
Length=399

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 72/144 (50%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  271  FPPISYLNDTSRRIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  +  P E+K  +  +   G V Y I T+
Sbjct  330  FPPEAN--------------GDKFLKGL-PVAPVSLPDELKTALALEPVPGGVKYIISTQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL P+ GLP+
Sbjct  375  VGPGPQVLDDPKAHLLGPD-GLPR  397



>ref|XP_005592827.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Macaca 
fascicularis]
Length=401

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 72/145 (50%), Gaps = 19/145 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICT  366
            FPP S+              GDA +K L  V   P   E++  +  +    G V Y I T
Sbjct  330  FPPGSN--------------GDAFLKGLQ-VRPAPLSAELQAALAMEPTTPGGVKYIIAT  374

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L D +  LL P+ GLPK
Sbjct  375  QVGPGPQILDDPSAHLLGPD-GLPK  398



>ref|NP_001068892.1| diphosphomevalonate decarboxylase [Bos taurus]
 sp|Q0P570.1|MVD1_BOVIN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Bos taurus]
 gb|AAI20433.1| Mevalonate (diphospho) decarboxylase [Bos taurus]
 tpg|DAA20052.1| TPA: diphosphomevalonate decarboxylase [Bos taurus]
Length=400

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 74/146 (51%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLSDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVVFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G   +  +L D    +L  V  + P P           G + Y I 
Sbjct  330  FPPESNGD--KFLKGLPVEPVLLSD----ELKAVLGMDPVP-----------GSIRYIIA  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  373  TQVGPGPQVLDDPGAHLLGPD-GLPK  397



>ref|NP_001247472.1| diphosphomevalonate decarboxylase [Macaca mulatta]
Length=401

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 72/145 (50%), Gaps = 19/145 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICT  366
            FPP S+              GDA +K L  V   P   E++  +  +    G V Y I T
Sbjct  330  FPPGSN--------------GDAFLKGLQ-VRPAPLSAELQAALAMEPTTPGGVKYIIAT  374

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L D +  LL P+ GLPK
Sbjct  375  QVGPGPQILDDPSAHLLGPD-GLPK  398



>gb|EAW66791.1| mevalonate (diphospho) decarboxylase, isoform CRA_b [Homo sapiens]
Length=186

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  57   FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHG  115

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  116  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  160

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  161  VGPGPQILDDPCAHLLGPD-GLPK  183



>dbj|GAM24015.1| hypothetical protein SAMD00019534_071900 [Acytostelium subglobosum 
LB1]
Length=402

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 82/151 (54%), Gaps = 25/151 (17%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMI--ARNR-KAAALLVQRLL  546
            PPI Y+N+TS  II  V K+N + G+ + AYTFDAGPNA +   A N  +  AL V+   
Sbjct  257  PPIHYLNETSRYIIDLVHKFNTAAGSIKCAYTFDAGPNACIYLPADNVIEVLALFVK---  313

Query  545  FYFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKN------KGDV  384
             +FP    +DL++Y  GD +        ++  +    PP   +    T +       G +
Sbjct  314  -HFPT---SDLAAYYRGDAA--------NVEKIANYQPPTNTQSLYSTPSAATQELAGSL  361

Query  383  SYFICTRPGRGPVVLSDETQALLNPETGLPK  291
             Y + T+ G GP VLS E+++L++P TGLPK
Sbjct  362  KYILHTKIGPGPCVLS-ESESLIDPSTGLPK  391



>ref|XP_006721255.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Homo 
sapiens]
Length=229

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  100  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHG  158

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  159  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  203

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  204  VGPGPQILDDPCAHLLGPD-GLPK  226



>ref|XP_005504910.1| PREDICTED: diphosphomevalonate decarboxylase [Columba livia]
Length=350

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 73/145 (50%), Gaps = 20/145 (14%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+NDTS  II+   ++N   G  +VAYTFDAGPNAV+       A   V+ +   
Sbjct  221  FPPIFYLNDTSRHIIALAHRFNAHHGRTKVAYTFDAGPNAVIFTLADTVAE-FVEVVKRS  279

Query  539  FPP--NSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICT  366
            FPP  N D  L    +G  S+      ++L     + P P           G + Y + T
Sbjct  280  FPPATNGDPFLRGLPVGSASL-----PEELLAAVVMEPVP-----------GAIRYILHT  323

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            +PG GP +L D +Q LL  + GLP+
Sbjct  324  QPGPGPQLLDDPSQHLLGAD-GLPR  347



>ref|XP_007549941.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia formosa]
Length=404

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 79/144 (55%), Gaps = 20/144 (14%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +II  V ++N+  G  +VAY+FDAGPNAV+    ++     VQ +  +F
Sbjct  275  PPIFYLNSVSQQIIHLVHRYNKYCGETRVAYSFDAGPNAVIFTL-QQFVPEFVQLVQHFF  333

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICTR  363
            PP+ +              G+  IK L  V+      E+K NI  +   KG ++Y I T+
Sbjct  334  PPDRN--------------GEDFIKGL-PVKGAALSMELKQNIGLEPVPKG-INYIISTK  377

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP V+ D +Q LL+ E GLPK
Sbjct  378  AGPGPRVVDDPSQHLLSAE-GLPK  400



>gb|EAW66790.1| mevalonate (diphospho) decarboxylase, isoform CRA_a [Homo sapiens]
Length=269

 Score = 75.5 bits (184),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  140  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHG  198

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  199  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  243

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  244  VGPGPQILDDPCAHLLGPD-GLPK  266



>ref|XP_008468875.1| PREDICTED: diphosphomevalonate decarboxylase [Diaphorina citri]
Length=448

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 54/142 (38%), Positives = 73/142 (51%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPI YMNDTSH I+  V ++N   G  +VAYTFDAGPNA +         LL+  L+ YF
Sbjct  319  PPIVYMNDTSHSIVRFVHEFNTVVGETKVAYTFDAGPNACLYVL-ENTVPLLLSTLVQYF  377

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP+S    + Y+          G++ LN    + PP ++    P +  G + Y I T+ G
Sbjct  378  PPSSGIS-APYI---------RGLEYLN----ILPPVQLPSFTP-QPAGLLQYLISTKIG  422

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP +L D     L  E G PK
Sbjct  423  SGPKILDDIPNNHLLNEAGAPK  444



>gb|KIK39127.1| hypothetical protein CY34DRAFT_808602 [Suillus luteus UH-Slu-Lm8-n1]
Length=395

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 53/142 (37%), Positives = 73/142 (51%), Gaps = 20/142 (14%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFYMND S  II+ + ++NR    P+ AYT+DAGPNAV+          + Q +L+YF
Sbjct  271  PPIFYMNDVSRAIIAIITEYNRLSEQPKAAYTYDAGPNAVIYTLTPNVRE-IAQLILYYF  329

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            P             +K ++G        +V+A  P    +        G V   I TR G
Sbjct  330  PQ-----------AEKVVIGG------QEVQAALPEGFNEAVAKRWEVGSVKGLIHTRVG  372

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP VLSD ++ALLN + G+PK
Sbjct  373  DGPRVLSD-SEALLNAQ-GIPK  392



>ref|XP_006212468.1| PREDICTED: diphosphomevalonate decarboxylase [Vicugna pacos]
Length=400

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 74/146 (51%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLSDTSRRIIHLVHRFNALHGHTKVAYTFDAGPNAVIFTLDETVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G   + ++L D    +L  V    P P           G + Y I 
Sbjct  330  FPPESNGD--KFLQGLPVEPALLSD----ELKAVLGEDPAP-----------GGIKYIIA  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  373  TQVGPGPQVLDDPGAHLLGPD-GLPK  397



>ref|XP_002111980.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
 gb|EDV25947.1| hypothetical protein TRIADDRAFT_55561 [Trichoplax adhaerens]
Length=385

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 75/145 (52%), Gaps = 20/145 (14%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPI YMND SH+I+  +  +N+  G  +  YTFDAGPNAV+    +    +L   +  YF
Sbjct  257  PPIAYMNDISHKIVQLITHFNQYCGEYKACYTFDAGPNAVLYVLAKDVPQIL-SAVCHYF  315

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPE---IKDNIPTKNKGDVSYFICT  366
            P   + D  SY+          G+ + +DV+  P   E     D IP    G ++  I T
Sbjct  316  PCTENHD--SYI---------QGLSNYSDVKEFPKEIENTICLDPIP----GSLTGIIHT  360

