BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037L07

Length=758
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009601820.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    219   1e-61   Nicotiana tomentosiformis
ref|XP_004235270.1|  PREDICTED: alanine--tRNA ligase                    219   1e-61   Solanum lycopersicum
ref|XP_006347609.1|  PREDICTED: alanine--tRNA ligase-like               218   2e-61   Solanum tuberosum [potatoes]
ref|XP_009802310.1|  PREDICTED: alanine--tRNA ligase                    198   3e-54   Nicotiana sylvestris
emb|CDP16860.1|  unnamed protein product                                172   6e-46   Coffea canephora [robusta coffee]
ref|XP_004505726.1|  PREDICTED: alanine--tRNA ligase-like               170   3e-44   Cicer arietinum [garbanzo]
ref|XP_003607217.1|  Alanyl-tRNA synthetase                             170   3e-44   
emb|CDP04915.1|  unnamed protein product                                169   1e-43   Coffea canephora [robusta coffee]
ref|XP_010031895.1|  PREDICTED: alanine--tRNA ligase                    167   4e-43   Eucalyptus grandis [rose gum]
ref|XP_007131657.1|  hypothetical protein PHAVU_011G031100g             163   1e-41   Phaseolus vulgaris [French bean]
gb|KDP43289.1|  hypothetical protein JCGZ_24210                         161   6e-41   Jatropha curcas
ref|XP_008465597.1|  PREDICTED: alanine--tRNA ligase-like               153   6e-41   
ref|XP_002307181.2|  alanyl-tRNA synthetase family protein              160   8e-41   
gb|KDO52982.1|  hypothetical protein CISIN_1g001826mg                   160   8e-41   Citrus sinensis [apfelsine]
ref|XP_002277341.1|  PREDICTED: alanine--tRNA ligase                    160   9e-41   Vitis vinifera
gb|KDO52988.1|  hypothetical protein CISIN_1g001826mg                   160   9e-41   Citrus sinensis [apfelsine]
gb|KDO52980.1|  hypothetical protein CISIN_1g001826mg                   160   9e-41   Citrus sinensis [apfelsine]
emb|CBI27126.3|  unnamed protein product                                160   1e-40   Vitis vinifera
ref|XP_011084638.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    159   2e-40   
ref|XP_011022066.1|  PREDICTED: alanine--tRNA ligase                    159   2e-40   Populus euphratica
emb|CDY64799.1|  BnaUnng00940D                                          154   3e-40   Brassica napus [oilseed rape]
ref|XP_006484669.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    159   3e-40   Citrus sinensis [apfelsine]
ref|XP_010500574.1|  PREDICTED: alanine--tRNA ligase-like               158   6e-40   Camelina sativa [gold-of-pleasure]
gb|EYU19755.1|  hypothetical protein MIMGU_mgv1a000969mg                155   3e-39   Erythranthe guttata [common monkey flower]
ref|XP_010463338.1|  PREDICTED: alanine--tRNA ligase-like               156   4e-39   Camelina sativa [gold-of-pleasure]
ref|XP_010662077.1|  PREDICTED: alanine--tRNA ligase-like               155   4e-39   Vitis vinifera
emb|CBI26461.3|  unnamed protein product                                155   4e-39   Vitis vinifera
ref|XP_009124544.1|  PREDICTED: alanine--tRNA ligase-like               152   8e-39   
ref|XP_009147848.1|  PREDICTED: alanine--tRNA ligase-like               154   1e-38   Brassica rapa
emb|CDY22784.1|  BnaA06g02930D                                          154   1e-38   Brassica napus [oilseed rape]
ref|XP_006437524.1|  hypothetical protein CICLE_v10030624mg             154   1e-38   Citrus clementina [clementine]
ref|XP_009107233.1|  PREDICTED: alanine--tRNA ligase                    154   2e-38   Brassica rapa
ref|XP_010541854.1|  PREDICTED: alanine--tRNA ligase-like               154   2e-38   Tarenaya hassleriana [spider flower]
ref|XP_007043323.1|  Alanyl-tRNA synthetase, putative                   153   2e-38   
ref|XP_002531134.1|  alanyl-tRNA synthetase, putative                   153   3e-38   
ref|XP_006590811.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    152   3e-38   
gb|KHN32273.1|  Alanine--tRNA ligase                                    152   6e-38   Glycine soja [wild soybean]
ref|XP_004148575.1|  PREDICTED: alanine--tRNA ligase-like               152   7e-38   
gb|KGN58521.1|  hypothetical protein Csa_3G656490                       152   7e-38   Cucumis sativus [cucumbers]
ref|XP_004163302.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    152   7e-38   
ref|XP_003537781.2|  PREDICTED: alanine--tRNA ligase-like isoform X1    152   8e-38   Glycine max [soybeans]
ref|XP_007225354.1|  hypothetical protein PRUPE_ppa000923mg             151   1e-37   
emb|CAA73145.1|  alanyl t-RNA synthetase                                141   7e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305941.1|  hypothetical protein CARUB_v10011180mg             148   2e-36   Capsella rubella
gb|KJB31825.1|  hypothetical protein B456_005G210000                    148   2e-36   Gossypium raimondii
gb|KJB31826.1|  hypothetical protein B456_005G210000                    147   2e-36   Gossypium raimondii
ref|XP_010112290.1|  Alanine--tRNA ligase                               147   2e-36   
ref|XP_008340455.1|  PREDICTED: alanine--tRNA ligase                    147   4e-36   Malus domestica [apple tree]
ref|XP_009351710.1|  PREDICTED: alanine--tRNA ligase                    146   6e-36   
ref|XP_008221037.1|  PREDICTED: alanine--tRNA ligase                    146   1e-35   Prunus mume [ume]
gb|KDO52983.1|  hypothetical protein CISIN_1g001826mg                   145   2e-35   Citrus sinensis [apfelsine]
ref|XP_010479473.1|  PREDICTED: alanine--tRNA ligase                    144   4e-35   Camelina sativa [gold-of-pleasure]
ref|XP_006484668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    144   5e-35   
ref|XP_010265724.1|  PREDICTED: alanine--tRNA ligase-like               141   5e-35   Nelumbo nucifera [Indian lotus]
ref|XP_008366973.1|  PREDICTED: alanine--tRNA ligase-like               143   6e-35   
ref|XP_002894237.1|  cytosolic tRNA-Ala synthetase                      142   2e-34   
ref|XP_006393171.1|  hypothetical protein EUTSA_v10011205mg             142   2e-34   
ref|XP_006393172.1|  hypothetical protein EUTSA_v10011205mg             142   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_010273668.1|  PREDICTED: alanine--tRNA ligase                    142   2e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006393173.1|  hypothetical protein EUTSA_v10011205mg             142   3e-34   
ref|NP_175439.2|  Alanyl-tRNA synthetase                                141   4e-34   Arabidopsis thaliana [mouse-ear cress]
gb|KJB50036.1|  hypothetical protein B456_008G149700                    141   4e-34   Gossypium raimondii
gb|AAD50044.1|AC007980_9  cytosolic tRNA-Ala synthetase                 141   5e-34   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45055.1|  BnaA08g02200D                                          140   7e-34   Brassica napus [oilseed rape]
emb|CAA80381.1|  cytosolic tRNA-Ala synthetase                          139   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004297751.1|  PREDICTED: alanine--tRNA ligase                    139   2e-33   Fragaria vesca subsp. vesca
pir||S32671  alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thali...    139   2e-33
emb|CAA80380.1|  mitochondrial tRNA-Ala synthetase                      139   2e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523577.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    139   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010683781.1|  PREDICTED: alanine--tRNA ligase                    139   3e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003607221.1|  Alanyl-tRNA synthetase                             133   1e-32   
gb|AES89418.2|  alanyl-tRNA synthetase                                  132   3e-32   Medicago truncatula
ref|XP_003607220.1|  Alanyl-tRNA synthetase                             132   1e-31   
gb|AES89417.2|  alanyl-tRNA synthetase                                  132   1e-31   Medicago truncatula
ref|NP_001185186.1|  Alanyl-tRNA synthetase                             134   2e-31   
ref|XP_003619277.1|  Alanyl-tRNA synthetase                             128   9e-31   
ref|XP_010904628.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    131   1e-30   Elaeis guineensis
ref|XP_009386816.1|  PREDICTED: alanine--tRNA ligase {ECO:0000255...    128   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010927937.1|  PREDICTED: alanine--tRNA ligase-like               128   1e-29   Elaeis guineensis
ref|XP_003619276.1|  Alanyl-tRNA synthetase                             127   2e-29   
ref|XP_008810673.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    127   3e-29   
ref|XP_008810668.1|  PREDICTED: alanine--tRNA ligase-like isoform X1    127   3e-29   Phoenix dactylifera
gb|KDO52981.1|  hypothetical protein CISIN_1g001826mg                   126   6e-29   Citrus sinensis [apfelsine]
emb|CDY29328.1|  BnaA05g15950D                                          126   7e-29   Brassica napus [oilseed rape]
gb|KJB50037.1|  hypothetical protein B456_008G149700                    124   5e-28   Gossypium raimondii
gb|KJB50041.1|  hypothetical protein B456_008G149700                    124   5e-28   Gossypium raimondii
gb|KJB50039.1|  hypothetical protein B456_008G149700                    124   5e-28   Gossypium raimondii
gb|EPS72880.1|  hypothetical protein M569_01869                         123   6e-28   Genlisea aurea
ref|XP_008778009.1|  PREDICTED: alanine--tRNA ligase-like               122   2e-27   
emb|CDY42520.1|  BnaC06g03380D                                          119   2e-26   Brassica napus [oilseed rape]
gb|KFK23692.1|  hypothetical protein AALP_AAs48168U000100               118   3e-26   Arabis alpina [alpine rockcress]
ref|XP_006662230.1|  PREDICTED: alanine--tRNA ligase-like               118   3e-26   Oryza brachyantha
gb|AAK70636.1|AC091238_14  Putative cytosolic tRNA-Ala synthetase       114   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003571715.1|  PREDICTED: LOW QUALITY PROTEIN: alanine--tRN...    114   6e-25   
gb|EEC66648.1|  hypothetical protein OsI_32912                          114   7e-25   Oryza sativa Indica Group [Indian rice]
ref|NP_001064254.1|  Os10g0182000                                       114   7e-25   
gb|EEE50661.1|  hypothetical protein OsJ_30891                          114   8e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002443089.1|  hypothetical protein SORBIDRAFT_08g008230          113   2e-24   Sorghum bicolor [broomcorn]
ref|XP_008662576.1|  PREDICTED: alanine--tRNA ligase                    112   4e-24   Zea mays [maize]
ref|XP_008350821.1|  PREDICTED: alanine--tRNA ligase-like               101   6e-23   
ref|XP_006826671.1|  hypothetical protein AMTR_s00137p00047050          108   6e-23   Amborella trichopoda
gb|EMT00983.1|  Alanyl-tRNA synthetase, mitochondrial                   108   6e-23   
dbj|BAJ98134.1|  predicted protein                                      108   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT18589.1|  Alanyl-tRNA synthetase, mitochondrial                   108   1e-22   
dbj|BAJ92565.1|  predicted protein                                      104   1e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001773539.1|  predicted protein                                  105   8e-22   
dbj|BAJ96541.1|  predicted protein                                      104   2e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004983349.1|  PREDICTED: alanine--tRNA ligase-like isoform X2    102   6e-21   Setaria italica
ref|XP_004983350.1|  PREDICTED: alanine--tRNA ligase-like isoform X3    102   6e-21   
gb|EMT07345.1|  Alanyl-tRNA synthetase, mitochondrial                   100   3e-20   
gb|EMS67609.1|  Alanyl-tRNA synthetase                                97.4    6e-19   Triticum urartu
ref|XP_004983348.1|  PREDICTED: alanine--tRNA ligase-like isoform X1  93.6    8e-18   
emb|CDY46263.1|  BnaC05g50520D                                        88.2    3e-16   Brassica napus [oilseed rape]
emb|CDY69088.1|  BnaCnng61840D                                        79.3    4e-15   Brassica napus [oilseed rape]
ref|XP_001769326.1|  predicted protein                                80.5    9e-15   
gb|KDO52984.1|  hypothetical protein CISIN_1g001826mg                 82.4    3e-14   Citrus sinensis [apfelsine]
gb|KDO52985.1|  hypothetical protein CISIN_1g001826mg                 82.4    3e-14   Citrus sinensis [apfelsine]
gb|KJB50034.1|  hypothetical protein B456_008G149700                  77.8    1e-12   Gossypium raimondii
gb|KJB50035.1|  hypothetical protein B456_008G149700                  77.8    1e-12   Gossypium raimondii
gb|KJB50038.1|  hypothetical protein B456_008G149700                  77.8    1e-12   Gossypium raimondii
ref|XP_002462563.1|  hypothetical protein SORBIDRAFT_02g028270        60.8    2e-08   
emb|CCI40732.1|  unnamed protein product                              62.4    9e-08   Albugo candida
emb|CCA14233.1|  unnamed protein product                              61.2    2e-07   Albugo laibachii Nc14
ref|XP_005849315.1|  hypothetical protein CHLNCDRAFT_143654           60.8    2e-07   Chlorella variabilis
ref|XP_002950616.1|  hypothetical protein VOLCADRAFT_120886           59.3    1e-06   Volvox carteri f. nagariensis
gb|EMS64427.1|  Alanyl-tRNA synthetase                                56.6    8e-06   Triticum urartu
gb|EMT09528.1|  Alanyl-tRNA synthetase, mitochondrial                 51.6    4e-04   