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            R G GP V+ D+ ++LL  + GLPK
Sbjct  361  RVGSGPRVILDDNESLLGGD-GLPK  384



>ref|XP_008490184.1| PREDICTED: diphosphomevalonate decarboxylase [Calypte anna]
Length=310

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 69/142 (49%), Gaps = 16/142 (11%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S  IIS V ++N   G  +VAYTFDAGPNAV+       A   V+ ++  
Sbjct  181  FPPIFYLNDISRHIISLVHRFNAHHGHIKVAYTFDAGPNAVIFTLEDTVAE-FVEVVMRS  239

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            FPP  +              GD  I+ L    A  P   +   +     G + Y + T+P
Sbjct  240  FPPAPN--------------GDQFIQGLPVGSATLPEELVASVVRDPVPGAIRYILHTKP  285

Query  359  GRGPVVLSDETQALLNPETGLP  294
            G GP ++ D  Q LL  + GLP
Sbjct  286  GPGPQLVDDPKQHLLGAD-GLP  306



>ref|XP_004753891.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
 ref|XP_004814744.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
Length=400

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 75/151 (50%), Gaps = 32/151 (21%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS R++  V ++N   G  +VAYTFDAGPNAV+ A +       V  +   
Sbjct  271  FPPISYLSDTSRRVVHLVHRFNAHHGQTKVAYTFDAGPNAVVFALHDTVPE-FVAAVRHC  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPP-----EIK---DNIPTKNKGDV  384
            FPP S+        GDK + G            LP PP     E+K   D  PT   G V
Sbjct  330  FPPESN--------GDKFLKG------------LPVPPVPLSDELKAVLDVDPT--PGGV  367

Query  383  SYFICTRPGRGPVVLSDETQALLNPETGLPK  291
             Y I T+ G GP +L D    LL P+ GLPK
Sbjct  368  KYIIATQVGPGPQILEDPHAHLLGPD-GLPK  397



>ref|XP_003460964.1| PREDICTED: diphosphomevalonate decarboxylase [Cavia porcellus]
Length=402

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 57/144 (40%), Positives = 72/144 (50%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RI+  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIMQLVHRFNAYHGQTKVAYTFDAGPNAVIFTLDDTMAE-FVAVVRHV  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP         V GDK + G         V  +P   E+K  +  +   G V Y I T+
Sbjct  330  FPPE--------VNGDKFLKG-------LPVTPVPVSDELKATLAMEPVPGGVQYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL P+ GLPK
Sbjct  375  VGPGPQVLDDPDAHLLGPD-GLPK  397



>ref|XP_005335532.1| PREDICTED: diphosphomevalonate decarboxylase [Ictidomys tridecemlineatus]
Length=384

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+ND S RI+  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  255  FPPISYLNDVSRRIVQLVHRFNACHGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  313

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  + P   +K  +  + + G V Y I T+
Sbjct  314  FPPETN--------------GDKFLKGLQ-VTPVLPSDTLKAALAMEPSPGGVQYIIATQ  358

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  359  VGPGPQILDDPHAHLLGPD-GLPK  381



>ref|XP_005531982.1| PREDICTED: diphosphomevalonate decarboxylase [Pseudopodoces humilis]
Length=399

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/145 (34%), Positives = 74/145 (51%), Gaps = 16/145 (11%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ D S  II+   ++N   G  +VAYTFDAGPNAV+   + +A A  V+ +   
Sbjct  270  FPPIFYLTDVSRHIIALAHRYNAHHGHTKVAYTFDAGPNAVIFLLD-EAVAEFVEVVRRS  328

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            FPP+++              GD  ++ L    A+     +   +     G V Y + T+P
Sbjct  329  FPPSTN--------------GDQFVRGLPVGSAVLSQELVAAVVSKPVPGAVQYILHTKP  374

Query  359  GRGPVVLSDETQALLNPETGLPK*R  285
            G GP ++ D +Q LL  + GLP+ R
Sbjct  375  GPGPQLVDDPSQHLLGAD-GLPRSR  398



>ref|XP_005862568.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Myotis 
brandtii]
Length=382

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  253  FPPISYLNDTSRRIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  311

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V+  P   E+K  +      G + Y I T+
Sbjct  312  FPPESN--------------GDKFLKGL-PVKPGPLSDELKAALGMDPTPGSIKYIIATQ  356

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L      LL P+ GLPK
Sbjct  357  VGPGPQILDHPHAHLLGPD-GLPK  379



>ref|XP_008308874.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
 ref|XP_008308875.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
Length=403

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 74/143 (52%), Gaps = 18/143 (13%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N+ S ++I+ V ++N   G  +VAYTFDAGPNAV+    R      V  +  +F
Sbjct  275  PPIFYLNNVSRQVINLVHRYNAHYGKTRVAYTFDAGPNAVIFTLERHVPE-FVSVVQHFF  333

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKD-NIPTKNKGDVSYFICTRP  360
            PP               I G   IK L   ++L P   +K   +    KG +SY I T+P
Sbjct  334  PPE--------------INGGQFIKGLPVKDSLLPEDLVKAIGLEPMPKG-ISYVISTKP  378

Query  359  GRGPVVLSDETQALLNPETGLPK  291
            G GP V+ D ++ L+    GLPK
Sbjct  379  GPGPCVVQDPSEHLIG-SNGLPK  400



>ref|XP_003442298.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oreochromis 
niloticus]
Length=402

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 75/142 (53%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +IIS V ++N+  G  +VAYTFDAGPNAV+    +      V  +  +F
Sbjct  274  PPIFYLNHVSQQIISLVHRYNKHYGETRVAYTFDAGPNAVIFTLQQHVPE-FVHVVQHFF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  +T+ + ++ G          ++L     L P P          KG ++Y I T+ G
Sbjct  333  PP--ETNGADFIKGLPVNCASLS-EELKQGIGLEPMP----------KG-INYIISTKVG  378

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP V+ D TQ LL+ + G PK
Sbjct  379  PGPCVVEDPTQQLLSSD-GFPK  399



>ref|XP_006987448.1| PREDICTED: diphosphomevalonate decarboxylase [Peromyscus maniculatus 
bairdii]
Length=401

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 54/146 (37%), Positives = 73/146 (50%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G      +L D    +L    A+ P P           G + Y I 
Sbjct  331  FPPATNGD--KFLKGLPVTPVLLSD----ELKAALAMEPSP-----------GAIQYIIA  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL +    LL P+ GLP+
Sbjct  374  TQVGPGPQVLDNSHAHLLGPD-GLPQ  398



>ref|XP_007887516.1| PREDICTED: diphosphomevalonate decarboxylase [Callorhinchus milii]
Length=399

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/144 (35%), Positives = 74/144 (51%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+N+ S RII+ V K+N   G  +VAYTFDAGPNAV+   ++      V+ +  +
Sbjct  272  FPPIFYLNNISRRIINLVHKYNSHHGETRVAYTFDAGPNAVIYTLHQHVEE-FVEVVKHF  330

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP  +              G   +K L  V+++    ++K +I T   K  + Y I T+
Sbjct  331  FPPEEN--------------GGQFLKGL-PVKSVSLSEQLKSSIQTDPVKAGIQYIISTK  375

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP ++      LL  + GLPK
Sbjct  376  VGPGPQLMEGPNHHLLGKD-GLPK  398



>gb|EFA74532.1| diphosphomevalonate decarboxylase [Polysphondylium pallidum PN500]
Length=399

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/145 (36%), Positives = 78/145 (54%), Gaps = 16/145 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            P I+Y+NDTS  I++ V K+N+  G  + AYTFDAGPNA +          +V+ L  + 
Sbjct  257  PAIYYLNDTSRYIMNLVHKYNKMSGKIKCAYTFDAGPNACIYLPEEN----VVEALALFT  312

Query  536  PPNSDTDLSSYVIG-DKSILGDAGIKDLNDVEALPPPPEIKDNI-PTKNKGD-VSYFICT  366
                 +DLS+Y  G DKS        ++  +E   PP  I+    P     D + Y + T
Sbjct  313  KHFPGSDLSTYYRGSDKS--------NIEKIEHYQPPKNIQTLFAPEVTFADSLKYILHT  364

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L DE+++L++  TGLPK
Sbjct  365  KIGPGPQIL-DESESLIDKSTGLPK  388