>ref|XP_009601820.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Nicotiana tomentosiformis]
Length=1027

 Score =   219 bits (558),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 146/192 (76%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+K+ EA   ++SLLEEKVT+LNA+VERAQIP  +K +LK +LS LQ +VI+AKK+IAA
Sbjct  836   LEQKVNEAFQTDESLLEEKVTSLNAAVERAQIPTVRKADLKAKLSALQNQVIKAKKKIAA  895

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVKAASEMAEAA SGGKAYCIL++ +GLDTAAVR+AVVKVMEQKG+AVL+FSTDE
Sbjct  896   ENVQKAVKAASEMAEAAASGGKAYCILQISVGLDTAAVREAVVKVMEQKGMAVLVFSTDE  955

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             AANKVLVCAGVPEKGD C+QL+VK+WLNAALKPLGGKGGGGKGGLAQGQA+++ HV EAM
Sbjct  956   AANKVLVCAGVPEKGDKCQQLNVKDWLNAALKPLGGKGGGGKGGLAQGQATNISHVGEAM  1015

Query  218   DLAASFASIKLS  183
             D+AASFA++KL+
Sbjct  1016  DVAASFAAMKLN  1027



>ref|XP_004235270.1| PREDICTED: alanine--tRNA ligase [Solanum lycopersicum]
Length=1010

 Score =   219 bits (557),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 148/192 (77%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+K+ EA+  ++SLLEEKVT+LNA+VERAQIP   K +LK +LS LQ RVI+AKK+IAA
Sbjct  819   LEQKVNEASQTDESLLEEKVTSLNATVERAQIPTVVKTDLKAKLSVLQDRVIKAKKKIAA  878

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVKAASEMAEAA SGGKAYCIL++G+GLDTAAVR+AVVKVMEQKG+AVL+FS DE
Sbjct  879   ENIQKAVKAASEMAEAAASGGKAYCILQIGVGLDTAAVREAVVKVMEQKGMAVLVFSKDE  938

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             AA KVLVCAGVPEKGD CKQL+VK+WLNAALKPLGGKGGGGKGGLAQGQA+D+  VDEAM
Sbjct  939   AAKKVLVCAGVPEKGDKCKQLNVKDWLNAALKPLGGKGGGGKGGLAQGQATDISKVDEAM  998

Query  218   DLAASFASIKLS  183
             D+AASFA++KL+
Sbjct  999   DVAASFAALKLN  1010



>ref|XP_006347609.1| PREDICTED: alanine--tRNA ligase-like [Solanum tuberosum]
Length=1009

 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 147/192 (77%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+K+ EA   ++SLLEEKVT+LNA+VERAQIP   K +LK +LS LQ +VI+AKK+IAA
Sbjct  818   LEQKVNEAFQTDESLLEEKVTSLNATVERAQIPTVMKTDLKAKLSVLQNQVIKAKKKIAA  877

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVKAASEMAEAA SGGKAYCIL++G+GLDTAAVR+AVVKVMEQKG+AVL+FS DE
Sbjct  878   ENIQKAVKAASEMAEAAASGGKAYCILQIGVGLDTAAVREAVVKVMEQKGMAVLVFSKDE  937

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             AANKVLVCAGVPEKGD C+QL+VK+WLNAALKPLGGKGGGGKGGLAQGQA+D+  VDEAM
Sbjct  938   AANKVLVCAGVPEKGDKCQQLNVKDWLNAALKPLGGKGGGGKGGLAQGQATDISKVDEAM  997

Query  218   DLAASFASIKLS  183
             D+AASFA++KL+
Sbjct  998   DVAASFAAMKLN  1009



>ref|XP_009802310.1| PREDICTED: alanine--tRNA ligase [Nicotiana sylvestris]
Length=1014

 Score =   198 bits (504),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 134/150 (89%), Gaps = 0/150 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+K+ EA   ++SLLEEKVT+LNA+VERAQIP  +K +LK +LS LQ +VI+AKK+IAA
Sbjct  836  LEQKVNEAFQTDESLLEEKVTSLNAAVERAQIPTVRKADLKAKLSALQNQVIKAKKKIAA  895

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVKAASEMAEAA SGGKAYCIL++ +GLDTAAVR+AVVKVMEQKG+AVL+FSTDE
Sbjct  896  ENVQKAVKAASEMAEAAASGGKAYCILQISVGLDTAAVREAVVKVMEQKGMAVLVFSTDE  955

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAA  309
            AANKVLVCAGVPEKGD C+QL+VK+WLNAA
Sbjct  956  AANKVLVCAGVPEKGDKCQQLNVKDWLNAA  985



>emb|CDP16860.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   172 bits (435),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            +E ++ E    E +LLE++VT LN  VE A IP  KK ++K +LS LQ  +I+AKK+IA 
Sbjct  369  IEHEVNETFKSEGALLEQRVTKLNGRVEGAVIPTVKKADIKAKLSLLQNHIIKAKKKIAE  428

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN+ NAVK A E A  + S GKAYC+  + +G DTAA+R+AV+KV EQKG+AV++ S D+
Sbjct  429  ENTQNAVKVALEEAAVSSSDGKAYCLTHVNVGGDTAAIREAVLKVTEQKGMAVMVISKDD  488

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            AANKV+VCAGVPEK D  KQL+ KEWL  AL+P     GGGKG LAQGQ S + HV EAM
Sbjct  489  AANKVVVCAGVPEKNDQYKQLNAKEWLRVALEP-LSGKGGGKGCLAQGQGSGISHVSEAM  547

Query  218  DLAASFASIKLS  183
            D+AASFA++KL+
Sbjct  548  DIAASFATLKLN  559



>ref|XP_004505726.1| PREDICTED: alanine--tRNA ligase-like [Cicer arietinum]
Length=990

 Score =   170 bits (431),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 110/192 (57%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             E+++ EAA +E SLLEEKV++L ++VE   IPAAKK ++K +++ LQ +V +A+KR+A 
Sbjct  800  FERQVDEAAKLEGSLLEEKVSSLKSNVETLSIPAAKKADIKTKIALLQDQVRKAQKRVAE  859

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV    E AE AVS GK++CI  + +GLD AAVR+AV KV++QKG++V++FSTDE
Sbjct  860  ENKRKAVMLTVEKAELAVSDGKSFCISHVDVGLDVAAVREAVTKVIDQKGLSVMVFSTDE  919

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKGD  K L V EWL+ AL PL G+ G GKGGLA GQ +D  HV+EAM
Sbjct  920  STNKAVVCAGVPEKGDKVK-LDVSEWLSNALGPLKGRCGKGKGGLATGQGTDASHVNEAM  978

Query  218  DLAASFASIKLS  183
            DLA  FASIKL+
Sbjct  979  DLAVKFASIKLT  990



>ref|XP_003607217.1| Alanyl-tRNA synthetase [Medicago truncatula]
 gb|AES89414.1| alanine-tRNA ligase [Medicago truncatula]
Length=950

 Score =   170 bits (430),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 145/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             EK++ E A +E SLLEEKV++L ++VE   IPAAKK E+K +++ LQ +V +A+KR+A 
Sbjct  760  FEKQVDEVAKLEGSLLEEKVSSLKSNVETLSIPAAKKAEIKTKIALLQDQVRKAQKRVAE  819

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV   +E A+ AVS GK++CI  + +GLD AAVR+AV KV++QKG++V++FSTDE
Sbjct  820  ENKRKAVTITAEKADLAVSDGKSFCISHVNVGLDVAAVREAVTKVIDQKGLSVMVFSTDE  879

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKGD  K L V EWL+ AL PL G+ G GKGGLA GQ +D  HV+EAM
Sbjct  880  STNKAVVCAGVPEKGDKGK-LDVSEWLSNALGPLKGRCGKGKGGLATGQGTDASHVNEAM  938

Query  218  DLAASFASIKLS  183
            DLA  FAS+KL+
Sbjct  939  DLAVKFASVKLN  950



>emb|CDP04915.1| unnamed protein product [Coffea canephora]
Length=1128

 Score =   169 bits (427),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 139/191 (73%), Gaps = 1/191 (1%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             +E+++ E   +E SLLE++VT LN  VE A IP  KK +LK ++S LQ ++I+AKK+IA 
Sbjct  938   IEQEVNETFKMEGSLLEQRVTKLNGRVEGAAIPTVKKTDLKAKISVLQNQIIKAKKKIAE  997

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN  NAVK A E AE + S GK YCI  + +G DTAA+R+AV+KV EQKG+A+++ S D 
Sbjct  998   ENIQNAVKVALEEAEVSSSHGKTYCITHVNVGADTAAIREAVLKVTEQKGMAIMVISKDG  1057

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              ANKV+ CAGVPEK D  KQL  KEWL AAL P     GGGKG LAQGQ S+L HV EAM
Sbjct  1058  TANKVVACAGVPEKIDQFKQLDAKEWLTAALAP-LNGKGGGKGRLAQGQGSELSHVTEAM  1116

Query  218   DLAASFASIKL  186
             D+AASFA++KL
Sbjct  1117  DIAASFAALKL  1127



>ref|XP_010031895.1| PREDICTED: alanine--tRNA ligase [Eucalyptus grandis]
 gb|KCW51291.1| hypothetical protein EUGRSUZ_J00856 [Eucalyptus grandis]
Length=1046

 Score =   167 bits (423),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 145/191 (76%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             +E+++ +A   E SLLE+KV +L + V+ A IPAA+K +++ +++ LQ+ V +A+K+IA 
Sbjct  855   IEQEVTDACRTEGSLLEKKVASLKSRVDSAAIPAARKADIRTKIAALQSEVKKAQKKIAE  914

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
              N+  AV+ + E AEAA+SGGK +CI R+ +GLD AAVR+AVVKV+EQKGI+ ++FS DE
Sbjct  915   ANTKKAVEVSLETAEAAISGGKGFCISRVDVGLDAAAVREAVVKVLEQKGISAMVFSRDE  974

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NKV+VCAGVPEKG   KQL V +WL  AL PL G+ G GKGGLA GQ +D  H+DEAM
Sbjct  975   TTNKVVVCAGVPEKGGNAKQLEVSQWLEEALGPLKGRCGKGKGGLATGQGTDASHLDEAM  1034

Query  218   DLAASFASIKL  186
             +LA SFAS+KL
Sbjct  1035  NLAVSFASMKL  1045



>ref|XP_007131657.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
 gb|ESW03651.1| hypothetical protein PHAVU_011G031100g [Phaseolus vulgaris]
Length=996

 Score =   163 bits (412),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 143/192 (74%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             E+++ +A+ ++ SLLEEKV++  ++VE   IPAAKK ++K ++++LQ +V +A+K++A 
Sbjct  806  FEQQVDDASKLDGSLLEEKVSSFKSNVETLSIPAAKKADIKNKIARLQDQVRKAQKQVAE  865

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV   +E AE A S GKA+CI R+ +GLD AAVR+AV K M+QKG++V++FSTDE
Sbjct  866  ENKRKAVIITAEKAELAASNGKAFCISRVDVGLDVAAVREAVTKAMDQKGLSVMVFSTDE  925

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK ++CAGVPEKGD  K L V EWL+ AL PL G+ G GKGGLA GQ +D   V EAM
Sbjct  926  STNKAVICAGVPEKGDKGK-LDVSEWLSNALGPLKGRCGKGKGGLATGQGTDAARVKEAM  984

Query  218  DLAASFASIKLS  183
            DLA  FAS+KLS
Sbjct  985  DLAEKFASVKLS  996



>gb|KDP43289.1| hypothetical protein JCGZ_24210 [Jatropha curcas]
Length=1019

 Score =   161 bits (407),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 145/191 (76%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++ E +  E SLLE+KV +L + V+ A IPAAKK +++ ++S LQ +V +A+K+IA 
Sbjct  828   LEQEVHETSKAEGSLLEKKVASLKSRVDSAPIPAAKKADIRAKISVLQNQVRKAQKKIAE  887

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A+EMAE A S GK +CI R+ +GLD AAVR+AV+KV+E+KGI+ ++FS DE
Sbjct  888   ENMQKAVKVATEMAEIAASEGKGFCISRVDVGLDAAAVREAVLKVLEKKGISAMVFSMDE  947

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NKV+VCAGVPEK D  K+L V EWL  AL+PL G+ G GKGGLA GQ +D  HVD+A+
Sbjct  948   TTNKVVVCAGVPEKKDQGKKLEVSEWLTKALEPLNGRCGKGKGGLATGQGTDGVHVDKAI  1007

Query  218   DLAASFASIKL  186
             DLAA+FA +KL
Sbjct  1008  DLAATFAEMKL  1018



>ref|XP_008465597.1| PREDICTED: alanine--tRNA ligase-like [Cucumis melo]
Length=291

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 136/191 (71%), Gaps = 0/191 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A 
Sbjct  99   LEQEVDAAFNIDGNLLEKVVASFKNRVDSAPIPAARKAQIRAKIVLLQNEVRKAQKKLAE  158

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A E AE A S GKA+CI  + +GLD AAVR+AVV+VMEQKGI+ ++FSTDE
Sbjct  159  ENMQKAVKIAVETAEMASSEGKAFCISHVDVGLDAAAVREAVVRVMEQKGISAMVFSTDE  218

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAM
Sbjct  219  TTKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAM  278

Query  218  DLAASFASIKL  186
            DLA SFAS+KL
Sbjct  279  DLATSFASLKL  289



>ref|XP_002307181.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE94177.2| alanyl-tRNA synthetase family protein [Populus trichocarpa]
Length=967

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++ EA+  + SLLE+KV +L   V+ A IPAAKK +++ ++S LQ +V +A+K+IA 
Sbjct  776  LEQEVDEASQADGSLLEKKVASLKTRVDSALIPAAKKADIRAKISVLQNKVRKAQKKIAE  835

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV+ A+EMAE A S GKA+CI  + +GLD AAVR+AV+KV+E+KGI+ ++FSTDE
Sbjct  836  ENMQKAVEVAAEMAEVASSDGKAFCISHVDVGLDAAAVREAVLKVLERKGISAMVFSTDE  895

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NKV+VCAGVPEK D  K L V EWL  AL PL G+ G GK GLA GQ +D  H+DEAM
Sbjct  896  STNKVVVCAGVPEKLDKGKGLEVSEWLTTALGPLKGRCGKGKAGLATGQGTDASHLDEAM  955

Query  218  DLAASFASIKL  186
             LA +FA +KL
Sbjct  956  GLATTFAQMKL  966



>gb|KDO52982.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=995

 Score =   160 bits (405),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 143/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  804  LEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  863

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V++FSTDE
Sbjct  864  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDE  923

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AM
Sbjct  924  TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAM  983

Query  218  DLAASFASIKL  186
            DLAA FA++KL
Sbjct  984  DLAAEFAAMKL  994



>ref|XP_002277341.1| PREDICTED: alanine--tRNA ligase [Vitis vinifera]
Length=1002

 Score =   160 bits (405),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++ +A+  E   LE+KV +L + V+ A IPAA+K +L+ ++S LQ +V +A+K+ A 
Sbjct  811   LEQEVDDASKTEGISLEKKVASLRSRVDSAPIPAARKADLRAKISLLQDQVRKAQKKFAE  870