>dbj|BAC40852.1| unnamed protein product [Mus musculus]
 dbj|BAE32901.1| unnamed protein product [Mus musculus]
Length=401

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N  +G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNTHQGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIGDK---SILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G +    +L D    +L    A+ P P           G V Y I 
Sbjct  331  FPPAANGD--KFLKGLQVAPVLLSD----ELKAALAVEPSP-----------GGVQYIIA  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL  + GLP+
Sbjct  374  TQVGPGPQVLDDTHDHLLGQD-GLPQ  398



>ref|XP_006259868.1| PREDICTED: diphosphomevalonate decarboxylase [Alligator mississippiensis]
Length=222

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 72/144 (50%), Gaps = 20/144 (14%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ D S R+I+   ++N   G  +VAYTFDAGPNAV+           V+ +   
Sbjct  84   FPPIFYLTDVSRRVIALAHRFNTHHGATKVAYTFDAGPNAVIFTLEDTVDE-FVEVVKRS  142

Query  539  FPPNSDTD--LSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICT  366
            FPP S+ D  L    +G  ++L +    +L     L P P           G + Y + T
Sbjct  143  FPPESNGDQFLQGLPVG-PAVLSE----ELQSAVVLEPVP-----------GAIRYILHT  186

Query  365  RPGRGPVVLSDETQALLNPETGLP  294
            +PG GP +L D +  LL P+ GLP
Sbjct  187  QPGPGPQLLEDPSLHLLGPD-GLP  209



>ref|XP_005892469.1| PREDICTED: diphosphomevalonate decarboxylase [Bos mutus]
Length=400

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 74/148 (50%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLSDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVVFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK-----DNIPTKNKGDVSYF  375
            FPP S+              GD  +K L  VE +    E+K     D +P    G + Y 
Sbjct  330  FPPESN--------------GDKFLKGL-PVEPVLLSDELKAALGMDPVP----GSIRYI  370

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  371  IATQVGPGPQVLDDPGAHLLGPD-GLPK  397



>ref|XP_006780089.1| PREDICTED: diphosphomevalonate decarboxylase-like [Neolamprologus 
brichardi]
Length=402

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 77/142 (54%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +IIS V ++N+  G  +VAYTFDAGPNAV+   +++     V  +  +F
Sbjct  274  PPIFYLNHVSQQIISLVHRYNKHCGETRVAYTFDAGPNAVIFT-SQQHVPEFVHVVQHFF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  +T+ + ++ G          ++L     L P P          KG ++Y I T+ G
Sbjct  333  PP--ETNGADFIKGLPVNCASLS-EELKQGIGLEPMP----------KG-INYIISTKAG  378

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP V+ D TQ LL+ + G PK
Sbjct  379  PGPHVVEDPTQHLLSSD-GFPK  399



>ref|XP_006043222.1| PREDICTED: diphosphomevalonate decarboxylase [Bubalus bubalis]
Length=400

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 74/148 (50%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLSDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVVFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK-----DNIPTKNKGDVSYF  375
            FPP S+              GD  +K L  VE +    E+K     D +P    G + Y 
Sbjct  330  FPPESN--------------GDKFLKGL-PVEPVLLSDELKAALGMDPVP----GSIRYI  370

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  371  IATQVGPGPQVLDDPGAHLLGPD-GLPK  397



>ref|XP_005753004.1| PREDICTED: diphosphomevalonate decarboxylase-like [Pundamilia 
nyererei]
Length=402

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 52/142 (37%), Positives = 75/142 (53%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +IIS V ++N+  G  +VAYTFDAGPNAV+    +      V  + ++F
Sbjct  274  PPIFYLNHVSQQIISLVHRYNKHYGETRVAYTFDAGPNAVIFTLQQHVPE-FVHMVQYFF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  +T+ + ++ G          ++L     L P P          KG ++Y I T+ G
Sbjct  333  PP--ETNGADFIKGLPVNCASLS-EELKQGIGLEPMP----------KG-INYIISTKAG  378

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP V+ D TQ LL  + G PK
Sbjct  379  PGPRVVEDPTQHLLLSD-GFPK  399



>ref|XP_010842266.1| PREDICTED: diphosphomevalonate decarboxylase [Bison bison bison]
Length=400

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 74/148 (50%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +    A  V  +   
Sbjct  271  FPPISYLSDTSRRIIQLVHRFNAHHGQTKVAYTFDAGPNAVVFTLD-DTVAEFVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK-----DNIPTKNKGDVSYF  375
            FPP S+              GD  +K L  VE +    E+K     D +P    G + Y 
Sbjct  330  FPPESN--------------GDKFLKGL-PVEPVLLSDELKAALGMDPVP----GSIRYI  370

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  371  IATQVGPGPQVLDDPGAHLLGPD-GLPK  397



>ref|NP_619597.2| diphosphomevalonate decarboxylase [Mus musculus]
 sp|Q99JF5.2|MVD1_MOUSE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Mus musculus]
 dbj|BAE22291.1| unnamed protein product [Mus musculus]
 gb|EDL11681.1| mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N  +G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNTHQGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIGDK---SILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G +    +L D    +L    A+ P P           G V Y I 
Sbjct  331  FPPAANGD--KFLKGLQVAPVLLSD----ELKAALAVEPSP-----------GGVQYIIA  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL  + GLP+
Sbjct  374  TQVGPGPQVLDDTHDHLLGQD-GLPQ  398



>ref|XP_011188872.1| PREDICTED: diphosphomevalonate decarboxylase [Bactrocera cucurbitae]
Length=390

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/142 (35%), Positives = 70/142 (49%), Gaps = 15/142 (11%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PP  YMND SH I+  V  +N++ G  ++AY+FDAGPNA +    +  +  L      +
Sbjct  261  FPPCVYMNDVSHAIVEFVHAFNKAAGEVKLAYSFDAGPNACLFLLEKDVSTALAAIQTSF  320

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
              PN   +   YV   K I      +++N            D++P  +K    Y I TR 
Sbjct  321  --PNDAGESVEYV---KGIPIKCATEEIN---------AFSDDLPKHDKNLFKYIIHTRI  366

Query  359  GRGPVVLSDETQALLNPETGLP  294
            G GP  L D++Q+LLN  TGLP
Sbjct  367  GTGPQRL-DKSQSLLNISTGLP  387



>emb|CAC35731.1| diphosphomevalonate decarboxylase [Mus musculus]
Length=401

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N  +G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNTHQGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIGDK---SILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G +    +L D    +L    A+ P P           G V Y I 
Sbjct  331  FPPAANGD--KFLKGLQVAPVLLSD----ELKAALAVEPSP-----------GGVQYIIA  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL  + GLP+
Sbjct  374  TQVGPGPQVLDDTHDHLLGQD-GLPQ  398



>ref|XP_003917347.1| PREDICTED: diphosphomevalonate decarboxylase [Papio anubis]
Length=401

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 73/145 (50%), Gaps = 19/145 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVKHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICT  366
            FPP+S+              GDA +K L  V   P   E++  +  +    G V Y I T
Sbjct  330  FPPDSN--------------GDAFLKGLQ-VRPAPLSAELQAALAMEPTTPGGVKYIIAT  374

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L + +  LL P+ GLPK
Sbjct  375  QVGPGPQILDNPSAHLLGPD-GLPK  398



>ref|XP_005862569.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Myotis 
brandtii]
Length=400

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V+  P   E+K  +      G + Y I T+
Sbjct  330  FPPESN--------------GDKFLKGL-PVKPGPLSDELKAALGMDPTPGSIKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L      LL P+ GLPK
Sbjct  375  VGPGPQILDHPHAHLLGPD-GLPK  397



>ref|XP_004905145.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Heterocephalus glaber]
Length=402

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 73/148 (49%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS R++  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLSDTSRRVMQLVHRFNAHYGQTKVAYTFDAGPNAVLFTLDDTMAE-FVAVVRHT  329

Query  539  FPPNSDTDLSSYVIGDKSILG----DAGIKD-LNDVEALPPPPEIKDNIPTKNKGDVSYF  375
            FPP +D        GDK + G     A I D L    A+ P P           G V Y 
Sbjct  330  FPPEAD--------GDKFLKGLPVTPAPISDELKATLAMEPVP-----------GGVQYV  370

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  371  IATQVGPGPQVLDDPDAHLLGPD-GLPK  397