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVKAA++MA+ A S GK +CI  + +GLDT AVR+AV+KV+EQKGI+V+IFSTDE
Sbjct  871   ENIQKAVKAATDMAQLAASDGKTFCISHVDVGLDTTAVREAVLKVIEQKGISVMIFSTDE  930

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +V AGVP+KGD  KQL V EWL AAL PL G+ G GKGGLAQGQ +D  HV EAM
Sbjct  931   TTNKAVVYAGVPQKGDKAKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASHVKEAM  990

Query  218   DLAASFASIKL  186
             D+A +FAS+KL
Sbjct  991   DVAENFASMKL  1001



>gb|KDO52988.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=904

 Score =   160 bits (404),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 143/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  713  LEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  772

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V++FSTDE
Sbjct  773  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDE  832

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AM
Sbjct  833  TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAM  892

Query  218  DLAASFASIKL  186
            DLAA FA++KL
Sbjct  893  DLAAEFAAMKL  903



>gb|KDO52980.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1002

 Score =   160 bits (405),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 143/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  811   LEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  870

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V++FSTDE
Sbjct  871   ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDE  930

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AM
Sbjct  931   TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAM  990

Query  218   DLAASFASIKL  186
             DLAA FA++KL
Sbjct  991   DLAAEFAAMKL  1001



>emb|CBI27126.3| unnamed protein product [Vitis vinifera]
Length=1026

 Score =   160 bits (404),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 108/191 (57%), Positives = 144/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++ +A+  E   LE+KV +L + V+ A IPAA+K +L+ ++S LQ +V +A+K+ A 
Sbjct  835   LEQEVDDASKTEGISLEKKVASLRSRVDSAPIPAARKADLRAKISLLQDQVRKAQKKFAE  894

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVKAA++MA+ A S GK +CI  + +GLDT AVR+AV+KV+EQKGI+V+IFSTDE
Sbjct  895   ENIQKAVKAATDMAQLAASDGKTFCISHVDVGLDTTAVREAVLKVIEQKGISVMIFSTDE  954

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +V AGVP+KGD  KQL V EWL AAL PL G+ G GKGGLAQGQ +D  HV EAM
Sbjct  955   TTNKAVVYAGVPQKGDKAKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASHVKEAM  1014

Query  218   DLAASFASIKL  186
             D+A +FAS+KL
Sbjct  1015  DVAENFASMKL  1025



>ref|XP_011084638.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Sesamum 
indicum]
Length=1012

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 148/192 (77%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++ EA++ E S+LE+KVT+LN+ +E A IP+AKK +LK ++S LQ++VI+AKK+IA 
Sbjct  821   LEQEVNEASNAEGSVLEQKVTSLNSRIEGAAIPSAKKADLKAKISVLQSQVIKAKKKIAE  880

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             E+   A + A +MAE A S GKAYCI  + +G DTAA+R+AVVKVMEQKG+AV++ S D+
Sbjct  881   EHMKKATEVALQMAEGASSNGKAYCISLVDVGGDTAAIREAVVKVMEQKGMAVMVISKDD  940

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK  +CAGVPEK    KQL+V EWL   L+ + GKGGGGKGGLAQGQ SD+  V+ AM
Sbjct  941   QVNKAFICAGVPEKDGKYKQLNVTEWLKKVLELISGKGGGGKGGLAQGQGSDVSRVEAAM  1000

Query  218   DLAASFASIKLS  183
             ++A SFA++KL+
Sbjct  1001  EVAESFAAMKLT  1012



>ref|XP_011022066.1| PREDICTED: alanine--tRNA ligase [Populus euphratica]
Length=1008

 Score =   159 bits (403),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 105/191 (55%), Positives = 142/191 (74%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++ EA+  + SLLE+KV +L   V+ A IPAAKK +++ ++S LQ +V +A+K+IA 
Sbjct  817   LEQEVDEASKADGSLLEKKVASLKTRVDSALIPAAKKADIRAKISVLQNKVRKAQKKIAE  876

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AV+ A+EMAE A S GKA+CI  + +GLD AAVR+AV+KV+++KGI+ ++FSTDE
Sbjct  877   ENMQKAVEVATEMAEVASSDGKAFCISHVDVGLDVAAVREAVLKVLDRKGISAMVFSTDE  936

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             + NKV+VCAGVPEK D  K L V EWL  AL PL G+ G GK GLA GQ +D  H+DEAM
Sbjct  937   STNKVVVCAGVPEKLDKGKGLEVSEWLTTALGPLKGRCGKGKAGLATGQGTDASHLDEAM  996

Query  218   DLAASFASIKL  186
              LA +FA +KL
Sbjct  997   GLATTFAQMKL  1007



>emb|CDY64799.1| BnaUnng00940D, partial [Brassica napus]
Length=414

 Score =   154 bits (390),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++++A+  E S LE+KV  L + V+ A +PAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  223  LEKEVEDASKAEGSALEKKVAALKSRVDSAIMPAAKKADIRAKIALLQNEVRKAQKKIAE  282

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  283  QNLKISVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  342

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+
Sbjct  343  TTNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVNAAL  402

Query  218  DLAASFASIKLS  183
            DLAASFAS+KL+
Sbjct  403  DLAASFASLKLN  414



>ref|XP_006484669.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Citrus sinensis]
Length=1002

 Score =   159 bits (401),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 143/191 (75%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK++ +A+ +E SL+E+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  811   LEKEVDDASKIEGSLVEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  870

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V++FSTDE
Sbjct  871   ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDE  930

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AM
Sbjct  931   TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAM  990

Query  218   DLAASFASIKL  186
             DLAA FA++KL
Sbjct  991   DLAAEFAAMKL  1001



>ref|XP_010500574.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1006

 Score =   158 bits (399),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA 
Sbjct  815   LEKEVEDASVAEGSALEKKVSALKSQVDTAVIPAAKKADIRAKIASLQNEVKKAQKRIAE  874

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  875   QNLKKSVKVATEAAESAASIGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  934

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  935   GTNKAVVCAGVPDKSDQFKQLDVAEWLTTALGPLKGRCGKGKGGLASGQGTDASQVHAAL  994

Query  218   DLAASFASIKLS  183
             D+AASFAS+KL+
Sbjct  995   DMAASFASMKLN  1006



>gb|EYU19755.1| hypothetical protein MIMGU_mgv1a000969mg [Erythranthe guttata]
Length=927

 Score =   155 bits (393),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 146/192 (76%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++KEA+  E S+LE+KVT+LN+ VE A IP+AKK +LK ++S LQ++VI+AKK+IA 
Sbjct  737  LEQEVKEASIAEGSVLEQKVTSLNSRVEGASIPSAKKADLKAKISVLQSQVIKAKKKIAE  796

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            E+   AV+ A++ AE A+S GK +CI  + +G DT A+R+AVVKVME+KG+AV++FS DE
Sbjct  797  EHMQKAVEVATQTAEGALSNGKTFCISLVDVGADTTAIREAVVKVMEKKGMAVMVFSIDE  856

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK  VCAGVPE G    QL+V EWL   L  + GKGGGGKGGLAQGQ SD   V+ AM
Sbjct  857  KVNKAFVCAGVPEDGKY-GQLNVTEWLKKVLDLINGKGGGGKGGLAQGQGSDSSRVEAAM  915

Query  218  DLAASFASIKLS  183
            D+A SFA++KL+
Sbjct  916  DVAESFAAMKLT  927



>ref|XP_010463338.1| PREDICTED: alanine--tRNA ligase-like [Camelina sativa]
Length=1050

 Score =   156 bits (394),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA 
Sbjct  859   LEKEVEDASVAEGSALEKKVSALKSQVDTAVIPAAKKADIRAKIASLQNEVKKAQKRIAE  918

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  919   QNLKKSVKVATEAAESAASIGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  978

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  979   GTNKAVVCAGVPDKSDQFKQLDVAEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  1038

Query  218   DLAASFASIKLS  183
             D+A SFAS+KL+
Sbjct  1039  DMAESFASMKLN  1050



>ref|XP_010662077.1| PREDICTED: alanine--tRNA ligase-like [Vitis vinifera]
Length=955

 Score =   155 bits (393),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 142/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++  A+  E SLLE+KV +L + V+ A IPA KK +L+ ++S LQ +V + +K+IA 
Sbjct  764  LEQEVDAASDAEGSLLEKKVASLRSRVDAAPIPAPKKADLRTKISLLQDQVRKEQKKIAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+EMA+ A S GKA+CI  + +GLDT AVR+AV+KV+EQKGI+V++FSTDE
Sbjct  824  ENIQKAVKVATEMADGAASDGKAFCISLVDVGLDTTAVREAVLKVIEQKGISVMVFSTDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVPE G+  KQL V EWL AAL PL G+ G GKGGLAQGQ +D   V EAM
Sbjct  884  TTNKAVVYAGVPENGEKFKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASLVKEAM  943

Query  218  DLAASFASIKLS  183
            D+A  FAS+KLS
Sbjct  944  DVATKFASMKLS  955



>emb|CBI26461.3| unnamed protein product [Vitis vinifera]
Length=960

 Score =   155 bits (392),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 142/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++  A+  E SLLE+KV +L + V+ A IPA KK +L+ ++S LQ +V + +K+IA 
Sbjct  769  LEQEVDAASDAEGSLLEKKVASLRSRVDAAPIPAPKKADLRTKISLLQDQVRKEQKKIAE  828

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+EMA+ A S GKA+CI  + +GLDT AVR+AV+KV+EQKGI+V++FSTDE
Sbjct  829  ENIQKAVKVATEMADGAASDGKAFCISLVDVGLDTTAVREAVLKVIEQKGISVMVFSTDE  888