>ref|XP_003758532.1| PREDICTED: diphosphomevalonate decarboxylase [Sarcophilus harrisii]
Length=398

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 72/144 (50%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS +IIS V  +N   G  +VAYTFDAGPNAV+           V  +   
Sbjct  269  FPPICYLNDTSRQIISLVHCFNAHYGKTKVAYTFDAGPNAVIFTLEDTVDE-FVAVIKQI  327

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP  +              GD  +K L  VE +    E+K  +P +   G + Y I T+
Sbjct  328  FPPEVN--------------GDKFLKGL-PVEPVELSEELKSALPMEPCPGGIRYIIATQ  372

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D  Q LL P+ GLP+
Sbjct  373  VGPGPQVLQDPQQHLLGPD-GLPQ  395



>ref|XP_006762260.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Myotis 
davidii]
Length=382

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 70/149 (47%), Gaps = 28/149 (19%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  253  FPPISYLNDTSRRIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  311

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALP-PPPEIKDNIPTK-----NKGDVSY  378
            FPP S+        GDK + G            LP  P  + D +          G + Y
Sbjct  312  FPPESN--------GDKFLKG------------LPVKPGRLSDELKAALGMDPTPGSIKY  351

Query  377  FICTRPGRGPVVLSDETQALLNPETGLPK  291
             I T+ G GP +L      LL P+ GLPK
Sbjct  352  IIATQVGPGPQILDHPHAHLLGPD-GLPK  379



>ref|XP_009561527.1| PREDICTED: diphosphomevalonate decarboxylase [Cuculus canorus]
Length=365

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/147 (36%), Positives = 76/147 (52%), Gaps = 18/147 (12%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S  IIS   ++N   G  +VAYTFDAGPNAV+       A   V+ +   
Sbjct  236  FPPIFYLNDISRHIISLAHRFNAHHGRTKVAYTFDAGPNAVIFTLADTVAE-FVEVVRRS  294

Query  539  FPPNSDTDLSSYVIGDKSILGDAGI-KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTR  363
            FPP ++ D   +V G    +G A + ++L     + P P           G + Y + T+
Sbjct  295  FPPATNGD--QFVRGLP--VGSASLPEELLTAVVMEPVP-----------GAIQYILHTK  339

Query  362  PGRGPVVLSDETQALLNPETGLPK*RT  282
            PG GP  + D +Q LL  + GLP+ R+
Sbjct  340  PGPGPQPVDDASQHLLGAD-GLPRCRS  365



>ref|XP_007992523.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Chlorocebus 
sabaeus]
 ref|XP_007992524.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Chlorocebus 
sabaeus]
Length=401

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 72/145 (50%), Gaps = 19/145 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICT  366
            FPP S+              GDA +K L  V   P   E++  +  +    G V Y I T
Sbjct  330  FPPGSN--------------GDAFLKGLQ-VRPAPLSAELQAALAMEPTTPGGVKYIIAT  374

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L + +  LL P+ GLPK
Sbjct  375  QVGPGPQILDNPSAHLLGPD-GLPK  398



>emb|CEI99330.1| Putative Diphosphomevalonate decarboxylase [Rhizopus microsporus]
Length=411

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/152 (38%), Positives = 79/152 (52%), Gaps = 25/152 (16%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRS--EGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLF  543
            PPIFYMNDTS  II  + ++N S  +G  + AYT+DAGPNAV+ A +++    ++Q +  
Sbjct  272  PPIFYMNDTSRAIIQLIHEYNASSPDGKLKAAYTYDAGPNAVIYA-SKEHMPEIIQLIGH  330

Query  542  YFPPNSDTD---LSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDN-----IPTKNKGD  387
            YFP N ++       Y +   + LG   I            P+   N     IP +  G 
Sbjct  331  YFPSNKESSEFFADPYNVAQGTKLGQDFI------------PKTHTNFNEKVIPVQPAGS  378

Query  386  VSYFICTRPGRGPVVLSDETQALLNPETGLPK  291
            VS  + T+   GP VLS E  +LLN E GLPK
Sbjct  379  VSRLLHTKVHDGPRVLS-EADSLLNAE-GLPK  408



>ref|XP_423130.3| PREDICTED: diphosphomevalonate decarboxylase isoform X4 [Gallus 
gallus]
Length=398

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/143 (37%), Positives = 76/143 (53%), Gaps = 18/143 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S RII+   ++N   G  +VAYTFDAGPNAV+           V+ +   
Sbjct  269  FPPIFYLNDISQRIIALAHRFNAHHGRTKVAYTFDAGPNAVVFMLE-DTVDEFVEVVRRS  327

Query  539  FPPNSDTDLSSYVIGDKSILGDAGI-KDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTR  363
            FPP+S+ D   ++ G    +G A + ++L     + P P           G + Y + T+
Sbjct  328  FPPDSNGD--QFLRGRP--VGTAVLPEELVSAVVVDPVP-----------GAIRYVLHTK  372

Query  362  PGRGPVVLSDETQALLNPETGLP  294
            PG GP +L D +Q LL P+ GLP
Sbjct  373  PGPGPQLLDDPSQHLLGPD-GLP  394



>ref|XP_006097406.1| PREDICTED: diphosphomevalonate decarboxylase [Myotis lucifugus]
Length=400

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V+  P   E+K  +      G + Y I T+
Sbjct  330  FPPESN--------------GDKFLKGL-PVKPGPLSDELKAALGMDPTPGGIKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L      LL P+ GLPK
Sbjct  375  VGPGPQILDHPHAHLLGPD-GLPK  397



>ref|XP_003922886.1| PREDICTED: diphosphomevalonate decarboxylase [Saimiri boliviensis 
boliviensis]
Length=400

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++  S RII  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  271  FPPISYLSHISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLEDTVAD-FVAAVRHA  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V+  P P E++  +  +   G + Y I T+
Sbjct  330  FPPGSN--------------GDTFLKGLQ-VKPAPLPAELEAALAMEPTPGGIKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILDDPCSHLLGPD-GLPK  397



>ref|XP_004842741.1| PREDICTED: diphosphomevalonate decarboxylase [Heterocephalus 
glaber]
Length=423

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/148 (39%), Positives = 73/148 (49%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS R++  V ++N   G  +VAYTFDAGPNAV+   +    A  V  +   
Sbjct  292  FPPISYLSDTSRRVMQLVHRFNAHYGQTKVAYTFDAGPNAVLFTLD-DTMAEFVAVVRHT  350

Query  539  FPPNSDTDLSSYVIGDKSILG----DAGIKD-LNDVEALPPPPEIKDNIPTKNKGDVSYF  375
            FPP +D        GDK + G     A I D L    A+ P P           G V Y 
Sbjct  351  FPPEAD--------GDKFLKGLPVTPAPISDELKATLAMEPVP-----------GGVQYV  391

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  392  IATQVGPGPQVLDDPDAHLLGPD-GLPK  418



>emb|CEG85085.1| Putative Diphosphomevalonate decarboxylase [Rhizopus microsporus]
Length=338

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 79/152 (52%), Gaps = 25/152 (16%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRS--EGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLF  543
            PPIFYMNDTS  II  + ++N S  +G  + AYT+DAGPNAV+ A +++    ++Q +  
Sbjct  199  PPIFYMNDTSRAIIQLIHEYNASSPDGKLKAAYTYDAGPNAVIYA-SKEHMPEIIQLIGH  257

Query  542  YFPPN---SDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDN-----IPTKNKGD  387
            YFP N   S+     Y +   + LG   I            P+   N     IP +  G 
Sbjct  258  YFPSNKEPSEFFADPYNVAQGTKLGQDFI------------PKTHTNFNEKVIPVQPAGS  305

Query  386  VSYFICTRPGRGPVVLSDETQALLNPETGLPK  291
            VS  + T+   GP VLS E  +LLN E GLPK
Sbjct  306  VSRLLHTKVHDGPRVLS-EADSLLNAE-GLPK  335



>ref|XP_006762259.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Myotis 
davidii]
Length=400

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 70/149 (47%), Gaps = 28/149 (19%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALP-PPPEIKDNIPTK-----NKGDVSY  378
            FPP S+        GDK + G            LP  P  + D +          G + Y
Sbjct  330  FPPESN--------GDKFLKG------------LPVKPGRLSDELKAALGMDPTPGSIKY  369

Query  377  FICTRPGRGPVVLSDETQALLNPETGLPK  291
             I T+ G GP +L      LL P+ GLPK
Sbjct  370  IIATQVGPGPQILDHPHAHLLGPD-GLPK  397



>ref|XP_004015005.1| PREDICTED: diphosphomevalonate decarboxylase [Ovis aries]
Length=391

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 74/148 (50%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  262  FPPISYLSDTSRRIIQLVHRFNAHHGRTKVAYTFDAGPNAVVFTLDDTVAE-FVAAVRHS  320

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK-----DNIPTKNKGDVSYF  375
            FPP S+              G+  +K L  VE +    E+K     D +P    G + Y 
Sbjct  321  FPPESN--------------GEKFLKGL-PVEPILLSDELKAALGMDPVP----GSIRYI  361

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  362  IATQVGPGPQVLDDPVAHLLGPD-GLPK  388



>ref|XP_005345851.1| PREDICTED: diphosphomevalonate decarboxylase [Microtus ochrogaster]
Length=401

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 72/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V  +N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHGFNTHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G     ++L D    +L    A+ P P           G V Y I 
Sbjct  331  FPPATNGD--KFLKGLPVTPALLSD----ELKAALAMEPSP-----------GAVQYIIS  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL +    LL P+ GLP 
Sbjct  374  TQVGPGPQVLGNAHAHLLGPD-GLPH  398



>ref|XP_005073260.1| PREDICTED: diphosphomevalonate decarboxylase [Mesocricetus auratus]
Length=401

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/146 (38%), Positives = 72/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V  +N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHCFNTHHGQTKVAYTFDAGPNAVVFTLDDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G      +L D    +L    AL P P           G V Y I 
Sbjct  331  FPPATNGD--KFLKGLPVTPVLLSD----ELKAALALEPSP-----------GAVQYIIA  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL +    LL P+ GLP+
Sbjct  374  TQVGPGPQVLDNSHAHLLGPD-GLPQ  398



>ref|XP_001488083.1| PREDICTED: diphosphomevalonate decarboxylase [Equus caballus]
Length=400

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 72/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS  II  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRCIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTMAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G     ++L D    +L     + P P           G + Y I 
Sbjct  330  FPPESNGD--KFLKGLPVRPALLSD----ELKAALGMEPTP-----------GGIKYIIA  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  373  TQVGPGPQVLDDPHAHLLGPD-GLPK  397



>ref|XP_008506971.1| PREDICTED: diphosphomevalonate decarboxylase [Equus przewalskii]
Length=400

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 72/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS  II  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRCIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTMAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G     ++L D    +L     + P P           G + Y I 
Sbjct  330  FPPESNGD--KFLKGLPVRPALLSD----ELKAALGMEPTP-----------GGIKYIIA  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  373  TQVGPGPQVLDDPHAHLLGPD-GLPK  397



>ref|XP_004362385.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
 gb|EGG24534.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
Length=415

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 50/145 (34%), Positives = 80/145 (55%), Gaps = 16/145 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPI+Y+NDTS  I++ + ++N+  G+ + AYTFDAGPNA  I   +++ A ++   L +F
Sbjct  280  PPIYYLNDTSRYIMNLIHRYNKLAGSVRCAYTFDAGPNAC-IYLPQESVAEVLSLFLKHF  338

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNK---GDVSYFICT  366
            P      + +Y  G   +        +ND +    PP+    + T        + Y + T
Sbjct  339  PAGE--GVQNYYRGTDEVFA-----KVNDYQ----PPKNMHTLYTPEVTFPNSLKYILHT  387

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            R G GP +LSD +++L+N ETGLPK
Sbjct  388  RVGPGPRILSD-SESLINLETGLPK  411



>ref|XP_005819249.1| mevalonate pyrophosphate decarboxylase [Guillardia theta CCMP2712]
 gb|EKX32269.1| mevalonate pyrophosphate decarboxylase [Guillardia theta CCMP2712]
Length=378

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 69/142 (49%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+NDTS  II  V  +N   G    AYTFDAGPNAV+          L  R+   F
Sbjct  253  PPIFYLNDTSRAIIQFVHAFNEEMGQICAAYTFDAGPNAVLFVEEANLVK-LAHRVSAAF  311

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP+ D  L  ++  D+           N V+ +      +D       G V Y I T+ G
Sbjct  312  PPSKDKTLEDHLADDEL---------RNKVQEVGGWEADQD-----MGGRVKYIIHTKVG  357

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP  L+ E ++L++  +GLPK
Sbjct  358  CGPSALT-EDESLIDLSSGLPK  378



>ref|XP_005256369.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Homo 
sapiens]
Length=379

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  250  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHG  308

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  309  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  353

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  354  VGPGPQILDDPCAHLLGPD-GLPK  376



>gb|AAP36301.1| Homo sapiens mevalonate (diphospho) decarboxylase [synthetic 
construct]
 gb|AAX43880.1| mevalonate (diphospho) decarboxylase, partial [synthetic construct]
Length=401

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHG  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  330  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILDDPCAHLLGPD-GLPK  397



>ref|NP_002452.1| diphosphomevalonate decarboxylase [Homo sapiens]
 sp|P53602.1|MVD1_HUMAN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Homo sapiens]
 pdb|3D4J|A Chain A, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 pdb|3D4J|B Chain B, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 gb|AAC50440.1| mevalonate pyrophosphate decarboxylase [Homo sapiens]
 gb|AAH00011.1| Mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAP35576.1| mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAX32278.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|EAW66792.1| mevalonate (diphospho) decarboxylase, isoform CRA_c [Homo sapiens]
 gb|ABM84650.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|ABM92179.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 dbj|BAI45751.1| mevalonate (diphospho) decarboxylase [synthetic construct]
Length=400

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVWHG  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  330  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILDDPCAHLLGPD-GLPK  397



>ref|XP_004310733.1| PREDICTED: diphosphomevalonate decarboxylase [Tursiops truncatus]
Length=400

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII     +N   G  +VAYTFDAG NAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIIQLAHCFNAHHGQTKVAYTFDAGANAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP  +              GD  +K L  VE +P   E+K  + T    G + Y I T+
Sbjct  330  FPPELN--------------GDKFLKGL-PVEPVPLSDELKAALGTDPTPGGIKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL P+ GLPK
Sbjct  375  VGPGPQVLDDPGAHLLGPD-GLPK  397



>ref|XP_009079223.1| PREDICTED: diphosphomevalonate decarboxylase, partial [Acanthisitta 
chloris]
Length=199

 Score = 72.4 bits (176),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/144 (33%), Positives = 72/144 (50%), Gaps = 20/144 (14%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVM--IARNRKAAALLVQRLL  546
             PPIFY+ND S  II+   ++N   G  +VAY+FDAGPNAV+  +A        +V+R  
Sbjct  70   FPPIFYLNDLSRHIIALAHRFNTHHGHTKVAYSFDAGPNAVIFTLADTVDEFVEVVRR--  127

Query  545  FYFPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICT  366
              FPP ++              GD  ++ L    A+ P   +   +     G + Y + T
Sbjct  128  -SFPPATN--------------GDQFVRGLPVGSAVLPQELVATVVTEPIPGAIQYILHT  172

Query  365  RPGRGPVVLSDETQALLNPETGLP  294
            +PG GP ++ D +Q LL  + GLP
Sbjct  173  KPGPGPQLVDDSSQHLLGAD-GLP  195



>ref|XP_004280113.1| PREDICTED: diphosphomevalonate decarboxylase [Orcinus orca]
Length=400

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII     +N   G  +VAYTFDAG NAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRRIIQLAHCFNTHHGQTKVAYTFDAGANAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP  +              GD  +K L  VE +P   E+K  + T    G + Y I T+
Sbjct  330  FPPELN--------------GDKFLKGL-PVEPVPLSDELKAALGTDPTPGGIKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL P+ GLPK
Sbjct  375  VGPGPQVLDDPGAHLLGPD-GLPK  397



>ref|XP_003418108.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Loxodonta africana]
Length=401

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 69/144 (48%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS  I+  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  272  FPPISYLNDTSRHIMDLVHRFNAHHGQTKVAYTFDAGPNAVVFTLDDTVAE-FVAAVSHC  330

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V  +P   E+K  +      G V Y I T+
Sbjct  331  FPPESN--------------GDKFLKGL-PVRPVPLSDELKTTLALDPTPGGVRYIIATK  375