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVPE G+  KQL V EWL AAL PL G+ G GKGGLAQGQ +D   V EAM
Sbjct  889  TTNKAVVYAGVPENGEKFKQLEVSEWLTAALGPLKGRCGKGKGGLAQGQGTDASLVKEAM  948

Query  218  DLAASFASIKLS  183
            D+A  FAS+KLS
Sbjct  949  DVATKFASMKLS  960



>ref|XP_009124544.1| PREDICTED: alanine--tRNA ligase-like [Brassica rapa]
Length=684

 Score =   152 bits (385),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 99/192 (52%), Positives = 139/192 (72%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            + K++ EA+    + LE+KV  L   V+   IPAAK+ ++K ++++LQ  V +A+K+IA 
Sbjct  493  ISKEVDEASKAVGNALEKKVNALKRRVDEVDIPAAKRADIKAKIAQLQNEVRKAQKKIAK  552

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V++FSTDE
Sbjct  553  ENLKKSVEIATEGAESAASDGKNFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDE  612

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVP+K D  KQL V EWL  AL P+ GK G GK GLA GQ +D   V  A+
Sbjct  613  STNKAVVCAGVPDKSDQFKQLDVTEWLTTALSPIKGKCGKGKSGLASGQGTDASQVSSAL  672

Query  218  DLAASFASIKLS  183
            DLAASFAS+KL+
Sbjct  673  DLAASFASMKLN  684



>ref|XP_009147848.1| PREDICTED: alanine--tRNA ligase-like [Brassica rapa]
Length=999

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++++A+  E S LE+KV  L + V+ A +PAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  808  LEKEVEDASKAEGSALEKKVAALKSRVDSAIMPAAKKADIRAKIALLQNEVRKAQKKIAE  867

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  868  QNLKISVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  927

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+
Sbjct  928  TTNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVNAAL  987

Query  218  DLAASFASIKLS  183
            DLAASFAS+KL+
Sbjct  988  DLAASFASLKLN  999



>emb|CDY22784.1| BnaA06g02930D [Brassica napus]
Length=999

 Score =   154 bits (390),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++++A+  E S LE+KV  L + V+ A +PAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  808  LEKEVEDASKAEGSALEKKVAALKSRVDSAIMPAAKKADIRAKIALLQNEVRKAQKKIAE  867

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  868  QNLKISVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  927

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+
Sbjct  928  TTNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVNAAL  987

Query  218  DLAASFASIKLS  183
            DLAASFAS+KL+
Sbjct  988  DLAASFASLKLN  999



>ref|XP_006437524.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
 gb|ESR50764.1| hypothetical protein CICLE_v10030624mg [Citrus clementina]
Length=1001

 Score =   154 bits (389),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 142/191 (74%), Gaps = 1/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  811  LEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  870

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQ G+ V++FSTDE
Sbjct  871  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQ-GMPVMVFSTDE  929

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AM
Sbjct  930  TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAM  989

Query  218  DLAASFASIKL  186
            DLAA FA++KL
Sbjct  990  DLAAEFAAMKL  1000



>ref|XP_009107233.1| PREDICTED: alanine--tRNA ligase [Brassica rapa]
Length=997

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 142/192 (74%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++++A+  E + LE+KV  L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  806  LEKEVEDASKAEGNALEKKVAALKSRVDSAIIPAAKKADIRAKIALLQNEVRKAQKKIAE  865

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  866  QNLKKSVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  925

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V  A+
Sbjct  926  TTNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVKAAL  985

Query  218  DLAASFASIKLS  183
            DLAASFAS+KL+
Sbjct  986  DLAASFASMKLN  997



>ref|XP_010541854.1| PREDICTED: alanine--tRNA ligase-like [Tarenaya hassleriana]
Length=1003

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 145/192 (76%), Gaps = 3/192 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK +++A+  E S LE+KV  LN+ V++A IPAAKK +++ +++ LQ+ V +A+K+IA 
Sbjct  815   LEKDVEDASKEEGSTLEKKVAALNSRVDKAVIPAAKKADIRAKITLLQSEVRKAQKKIAE  874

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A++ AEAA S GK++C+  + +GLD AAVR+AV KVM+QKG++V++FSTD 
Sbjct  875   ENIQKAVKVATDAAEAAASNGKSFCVSHVDVGLDAAAVREAVSKVMKQKGMSVMVFSTDG  934

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +VCAGVP+K    KQL V EWL+ AL PL G+ G GKGGLA GQ +D   V+EA+
Sbjct  935   TTNKAIVCAGVPDK---YKQLDVTEWLSNALGPLNGRCGKGKGGLATGQGTDASQVNEAL  991

Query  218   DLAASFASIKLS  183
             DLAASFAS+KL+
Sbjct  992   DLAASFASMKLN  1003



>ref|XP_007043323.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
 gb|EOX99154.1| Alanyl-tRNA synthetase, putative [Theobroma cacao]
Length=1015

 Score =   153 bits (387),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             L K++ +A+ +E SLLE+KV +L   V+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  824   LLKEVDDASKIEVSLLEKKVASLKTRVDSASIPAAKKADIRGKIAQLQNQLKKAQKKIAE  883

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A+E+AE A S GK +C+ R+ +GLD AA+R+AV KV+EQKG+ V++FSTDE
Sbjct  884   ENMQKAVKIATELAEVAASEGKTFCVSRIDVGLDAAALREAVSKVIEQKGMPVMVFSTDE  943

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +V AGVPEK    K L V EWL  AL PL G+ G GKGGLA GQ +D  H++EAM
Sbjct  944   TTNKAVVYAGVPEKSAQSKLLEVSEWLTNALGPLKGRCGRGKGGLATGQGTDASHINEAM  1003

Query  218   DLAASFASIKL  186
             DLA SFAS+KL
Sbjct  1004  DLATSFASMKL  1014



>ref|XP_002531134.1| alanyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF31254.1| alanyl-tRNA synthetase, putative [Ricinus communis]
Length=1025

 Score =   153 bits (387),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 141/191 (74%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE++  E +  E SLLE+KV +L + V+ A IPAAKK +++ ++S LQ  V +A+K+I+ 
Sbjct  834   LEQEADEISKTEGSLLEKKVASLKSRVDSAPIPAAKKFDIRTKISALQDEVRKAQKKISE  893

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A+EMAE A S GK +CI R+ +GLD AAVR+AV KV+++KG++ ++FS DE
Sbjct  894   ENMQKAVKIATEMAEVAASEGKQFCISRVDVGLDAAAVREAVSKVLQKKGLSAMVFSIDE  953

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NKV+VCAGV EKGD  KQL V EWL AALKPL G+ G GKGGLA GQ ++  H+D AM
Sbjct  954   TTNKVVVCAGVAEKGDKSKQLEVSEWLTAALKPLNGRCGKGKGGLATGQGTEGVHLDAAM  1013

Query  218   DLAASFASIKL  186
             +LAA FA +KL
Sbjct  1014  NLAAEFAQMKL  1024



>ref|XP_006590811.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Glycine max]
Length=824

 Score =   152 bits (384),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             E+++ +AA +  +LLEEKV++L +++E   IPAAKK ++K ++ +LQ +V +A+K++A 
Sbjct  634  FEQQVDDAAKLVGTLLEEKVSSLKSNIETLSIPAAKKADIKIKIVRLQDQVRKAQKQVAE  693

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV   +E AE A S GK +CI  + +GLD AAVR+AV KVM+QKG++V++FSTDE
Sbjct  694  ENKRKAVMITAEKAELAASNGKTFCISLVDVGLDVAAVREAVTKVMDQKGLSVMVFSTDE  753

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKG     L V +WL+ AL PL G+ G GKGGLA GQ ++  HV+EA+
Sbjct  754  STNKAVVCAGVPEKGG-KGNLDVADWLSNALGPLKGRCGKGKGGLATGQGTEASHVNEAI  812

Query  218  DLAASFASIKLS  183
            DLA  FAS+KLS
Sbjct  813  DLAEKFASMKLS  824



>gb|KHN32273.1| Alanine--tRNA ligase, partial [Glycine soja]
Length=919

 Score =   152 bits (383),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             E+++ +AA +  +LLEEKV++L +++E   IPAAKK ++K ++ +LQ +V +A+K++A 
Sbjct  729  FEQQVDDAAKLVGTLLEEKVSSLKSNIETLSIPAAKKADIKIKIVRLQDQVRKAQKQVAE  788

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV   +E AE A S GK +CI  + +GLD AAVR+AV KVM+QKG++V++FSTDE
Sbjct  789  ENKRKAVMITAEKAELAASNGKTFCISLVDVGLDVAAVREAVTKVMDQKGLSVMVFSTDE  848

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKG     L V +WL+ AL PL G+ G GKGGLA GQ ++  HV+EA+
Sbjct  849  STNKAVVCAGVPEKGGK-GNLDVADWLSNALGPLKGRCGKGKGGLATGQGTEASHVNEAI  907

Query  218  DLAASFASIKLS  183
            DLA  FAS+KLS
Sbjct  908  DLAEKFASMKLS  919



>ref|XP_004148575.1| PREDICTED: alanine--tRNA ligase-like [Cucumis sativus]
Length=956

 Score =   152 bits (383),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 136/192 (71%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A 
Sbjct  764  LEQEVDAAFNIDGNLLEKMVASFKNRVDSAPIPAARKAQIRTKIVLLQNEVRKAQKKLAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A E AE A S GK +CI  + +GLD AAVR+AVV+VMEQKGI+ ++FSTDE
Sbjct  824  ENMQKAVKIAVETAEMASSEGKPFCISHVDVGLDAAAVREAVVRVMEQKGISTMVFSTDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAM
Sbjct  884  TTKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAM  943