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL    GLPK
Sbjct  376  AGPGPQILDDPHLHLLGSH-GLPK  398



>ref|XP_006734134.1| PREDICTED: diphosphomevalonate decarboxylase [Leptonychotes weddellii]
Length=400

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RI+  V  +N   G  +VAYTFDAGPNAV+ A +       V  +   
Sbjct  271  FPPISYLSDTSRRIVQLVHCFNAHHGQTKVAYTFDAGPNAVVFALDDTVPE-FVAAVRQC  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V  +P   E+K  +      G V Y I T+
Sbjct  330  FPPESN--------------GDKFLKGL-PVRPVPLSDELKAALDVDPTPGGVKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILDDRQAHLLGPD-GLPK  397



>ref|XP_006888835.1| PREDICTED: diphosphomevalonate decarboxylase [Elephantulus edwardii]
Length=400

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 73/146 (50%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+ DTS RI+  V  +N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  271  FPPISYLTDTSRRIMHLVHDFNTHHGQTKVAYTFDAGPNAVVFTLEDTVAE-FVAAVKHC  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNI---PTKNKGDVSYFIC  369
            FPP S+        GDK + G         ++++P   E+K  +   PT   G + Y I 
Sbjct  330  FPPESN--------GDKFLRG-------LPMKSVPLSDELKATLGLDPT--PGSIQYIIV  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP +L D    LL P+ GLPK
Sbjct  373  TKVGPGPQILDDPLCHLLGPD-GLPK  397



>ref|XP_003495141.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Cricetulus 
griseus]
 ref|XP_007622101.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Cricetulus 
griseus]
 gb|EGV94082.1| Diphosphomevalonate decarboxylase [Cricetulus griseus]
 gb|ERE77824.1| diphosphomevalonate decarboxylase-like protein [Cricetulus griseus]
Length=401

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 71/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V  +N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHCFNTHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G      +L D    +L    A+ P P           G V Y I 
Sbjct  331  FPPATNGD--KFLKGLPVTPVLLSD----ELKAALAMEPSP-----------GGVQYIIA  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL      LL P+ GLP+
Sbjct  374  TQVGPGPQVLDSSNAHLLGPD-GLPQ  398



>ref|XP_004058175.1| PREDICTED: diphosphomevalonate decarboxylase [Gorilla gorilla 
gorilla]
Length=400

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHG  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  330  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILHDPCAHLLGPD-GLPK  397



>gb|AAH08526.1| Mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  +    E+K  +  + + G V Y I T+
Sbjct  331  FPPAAN--------------GDKFLKGLQ-VAPVLLSDELKAALVVEPSPGGVQYIIATQ  375

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL  + GLP+
Sbjct  376  VGPGPQVLDDTHDHLLGQD-GLPQ  398



>ref|XP_009902760.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Picoides pubescens]
Length=397

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 75/145 (52%), Gaps = 20/145 (14%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S  II+ V ++N   G+ +VAYTFDAGPNAV+       A   V+ +   
Sbjct  271  FPPIFYLNDLSRHIIALVHRFNAHHGSTKVAYTFDAGPNAVIFTLADTVAE-FVEVVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKD--LNDVEALPPPPEIKDNIPTKNKGDVSYFICT  366
            FP  ++ D   +V G    +G A + +  L  V A P P            G V Y + T
Sbjct  330  FPTATNGD--QFVRGLP--VGSAALPEELLAAVVAEPVP------------GAVRYILHT  373

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            +PG GP  + D +Q LL  + GLP+
Sbjct  374  KPGPGPQFVDDPSQHLLGAD-GLPR  397



>emb|CDQ87522.1| unnamed protein product [Oncorhynchus mykiss]
Length=402

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 55/149 (37%), Positives = 76/149 (51%), Gaps = 30/149 (20%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+ND S R+I+ V ++NR     +VAYTFDAGPNAV+    +      VQ +   F
Sbjct  274  PPIFYLNDVSRRVINLVHRYNRHYRETKVAYTFDAGPNAVIYTLQQNVEE-FVQVVKHLF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPP-----EIKDNIPTK--NKGDVSY  378
            PP ++        G + + G            LP  P     E+K  I  +   KG +SY
Sbjct  333  PPETN--------GGQFLKG------------LPVAPTTLSEELKQAIGMEPMVKG-ISY  371

Query  377  FICTRPGRGPVVLSDETQALLNPETGLPK  291
             I T+ G GP V+ D ++ LL  + GLPK
Sbjct  372  IISTKAGPGPRVVEDPSEHLLGSD-GLPK  399



>ref|XP_005915248.1| PREDICTED: diphosphomevalonate decarboxylase-like [Haplochromis 
burtoni]
Length=402

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 51/142 (36%), Positives = 74/142 (52%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N  S +IIS V ++N+  G  +VAYTFDAGPNAV+    +      V  + ++F
Sbjct  274  PPIFYLNHVSQQIISLVHRYNKHYGETRVAYTFDAGPNAVIFTLQQHVPE-FVHMVQYFF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  +T+ + ++ G          ++L     L P P          KG ++Y I T+ G
Sbjct  333  PP--ETNGADFIKGLPVNCASLS-EELKQGIGLEPMP----------KG-INYIISTKAG  378

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP  + D TQ LL  + G PK
Sbjct  379  PGPRAVEDPTQHLLLSD-GFPK  399



>emb|CEG64400.1| Putative Diphosphomevalonate decarboxylase [Rhizopus microsporus]
Length=411

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 58/152 (38%), Positives = 79/152 (52%), Gaps = 25/152 (16%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRS--EGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLF  543
            PPIFYMNDTS  II  + ++N S  +G  + AYT+DAGPNAV+ A +++    ++Q +  
Sbjct  272  PPIFYMNDTSRAIIQLIHEYNASSPDGKLKAAYTYDAGPNAVIYA-SKEHMPEIIQLIGH  330

Query  542  YFPPN---SDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDN-----IPTKNKGD  387
            YFP N   S+     Y +   + LG   I            P+   N     IP +  G 
Sbjct  331  YFPSNKEPSEFFADPYNVAQGTKLGQDFI------------PKTHTNFNEKVIPVQPAGS  378

Query  386  VSYFICTRPGRGPVVLSDETQALLNPETGLPK  291
            VS  + T+   GP VLS E  +LLN E GLPK
Sbjct  379  VSRLLHTKVHDGPRVLS-EADSLLNAE-GLPK  408



>ref|XP_010353864.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Rhinopithecus 
roxellana]
Length=401

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 71/145 (49%), Gaps = 19/145 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICT  366
            FPP S+              GDA +K L  V   P   E++  +  +    G V Y I T
Sbjct  330  FPPGSN--------------GDAFLKGLQ-VRPSPLSAELQAALAMEPTTPGGVKYIIAT  374

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L +    LL P+ GLPK
Sbjct  375  QVGPGPQILDNPCAHLLGPD-GLPK  398



>ref|XP_008137975.1| PREDICTED: diphosphomevalonate decarboxylase [Eptesicus fuscus]
Length=400

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS  II  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNDTSRHIIHLVHRFNAHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V+  P   E+K  +      G + Y I T+
Sbjct  330  FPPESN--------------GDKFLKGL-PVKPAPLSDELKAALGMDPTPGGIKYIIATQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L      LL P+ GLPK
Sbjct  375  VGPGPQILDHPHAHLLGPD-GLPK  397



>ref|XP_003287684.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
 gb|EGC35790.1| hypothetical protein DICPUDRAFT_32847 [Dictyostelium purpureum]
Length=388

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/144 (32%), Positives = 79/144 (55%), Gaps = 15/144 (10%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            P I+Y+NDTS  I++ + ++N+  G+ + AYTFDAGPNA +         +L    + +F
Sbjct  258  PAIYYLNDTSRYIMNLIHRYNKLSGSVKCAYTFDAGPNACIYLPEENVVEVL-SLFIKHF  316

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNI--PTKNKGDVSYFICTR  363
            P   D DLS+Y  G K        +++  +++  P  +++      T     + Y + T+
Sbjct  317  P---DQDLSTYYRGPK--------ENVEKIQSYKPNEKLQSLFTPETTFASSLKYILHTK  365

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +LS E+++L++  TGLPK
Sbjct  366  VGPGPQILS-ESESLIDNNTGLPK  388



>ref|XP_007670945.1| PREDICTED: diphosphomevalonate decarboxylase [Ornithorhynchus 
anatinus]
Length=423

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/144 (37%), Positives = 72/144 (50%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS  IIS V ++N   G  +VAYTFDAGPNAV+   +       V  +   
Sbjct  294  FPPICYLNDTSRHIISLVHRFNAHFGKTRVAYTFDAGPNAVIFTLDNTVDD-FVAVVKHS  352

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNI-PTKNKGDVSYFICTR  363
            FPP S+              GD  ++ L  V + P   E+K  + P    G + Y + T+
Sbjct  353  FPPVSN--------------GDQFLQGLQ-VGSAPLSEELKSAMGPELTPGGIRYILVTQ  397

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL+ E GLP+
Sbjct  398  AGPGPQLLEDSHVHLLDAE-GLPR  420



>ref|XP_011497479.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratosolen solmsi 
marchali]
Length=391

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 67/143 (47%), Gaps = 18/143 (13%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PP  YMNDTSH I+  +  +N +    +VAYTFDAGPNA +    +      V  L  YF
Sbjct  257  PPCIYMNDTSHLIVDLIHSYNATSSKIKVAYTFDAGPNATLFLLEKDVPE-FVSVLDHYF  315

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEI--KDNIPTKNKGDVSYFICTR  363
            P           I + +I    GI     +E + P   +  K N   +  G + Y I TR
Sbjct  316  PS----------IENINIEYKKGIA----IETILPSKNLLEKINFTKQTAGKLKYIIHTR  361

Query  362  PGRGPVVLSDETQALLNPETGLP  294
             G GP  LSD    LLN + GLP
Sbjct  362  IGNGPEQLSDCKSHLLNSQ-GLP  383



>ref|XP_003805806.1| PREDICTED: diphosphomevalonate decarboxylase [Pan paniscus]
Length=400

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHG  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  330  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILDDPCAHLLGPD-GLPK  397



>pdb|3F0N|A Chain A, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
 pdb|3F0N|B Chain B, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
Length=414

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 71/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  285  FPPISYLNDTSRRIIQLVHRFNTHHGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  343

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP ++              GD  +K L  V  +    E+K  +  + + G V Y I T+
Sbjct  344  FPPAAN--------------GDKFLKGLQ-VAPVLLSDELKAALVVEPSPGGVQYIIATQ  388

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL D    LL  + GLP+
Sbjct  389  VGPGPQVLDDTHDHLLGQD-GLPQ  411



>gb|ELU38465.1| diphosphomevalonate decarboxylase [Rhizoctonia solani AG-1 IA]
Length=400

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 75/146 (51%), Gaps = 21/146 (14%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIA--RNRKAAALLVQRLLF  543
            PPIFYMND S  I++ VE++NR+ G  + AYT+DAGPNAV+ A   N K    +V  ++ 
Sbjct  270  PPIFYMNDVSRAIVALVEEFNRASGKIRAAYTYDAGPNAVIYAPKENLKE---IVNLIVK  326

Query  542  YFPPNSDTDLSSYVIGDKSILGDAG--IKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            YFP        S    D   + DAG  + DL+  +       +K  I     G V   I 
Sbjct  327  YFP-------QSQTFADPFGVFDAGEQVGDLDLPQGFNAAVAVKYEI-----GAVKGLIH  374

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            TR G GP  L  E  ALL  + GLPK
Sbjct  375  TRVGDGPRALGQE-DALLTSD-GLPK  398



>ref|XP_003800873.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Otolemur garnettii]
Length=400

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 71/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS  II  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  271  FPPISYLNDTSRCIIQLVHRFNAYHGLTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVKHS  329

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP S+ D   ++ G      +L D    +L    A+ P P           G V Y I 
Sbjct  330  FPPESNGD--KFLKGLPVRPVLLSD----ELKAALAMEPTP-----------GGVKYIIA  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL P+ GLPK
Sbjct  373  TQVGPGPQVLDDPHVHLLGPD-GLPK  397



>ref|XP_523460.3| PREDICTED: diphosphomevalonate decarboxylase [Pan troglodytes]
Length=400

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 54/144 (38%), Positives = 70/144 (49%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  271  FPPISYLNAISWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHG  329

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP S+              GD  +K L  V   P   E++  +  +   G V Y I T+
Sbjct  330  FPPGSN--------------GDTFLKGLQ-VRPAPLSAELQAALAMEPTPGGVKYIIVTQ  374

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP +L D    LL P+ GLPK
Sbjct  375  VGPGPQILDDPCAHLLGPD-GLPK  397



>ref|XP_005691918.1| PREDICTED: diphosphomevalonate decarboxylase [Capra hircus]
Length=396

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 74/148 (50%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  267  FPPISYLSDTSRRIIQLVHRFNAHHGRTKVAYTFDAGPNAVVFTLDDTVAE-FVAAVRHS  325

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK-----DNIPTKNKGDVSYF  375
            FPP S+              G+  +K L  VE +    E+K     D +P    G + Y 
Sbjct  326  FPPESN--------------GEKFLKGL-PVEPILLSDELKAALGMDPVP----GSIRYI  366

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  367  IATQVGPGPQVLDDPGAHLLGPD-GLPK  393



>ref|XP_001376834.1| PREDICTED: diphosphomevalonate decarboxylase [Monodelphis domestica]
Length=398

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 72/144 (50%), Gaps = 18/144 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS +IIS V  +N   G  +VAYTFDAGPNAV+           V  +   
Sbjct  269  FPPICYLNDTSRQIISLVHCFNAYYGKTKVAYTFDAGPNAVIFTLEETVDE-FVAVIKQV  327

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFICTR  363
            FPP  +              GD  +K L  VE +    E+K  +P +   G + Y I T+
Sbjct  328  FPPEMN--------------GDKFLKGL-PVEPVELSEEVKSALPMEPFPGGIRYIITTQ  372

Query  362  PGRGPVVLSDETQALLNPETGLPK  291
             G GP VL +  + LL P+ GLPK
Sbjct  373  VGPGPQVLEEPQRQLLGPD-GLPK  395



>ref|XP_010577890.1| PREDICTED: diphosphomevalonate decarboxylase [Haliaeetus leucocephalus]
Length=400

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 52/149 (35%), Positives = 73/149 (49%), Gaps = 22/149 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S  II+   ++N   G  +VAYTFDAGPNAV+        A  V+ +   
Sbjct  271  FPPIFYLNDLSRHIIALAHRFNAHHGRTKVAYTFDAGPNAVIFTLA-DTVAEFVEVVRRS  329

Query  539  FPP--NSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK-NKGDVSYFIC  369
            FPP  N D  +    +G  S+                 P E+   + T+   G V Y + 
Sbjct  330  FPPAANGDQFVRGLPVGSASL-----------------PEELLAAVVTEPVPGAVRYILH  372

Query  368  TRPGRGPVVLSDETQALLNPETGLPK*RT  282
            T+PG GP ++ D +Q LL  + GLP+ R 
Sbjct  373  TKPGPGPQLVDDPSQHLLGAD-GLPRRRA  400



>ref|XP_005956369.1| PREDICTED: diphosphomevalonate decarboxylase [Pantholops hodgsonii]
Length=403

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 57/148 (39%), Positives = 74/148 (50%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y++DTS RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  274  FPPISYLSDTSRRIIQLVHRFNAHHGRTKVAYTFDAGPNAVVFTLDDTMAE-FVAAVRHS  332

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIK-----DNIPTKNKGDVSYF  375
            FPP S+              G+  +K L  VE +    E+K     D +P    G + Y 
Sbjct  333  FPPESN--------------GEKFLKGL-PVEPILLSDELKAALGMDPVP----GSIRYI  373

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP VL D    LL P+ GLPK
Sbjct  374  IATQVGPGPQVLDDPGAHLLGPD-GLPK  400



>gb|EHH31936.1| hypothetical protein EGK_13104, partial [Macaca mulatta]
Length=377

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 54/145 (37%), Positives = 71/145 (49%), Gaps = 19/145 (13%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+N  S RII  V ++N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  247  FPPISYLNAVSWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  305

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTK--NKGDVSYFICT  366
            FPP S+              GDA +K L  V   P   E++  +  +    G V Y I T
Sbjct  306  FPPGSN--------------GDAFLKGLQ-VRPAPLSAELQAALAMEPTTPGGVKYIIAT  350