Query  218  DLAASFASIKLS  183
            DLA SFAS+KL+
Sbjct  944  DLATSFASLKLN  955



>gb|KGN58521.1| hypothetical protein Csa_3G656490 [Cucumis sativus]
Length=1030

 Score =   152 bits (384),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 136/192 (71%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A 
Sbjct  838   LEQEVDAAFNIDGNLLEKMVASFKNRVDSAPIPAARKAQIRTKIVLLQNEVRKAQKKLAE  897

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A E AE A S GK +CI  + +GLD AAVR+AVV+VMEQKGI+ ++FSTDE
Sbjct  898   ENMQKAVKIAVETAEMASSEGKPFCISHVDVGLDAAAVREAVVRVMEQKGISTMVFSTDE  957

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
                K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAM
Sbjct  958   TTKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAM  1017

Query  218   DLAASFASIKLS  183
             DLA SFAS+KL+
Sbjct  1018  DLATSFASLKLN  1029



>ref|XP_004163302.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Cucumis 
sativus]
Length=956

 Score =   152 bits (383),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 136/192 (71%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++  A +++ +LLE+ V +    V+ A IPAA+K +++ ++  LQ  V +A+K++A 
Sbjct  764  LEQEVDAAFNIDGNLLEKMVASFKNRVDSAPIPAARKAQIRTKIVLLQNEVRKAQKKLAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A E AE A S GK +CI  + +GLD AAVR+AVV+VMEQKGI+ ++FSTDE
Sbjct  824  ENMQKAVKIAVETAEMASSEGKPFCISHVDVGLDAAAVREAVVRVMEQKGISTMVFSTDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               K +VCAGVP KG+  KQL V EWL  AL+PL G+ G GKGGLA GQ +D   + EAM
Sbjct  884  TTKKAVVCAGVPPKGNQGKQLEVSEWLTTALQPLKGRCGKGKGGLATGQGTDASQIKEAM  943

Query  218  DLAASFASIKLS  183
            DLA SFAS+KL+
Sbjct  944  DLATSFASLKLN  955



>ref|XP_003537781.2| PREDICTED: alanine--tRNA ligase-like isoform X1 [Glycine max]
Length=999

 Score =   152 bits (383),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 141/192 (73%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             E+++ +AA +  +LLEEKV++L +++E   IPAAKK ++K ++ +LQ +V +A+K++A 
Sbjct  809  FEQQVDDAAKLVGTLLEEKVSSLKSNIETLSIPAAKKADIKIKIVRLQDQVRKAQKQVAE  868

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV   +E AE A S GK +CI  + +GLD AAVR+AV KVM+QKG++V++FSTDE
Sbjct  869  ENKRKAVMITAEKAELAASNGKTFCISLVDVGLDVAAVREAVTKVMDQKGLSVMVFSTDE  928

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKG     L V +WL+ AL PL G+ G GKGGLA GQ ++  HV+EA+
Sbjct  929  STNKAVVCAGVPEKGG-KGNLDVADWLSNALGPLKGRCGKGKGGLATGQGTEASHVNEAI  987

Query  218  DLAASFASIKLS  183
            DLA  FAS+KLS
Sbjct  988  DLAEKFASMKLS  999



>ref|XP_007225354.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
 gb|EMJ26553.1| hypothetical protein PRUPE_ppa000923mg [Prunus persica]
Length=960

 Score =   151 bits (381),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 139/191 (73%), Gaps = 2/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++ EA+  E SLLE+KV +L + V+ A IP A K E++ +++ LQ +V +A+K IA 
Sbjct  771  LEQEVDEASKAEGSLLEKKVASLKSRVDSAPIPVANKAEIRAKIAVLQNQVRKAQKIIAE  830

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N  NAVK A+EMAE A S GKAYC+  + +GLD AAVR+AVVKV+E+KG+  ++FSTDE
Sbjct  831  QNMQNAVKVATEMAEVAASDGKAYCVSHVDVGLDAAAVREAVVKVIEKKGMPAMVFSTDE  890

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVP  GD   QL V EWL A+L PL G+ G GKGGLA GQ +D   ++EA+
Sbjct  891  TTNKAVVCAGVP--GDKGNQLEVSEWLTASLGPLKGRCGKGKGGLATGQGTDASRLNEAV  948

Query  218  DLAASFASIKL  186
            DLA SFA +KL
Sbjct  949  DLATSFAQMKL  959



>emb|CAA73145.1| alanyl t-RNA synthetase [Arabidopsis thaliana]
Length=251

 Score =   141 bits (356),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  60   LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAE  119

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  120  QNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  179

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  180  STNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDAFQVQAAL  239

Query  218  DLAASFASIKLS  183
            D+A+SFAS+KL+
Sbjct  240  DMASSFASMKLN  251



>ref|XP_006305941.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
 gb|EOA38839.1| hypothetical protein CARUB_v10011180mg [Capsella rubella]
Length=1003

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA 
Sbjct  812   LEKEVEDASKAEGSALEKKVSALKSRVDAAIIPAAKKADIRAKIASLQNEVRKAQKRIAE  871

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +VK A E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  872   QNLKKSVKVAIETAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  931

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             + NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  932   STNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  991

Query  218   DLAASFASIKLS  183
             D+AASFAS+KL+
Sbjct  992   DMAASFASMKLN  1003



>gb|KJB31825.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=1015

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 139/191 (73%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             L K++ +A+++E  LLE+KV +L  +V+ A IPAA+K +++ ++++LQ ++ +A+K+IA 
Sbjct  824   LLKEVDDASNMEVRLLEKKVASLKTTVDSASIPAAQKADIRSKIAQLQNQLKKAQKKIAE  883

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   AV  A+E+AE A   GK +C+ R+ +GLD AA+R+AV KV++QKG+ V++FS DE
Sbjct  884   QNMQRAVTTATELAEVAAKEGKTFCVTRIDVGLDAAALREAVSKVIQQKGMPVMVFSIDE  943

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +V AGVPEK +  K L V EWL  AL PL G+ G GKGGLA GQ +D  HV EAM
Sbjct  944   TTNKAVVYAGVPEKSEQSKLLEVSEWLTNALGPLKGRCGKGKGGLATGQGTDGSHVKEAM  1003

Query  218   DLAASFASIKL  186
             DLA SFAS+KL
Sbjct  1004  DLATSFASMKL  1014



>gb|KJB31826.1| hypothetical protein B456_005G210000 [Gossypium raimondii]
Length=974

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 139/191 (73%), Gaps = 0/191 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L K++ +A+++E  LLE+KV +L  +V+ A IPAA+K +++ ++++LQ ++ +A+K+IA 
Sbjct  783  LLKEVDDASNMEVRLLEKKVASLKTTVDSASIPAAQKADIRSKIAQLQNQLKKAQKKIAE  842

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   AV  A+E+AE A   GK +C+ R+ +GLD AA+R+AV KV++QKG+ V++FS DE
Sbjct  843  QNMQRAVTTATELAEVAAKEGKTFCVTRIDVGLDAAALREAVSKVIQQKGMPVMVFSIDE  902

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVPEK +  K L V EWL  AL PL G+ G GKGGLA GQ +D  HV EAM
Sbjct  903  TTNKAVVYAGVPEKSEQSKLLEVSEWLTNALGPLKGRCGKGKGGLATGQGTDGSHVKEAM  962

Query  218  DLAASFASIKL  186
            DLA SFAS+KL
Sbjct  963  DLATSFASMKL  973



>ref|XP_010112290.1| Alanine--tRNA ligase [Morus notabilis]
 gb|EXC33093.1| Alanine--tRNA ligase [Morus notabilis]
Length=906

 Score =   147 bits (372),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 136/191 (71%), Gaps = 0/191 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++ +A+  E   LE+KV +L   V+ A IPAAKK +++ +++ LQ +V +A+K+IA 
Sbjct  715  LEQEVDDASKDEGISLEKKVASLKNRVDSALIPAAKKADIRSKIALLQNQVKKAQKKIAE  774

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A++  + +A+ A S GKA+CI  + +GLD  AVR+AV KVM+ KG++ ++FSTD 
Sbjct  775  ENLQKAIQVTTMIADNATSEGKAFCICSVDVGLDVNAVREAVSKVMKDKGMSAMVFSTDV  834

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVPEKGD  K L V  WL AAL+PL G+ G GKGGLA GQ +D  HV EAM
Sbjct  835  TTNKAVVCAGVPEKGDKSKLLDVTAWLTAALEPLKGRCGKGKGGLATGQGTDASHVQEAM  894

Query  218  DLAASFASIKL  186
             LA+SFAS+KL
Sbjct  895  SLASSFASMKL  905



>ref|XP_008340455.1| PREDICTED: alanine--tRNA ligase [Malus domestica]
Length=1015

 Score =   147 bits (371),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 139/191 (73%), Gaps = 3/191 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+ + EA+  E SLLE+KV +L + V+ A IPAAKK E++ +++ LQT++ +A+K IA 
Sbjct  827   LEQDVHEASKAEGSLLEKKVASLKSRVDSAPIPAAKKAEIRTKMAVLQTQLKKAQKMIAE  886

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N  NAVK A+EMAE A S GKAYC+ ++ +GLDTAAVR+AV+K+    G+  ++FSTDE
Sbjct  887   QNIKNAVKVATEMAEVAASDGKAYCVSQVDVGLDTAAVREAVLKITGM-GMPAMVFSTDE  945

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK LVCAGVP  GD   QL V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+
Sbjct  946   TTNKALVCAGVP--GDKGTQLEVSEWLTAAMGPLNGRCGKGKGGLATGQGTDASRLNEAI  1003

Query  218   DLAASFASIKL  186
             DLA SFA +KL
Sbjct  1004  DLATSFAQMKL  1014



>ref|XP_009351710.1| PREDICTED: alanine--tRNA ligase [Pyrus x bretschneideri]
Length=952

 Score =   146 bits (369),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 104/191 (54%), Positives = 139/191 (73%), Gaps = 3/191 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+ + EA+  E SLLE+KV +L + V+ A IPAAKK E++ +++ LQT++ +A+K IA 
Sbjct  764  LEQDVHEASKAEGSLLEKKVASLKSRVDSAPIPAAKKAEIRAKMAVLQTQLRKAQKMIAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N  NAVK A+EMAE A S GKAYC+ ++ +GLDTAAVR+AV+K+    G+  ++FSTDE
Sbjct  824  QNIKNAVKVATEMAEVAASDGKAYCVSQVDVGLDTAAVREAVLKITGM-GMPAMVFSTDE  882

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK LVCAGVP  GD   QL V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+
Sbjct  883  TTNKALVCAGVP--GDKGTQLEVSEWLTAAMGPLNGRCGKGKGGLATGQGTDASRLNEAI  940

Query  218  DLAASFASIKL  186
            DLA SFA +KL
Sbjct  941  DLATSFAQMKL  951



>ref|XP_008221037.1| PREDICTED: alanine--tRNA ligase [Prunus mume]
Length=1025

 Score =   146 bits (368),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 3/191 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++ EA+  E SLLE+KV +L + V+ A IP A K E++ +++ LQ +V +A+K IA 
Sbjct  837   LEQEVDEASKAEGSLLEKKVASLKSRVDSAPIPVANKAEIRAKIAVLQNQVRKAQKIIAE  896

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N  NAVK A+EMAE A S GKAYC+  + +GLD AAVR+AVVKV+E KG+  ++FSTDE
Sbjct  897   QNMQNAVKVATEMAEVAASDGKAYCVSHVDVGLDVAAVREAVVKVIE-KGMPAMVFSTDE  955

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +VCAGVP  GD   QL V EWL A+L PL G+ G GKGGL  GQ +D   ++EA+
Sbjct  956   TTNKAVVCAGVP--GDKGNQLEVSEWLTASLGPLKGRCGKGKGGLVTGQGTDASRLNEAV  1013

Query  218   DLAASFASIKL  186
             DLA SFA +KL
Sbjct  1014  DLATSFAQMKL  1024



>gb|KDO52983.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=1009

 Score =   145 bits (366),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  811  LEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  870

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V++FSTDE
Sbjct  871  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDE  930

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  300
              NK +VCAGVPEK D  KQL V EWL AAL+P
Sbjct  931  TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQP  963



>ref|XP_010479473.1| PREDICTED: alanine--tRNA ligase [Camelina sativa]
Length=1006

 Score =   144 bits (364),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 145/192 (76%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+KRIA 
Sbjct  815   LEKEVEDASVAEGSALEKKVSALKSQVDAAIIPAAKKADIRAKIASLQNEVKKAQKRIAE  874

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  875   QNLKKSVKVATEAAESAASNGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  934

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             + NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  935   STNKAVVCAGVPDKSDQFKQLDVTEWLTNALGPLKGRCGKGKGGLASGQGTDASQVQAAL  994

Query  218   DLAASFASIKLS  183
             D+A+SFAS+KL+
Sbjct  995   DMASSFASMKLN  1006



>ref|XP_006484668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Citrus sinensis]
Length=1009

 Score =   144 bits (363),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 116/153 (76%), Gaps = 0/153 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SL+E+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  811  LEKEVDDASKIEGSLVEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  870

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V++FSTDE
Sbjct  871  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDE  930

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  300
              NK +VCAGVPEK D  KQL V EWL AAL+P
Sbjct  931  TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQP  963



>ref|XP_010265724.1| PREDICTED: alanine--tRNA ligase-like [Nelumbo nucifera]
Length=493

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 134/194 (69%), Gaps = 3/194 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L+++I  AA +E S LE+KV +L + V+ A IPAA K +L  ++S+LQ +V +  K+IA 
Sbjct  299  LDQEISGAAKIEVSQLEKKVASLKSRVQSATIPAAMKTDLSAKISQLQDQVRKEMKKIAQ  358

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A   A+EMA+AA S G+++C+  + +GLD AAVR+AV++ M+QKG++V+IFSTDE
Sbjct  359  ENVQKAKTTAAEMADAAASNGESFCVCHVNVGLDAAAVREAVIRTMDQKGMSVMIFSTDE  418

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP---lggkggggkgglaqgqASDLKHVD  228
              NK + CAGV E  D  K L V EW  AA++P    GGKG  GK   AQGQ +D  H+ 
Sbjct  419  TTNKAVACAGVVENVDKSKDLDVLEWFTAAMEPLKGRGGKGNVGKRFYAQGQGTDASHLQ  478

Query  227  EAMDLAASFASIKL  186
            EAMD+A +FAS++L
Sbjct  479  EAMDIATAFASMRL  492



>ref|XP_008366973.1| PREDICTED: alanine--tRNA ligase-like [Malus domestica]
Length=901

 Score =   143 bits (361),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 103/191 (54%), Positives = 137/191 (72%), Gaps = 3/191 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+ + EA+  E SLLE+KV +L + V+ A IPAAKK E++ +++ LQ ++ +A+K IA 
Sbjct  713  LEQDVHEASKAEGSLLEKKVXSLKSRVDSAPIPAAKKAEIRAKMAVLQNQLKKAQKMIAE  772

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N  NAVK A+EMAE A S GKAYC+ ++ +GLD AAVR+AV+K+    GI  ++FSTDE
Sbjct  773  QNIKNAVKVATEMAEVAASDGKAYCVSQVDVGLDAAAVREAVLKITGM-GIPAMVFSTDE  831

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK LVCAGVP  GD   QL V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+
Sbjct  832  TTNKALVCAGVP--GDKGTQLEVSEWLTAAMGPLNGRCGKGKGGLASGQGTDASRLNEAI  889

Query  218  DLAASFASIKL  186
            DLA SFA +KL
Sbjct  890  DLATSFAQMKL  900



>ref|XP_002894237.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70496.1| cytosolic tRNA-Ala synthetase [Arabidopsis lyrata subsp. lyrata]
Length=955

 Score =   142 bits (358),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  764  LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRAKIASLQNEVRKAQKKIAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  824  QNLKKSVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  884  STNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  943

Query  218  DLAASFASIKLS  183
            D+AASFAS+KL+
Sbjct  944  DMAASFASMKLN  955



>ref|XP_006393171.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30457.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=994

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK+ ++A   E S LE+KV TL   V+   IPAAKK ++K ++  LQ  V +A+K+IA 
Sbjct  803  LEKEAEDAFKAEGSALEKKVATLKRRVDEVDIPAAKKADIKAKIVLLQNEVRKAQKKIAE  862

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V++FSTDE
Sbjct  863  QNLKKSVEVATEAAESAASDGKMFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDE  922

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+
Sbjct  923  STNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKSGLATGQGTDASQVNAAL  982

Query  218  DLAASFASIKLS  183
            D+AASFAS+KL+
Sbjct  983  DMAASFASMKLN  994



>ref|XP_006393172.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30458.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1001

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK+ ++A   E S LE+KV TL   V+   IPAAKK ++K ++  LQ  V +A+K+IA 
Sbjct  810   LEKEAEDAFKAEGSALEKKVATLKRRVDEVDIPAAKKADIKAKIVLLQNEVRKAQKKIAE  869

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V++FSTDE
Sbjct  870   QNLKKSVEVATEAAESAASDGKMFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDE  929

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             + NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+
Sbjct  930   STNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKSGLATGQGTDASQVNAAL  989

Query  218   DLAASFASIKLS  183
             D+AASFAS+KL+
Sbjct  990   DMAASFASMKLN  1001



>ref|XP_010273668.1| PREDICTED: alanine--tRNA ligase [Nelumbo nucifera]
Length=1038

 Score =   142 bits (357),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 95/194 (49%), Positives = 136/194 (70%), Gaps = 3/194 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE++I +AA ++ S +E+KV +L + V+ A IPA  K +L  ++S+LQ +V +A K+IA 
Sbjct  844   LEQEISDAAKLDVSQMEKKVASLKSRVQSAAIPATMKADLGAKISQLQDQVRKATKKIAQ  903

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   A K A+EMA+ A + GKA+CI R+ +GLD AA+R+AV+K M+QKG++V+IFSTDE
Sbjct  904   ENIQKATKTAAEMADIAATNGKAFCICRVNVGLDAAAIREAVIKTMDQKGMSVMIFSTDE  963

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP---lggkggggkgglaqgqASDLKHVD  228
               NK +VCAGV E G   K L + EW  AA++P    GGKG  GK   AQGQ +D   V 
Sbjct  964   TTNKAVVCAGVSENGSKSKDLDLLEWFTAAMEPLKGRGGKGSVGKRFYAQGQGTDASQVQ  1023

Query  227   EAMDLAASFASIKL  186
             +A+++A +FAS+KL
Sbjct  1024  QAIEIATAFASMKL  1037



>ref|XP_006393173.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
 gb|ESQ30459.1| hypothetical protein EUTSA_v10011205mg [Eutrema salsugineum]
Length=1005

 Score =   142 bits (357),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK+ ++A   E S LE+KV TL   V+   IPAAKK ++K ++  LQ  V +A+K+IA 
Sbjct  814   LEKEAEDAFKAEGSALEKKVATLKRRVDEVDIPAAKKADIKAKIVLLQNEVRKAQKKIAE  873

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V++FSTDE
Sbjct  874   QNLKKSVEVATEAAESAASDGKMFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDE  933