Query  365  RPGRGPVVLSDETQALLNPETGLPK  291
            + G GP +L D +  LL P+ GL K
Sbjct  351  QVGPGPQILDDPSAHLLGPD-GLLK  374



>ref|XP_007651118.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Cricetulus 
griseus]
 ref|XP_007622102.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Cricetulus 
griseus]
 gb|ERE77825.1| diphosphomevalonate decarboxylase-like protein [Cricetulus griseus]
Length=376

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 71/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V  +N   G  +VAYTFDAGPNAV+   +   A   V  +   
Sbjct  247  FPPISYLNDTSRRIIQLVHCFNTHHGQTKVAYTFDAGPNAVIFTLDDTVAE-FVAAVRHS  305

Query  539  FPPNSDTDLSSYVIG---DKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G      +L D    +L    A+ P P           G V Y I 
Sbjct  306  FPPATNGD--KFLKGLPVTPVLLSD----ELKAALAMEPSP-----------GGVQYIIA  348

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL      LL P+ GLP+
Sbjct  349  TQVGPGPQVLDSSNAHLLGPD-GLPQ  373



>ref|NP_001007423.1| diphosphomevalonate decarboxylase [Danio rerio]
 sp|Q5U403.1|MVD1_DANRE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Danio rerio]
 gb|AAH85325.1| Zgc:100824 [Danio rerio]
Length=400

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/142 (35%), Positives = 72/142 (51%), Gaps = 16/142 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+N+ SH+IIS V ++N+  G  +VAYTFDAGPNAV+ +         V+ +  +F
Sbjct  271  PPIFYLNNISHQIISLVHRYNQYYGETRVAYTFDAGPNAVIYSLQDYLPE-FVEVVRHFF  329

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  + +   +  G      D   + + D+   P P  I+            Y I T+ G
Sbjct  330  PPEVNEE--EFFKGLPVCPADLSEEMIRDINMKPTPNGIR------------YMISTKAG  375

Query  356  RGPVVLSDETQALLNPETGLPK  291
             GP V+ D    LL  + GLPK
Sbjct  376  PGPRVVEDPNLHLLGAD-GLPK  396



>ref|XP_007244091.1| PREDICTED: diphosphomevalonate decarboxylase [Astyanax mexicanus]
Length=404

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 74/141 (52%), Gaps = 16/141 (11%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+ND S R+IS V ++N+     +VAYTFDAGPNAV+            Q +  +F
Sbjct  276  PPIFYLNDISRRVISLVHRYNQHYQETRVAYTFDAGPNAVIYTLQEHVPEFF-QAVRHFF  334

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRPG  357
            PP  +T+   +V G  S+   +  ++L     + P P          KG +SY I T+ G
Sbjct  335  PP--ETNGGEFVKG-LSVDSASLSEELKRAIGMEPVP----------KG-ISYVISTQVG  380

Query  356  RGPVVLSDETQALLNPETGLP  294
             GP V+ +    LL P+ GLP
Sbjct  381  PGPCVVEEPNLHLLGPD-GLP  400



>ref|NP_001133968.1| Diphosphomevalonate decarboxylase [Salmo salar]
 gb|ACI34234.1| Diphosphomevalonate decarboxylase [Salmo salar]
Length=402

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 54/149 (36%), Positives = 76/149 (51%), Gaps = 30/149 (20%)
 Frame = -1

Query  716  PPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFYF  537
            PPIFY+ND S R+I+ V ++NR     +VAYTFDAGPNAV+    +      VQ +  +F
Sbjct  274  PPIFYLNDVSRRVINLVHRYNRHYRETKVAYTFDAGPNAVIYTLQQNVEE-FVQVVKHFF  332

Query  536  PPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPP-----EIKDNIPTK--NKGDVSY  378
            PP  +T+   ++ G                  LP  P     E+K  I  +   KG + Y
Sbjct  333  PP--ETNGGHFLKG------------------LPVAPTTLSEELKQAIGMEPMVKG-ICY  371

Query  377  FICTRPGRGPVVLSDETQALLNPETGLPK  291
             I T+ G GP V+ D ++ LL  + GLPK
Sbjct  372  IISTKAGPGPRVVEDPSEHLLGSD-GLPK  399



>dbj|BAE42019.1| unnamed protein product [Mus musculus]
Length=401

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 55/146 (38%), Positives = 72/146 (49%), Gaps = 22/146 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS RII  V ++N   G  +VAYTFDAGPNAV+       A   V  +   
Sbjct  272  FPPISYLNDTSRRIIQLVHRFNTHLGQTKVAYTFDAGPNAVIFTLEDTVAE-FVAAVRHS  330

Query  539  FPPNSDTDLSSYVIGDK---SILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP ++ D   ++ G +    +L D    +L    A+ P P           G V Y I 
Sbjct  331  FPPAANGD--KFLKGLQVAPVLLSD----ELKAALAVEPSP-----------GGVQYIIA  373

Query  368  TRPGRGPVVLSDETQALLNPETGLPK  291
            T+ G GP VL D    LL  + GLP+
Sbjct  374  TQVGPGPQVLDDTHDHLLGQD-GLPQ  398



>ref|XP_004600545.1| PREDICTED: diphosphomevalonate decarboxylase [Sorex araneus]
Length=395

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/148 (35%), Positives = 70/148 (47%), Gaps = 26/148 (18%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPI Y+NDTS R+I  V ++N   G  +VAY+FDAGPNAV+   +      L   +   
Sbjct  269  FPPISYLNDTSRRVIQLVHRFNSHHGQTKVAYSFDAGPNAVIFTLDHTLPEFLAA-VKHS  327

Query  539  FPPNSDTDLSSYVIGDKSILGDAGI-----KDLNDVEALPPPPEIKDNIPTKNKGDVSYF  375
            FPP ++        GDK + G          DL    A+ P P           G + Y 
Sbjct  328  FPPEAN--------GDKFLKGLPVTPAPLSDDLKAALAMEPSP-----------GAIKYV  368

Query  374  ICTRPGRGPVVLSDETQALLNPETGLPK  291
            I T+ G GP  L +  + LL P+ GLPK
Sbjct  369  IATQAGPGPQTLDNPQEHLLGPD-GLPK  395



>ref|XP_005235566.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Falco peregrinus]
Length=577

 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 72/145 (50%), Gaps = 16/145 (11%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S  II+   ++N   G  +VAYTFDAGPNAV+        A  V+ +   
Sbjct  448  FPPIFYLNDLSRHIIALAHRFNTHHGHTKVAYTFDAGPNAVIFTLA-DTVAEFVEVVRHS  506

Query  539  FPPNSDTDLSSYVIGDKSILGDAGIKDLNDVEALPPPPEIKDNIPTKNKGDVSYFICTRP  360
            FPP ++ D   +V G    L     + L  V   P P            G V Y + T+P
Sbjct  507  FPPATNGD--QFVRGLPVGLASLPEELLTAVVTEPVP------------GAVRYILHTKP  552

Query  359  GRGPVVLSDETQALLNPETGLPK*R  285
            G GP ++ D +Q LL  + GLP+ R
Sbjct  553  GPGPQLVDDPSQHLLGVD-GLPRCR  576



>ref|XP_004944353.1| PREDICTED: diphosphomevalonate decarboxylase isoform X6 [Gallus 
gallus]
Length=583

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 77/145 (53%), Gaps = 22/145 (15%)
 Frame = -1

Query  719  LPPIFYMNDTSHRIISCVEKWNRSEGTPQVAYTFDAGPNAVMIARNRKAAALLVQRLLFY  540
             PPIFY+ND S RII+   ++N   G  +VAYTFDAGPNAV+           V+ +   
Sbjct  454  FPPIFYLNDISQRIIALAHRFNAHHGRTKVAYTFDAGPNAVVFMLE-DTVDEFVEVVRRS  512

Query  539  FPPNSDTDLSSYVIGDKSILGD-AGIKDLND--VEALPPPPEIKDNIPTKNKGDVSYFIC  369
            FPP+S+        GD+ + G   G   L +  V A+     + D +P    G + Y + 
Sbjct  513  FPPDSN--------GDQFLRGRPVGTAVLPEELVSAV-----VVDPVP----GAIRYVLH  555

Query  368  TRPGRGPVVLSDETQALLNPETGLP  294
            T+PG GP +L D +Q LL P+ GLP
Sbjct  556  TKPGPGPQLLDDPSQHLLGPD-GLP  579



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1273595176425