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             + NK +VCAGVPEK D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V+ A+
Sbjct  934   STNKAVVCAGVPEKSDQFKQLDVTEWLTTALGPLKGRCGKGKSGLATGQGTDASQVNAAL  993

Query  218   DLAASFASIKLS  183
             D+AASFAS+KL+
Sbjct  994   DMAASFASMKLN  1005



>ref|NP_175439.2| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 sp|P36428.3|SYA_ARATH RecName: Full=Alanine--tRNA ligase; AltName: Full=Alanyl-tRNA 
synthetase; Short=AlaRS; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE32524.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=1003

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  812   LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAE  871

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  872   QNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  931

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             + NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  932   STNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  991

Query  218   DLAASFASIKLS  183
             D+A+SFAS+KL+
Sbjct  992   DMASSFASMKLN  1003



>gb|KJB50036.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1010

 Score =   141 bits (356),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             L +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  819   LLQEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAE  878

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V++FS DE
Sbjct  879   QNMQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDE  938

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK +V AGVPEK +  K+L V EWL  AL PL GK G GKGGLA GQ +D   V+EA+
Sbjct  939   TTNKAVVYAGVPEKSESIKRLEVSEWLTKALGPLKGKCGRGKGGLATGQGTDASRVNEAI  998

Query  218   DLAASFASIKL  186
             DLA SFAS+KL
Sbjct  999   DLATSFASMKL  1009



>gb|AAD50044.1|AC007980_9 cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
 gb|AAO00886.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP68246.1| At1g50200 [Arabidopsis thaliana]
Length=955

 Score =   141 bits (355),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  764  LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE
Sbjct  824  QNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  884  STNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  943

Query  218  DLAASFASIKLS  183
            D+A+SFAS+KL+
Sbjct  944  DMASSFASMKLN  955



>emb|CDY45055.1| BnaA08g02200D [Brassica napus]
Length=993

 Score =   140 bits (354),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 137/192 (71%), Gaps = 5/192 (3%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++++A+  E + LE+KV  L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  807  LEKEVEDASKAEGNALEKKVAALKSRVDSAIIPAAKKADIRAKIALLQNEVRKAQKKIAE  866

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV      KG+++++FSTDE
Sbjct  867  QNLKKSVKVATEAAESAASDGKTFCIIQLDVGLDAAAVREAV-----SKGMSIMVFSTDE  921

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ +D   V  A+
Sbjct  922  TTNKAVVCAGVPDKSDKFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVKAAL  981

Query  218  DLAASFASIKLS  183
            DLAASFAS+KL+
Sbjct  982  DLAASFASMKLN  993



>emb|CAA80381.1| cytosolic tRNA-Ala synthetase [Arabidopsis thaliana]
Length=955

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  764  LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAV++AV KVME+KG+++++FSTDE
Sbjct  824  QNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVQEAVSKVMEKKGMSIMVFSTDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  884  STNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  943

Query  218  DLAASFASIKLS  183
            D+A+SFAS+KL+
Sbjct  944  DMASSFASMKLN  955



>ref|XP_004297751.1| PREDICTED: alanine--tRNA ligase [Fragaria vesca subsp. vesca]
Length=1002

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 98/192 (51%), Positives = 139/192 (72%), Gaps = 3/192 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++ EA+  E+SLLE+K+ +  + ++ AQIPAAKK +++ ++ +LQ +V +A+K+IA 
Sbjct  814   LEQEVTEASKAEESLLEKKIASFKSRIDAAQIPAAKKADIRDKIVQLQNKVRKAQKKIAE  873

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   AVK A EMAE A S GKA+C+  + +GLD AAVR+AV KV+E KG+  ++FSTDE
Sbjct  874   QNLQKAVKVAREMAELAASDGKAFCVSHVDVGLDIAAVREAVCKVIE-KGMPAIVFSTDE  932

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
               NK + CAGVP  GD  KQL V +WL AAL PL G+ G GKGGLA GQ +D   + E++
Sbjct  933   TTNKAVACAGVP--GDKGKQLEVSQWLIAALGPLKGRCGKGKGGLATGQGTDASRLKESI  990

Query  218   DLAASFASIKLS  183
             D+A +FA +KLS
Sbjct  991   DVATTFAQMKLS  1002



>pir||S32671 alanine-tRNA ligase (EC 6.1.1.7) - Arabidopsis thaliana  (fragment)
Length=989

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  798  LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAE  857

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   +VK A+E AE+A S GK +CI++L +GLD AAV++AV KVME+KG+++++FSTDE
Sbjct  858  QNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVQEAVSKVMEKKGMSIMVFSTDE  917

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  918  STNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  977

Query  218  DLAASFASIKLS  183
            D+A+SFAS+KL+
Sbjct  978  DMASSFASMKLN  989



>emb|CAA80380.1| mitochondrial tRNA-Ala synthetase [Arabidopsis thaliana]
Length=1003

 Score =   139 bits (351),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 144/192 (75%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ  V +A+K+IA 
Sbjct  812   LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQNEVRKAQKKIAE  871

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   +VK A+E AE+A S GK +CI++L +GLD AAV++AV KVME+KG+++++FSTDE
Sbjct  872   QNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVQEAVSKVMEKKGMSIMVFSTDE  931

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             + NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D   V  A+
Sbjct  932   STNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTDASQVQAAL  991

Query  218   DLAASFASIKLS  183
             D+A+SFAS+KL+
Sbjct  992   DMASSFASMKLN  1003



>ref|XP_010523577.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523578.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010523579.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Tarenaya hassleriana]
Length=1003

 Score =   139 bits (350),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 139/192 (72%), Gaps = 3/192 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             LEK++++A+    S LE+KV  L + V+ A IPA KK +++ ++  LQ+ V +A+K+IA 
Sbjct  815   LEKEVEDASKELGSALEKKVAALKSRVDAAVIPAPKKADIRAKIVLLQSEVRKAQKKIAE  874

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A+E AEAA S GK +C+  + +GLD AAVR+AV KVMEQKG+++++FSTDE
Sbjct  875   ENIRKAVKVATETAEAAASDGKPFCVSNVDVGLDAAAVREAVSKVMEQKGMSIMVFSTDE  934

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             A  K +VCAGVP K    KQL V EWL+ AL PL G+ G GKGGLA GQ +D   V+ A+
Sbjct  935   ATKKAVVCAGVPGK---YKQLDVTEWLSNALGPLNGRCGKGKGGLATGQGTDASQVNAAL  991

Query  218   DLAASFASIKLS  183
             DLAA+FAS+KL+
Sbjct  992   DLAATFASMKLN  1003



>ref|XP_010683781.1| PREDICTED: alanine--tRNA ligase [Beta vulgaris subsp. vulgaris]
Length=1007

 Score =   139 bits (349),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 140/192 (73%), Gaps = 0/192 (0%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             L+++++ A  +E S  E+ V +L + VE A IP AKKD++++ +  LQ  V +A+K++A 
Sbjct  816   LKQEVEHALKLEVSQQEKIVASLRSRVEAAPIPVAKKDDIQKIMKVLQDNVRKAQKKVAE  875

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             EN   AVK A+E AEAA+S GK +CI R+ +GLD AAVR+AV KV+++KGI+V++FS DE
Sbjct  876   ENLQKAVKTATEKAEAAISEGKTFCISRVDVGLDAAAVREAVQKVIQKKGISVMVFSVDE  935

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              ANK +V AGVP+KG+  K L V EWL  AL PL G+ G GKGGLAQGQ +D  +V+EA+
Sbjct  936   TANKAIVYAGVPDKGNTWKGLEVSEWLTVALGPLKGRCGKGKGGLAQGQGTDASNVEEAI  995

Query  218   DLAASFASIKLS  183
              LA  FAS+KL+
Sbjct  996   KLAVDFASMKLN  1007



>ref|XP_003607221.1| Alanyl-tRNA synthetase [Medicago truncatula]
Length=389

 Score =   133 bits (334),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 125/174 (72%), Gaps = 1/174 (1%)
 Frame = -1

Query  704  KVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavkaasemaeaav  525
            KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A E+   AVK  +E A+ AV
Sbjct  217  KVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAEEDKRKAVKITTEKADLAV  276

Query  524  SGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDEAANKVLVCAGVPEKGDVC  345
            S GK +CI  + +GLD AAVR+AV KV++QKG++V++FSTDE+ NK +VCAGVPEKGD  
Sbjct  277  SDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDESTNKAVVCAGVPEKGDKG  336

Query  344  KQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKLS  183
            K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM LA  FAS+KL+
Sbjct  337  K-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAMGLAVKFASVKLT  389



>gb|AES89418.2| alanyl-tRNA synthetase [Medicago truncatula]
Length=453

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 132/192 (69%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
              + +K A     +  ++KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A 
Sbjct  263  FHRAMKAARERSKTAPKKKVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAE  322

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            E+   AVK  +E A+ AVS GK +CI  + +GLD AAVR+AV KV++QKG++V++FSTDE
Sbjct  323  EDKRKAVKITTEKADLAVSDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDE  382

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKGD  K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM
Sbjct  383  STNKAVVCAGVPEKGDKGK-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAM  441

Query  218  DLAASFASIKLS  183
             LA  FAS+KL+
Sbjct  442  GLAVKFASVKLT  453



>ref|XP_003607220.1| Alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 132/192 (69%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
              + +K A     +  ++KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A 
Sbjct  445  FHRAMKAARERSKTAPKKKVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAE  504

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            E+   AVK  +E A+ AVS GK +CI  + +GLD AAVR+AV KV++QKG++V++FSTDE
Sbjct  505  EDKRKAVKITTEKADLAVSDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDE  564

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKGD  K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM
Sbjct  565  STNKAVVCAGVPEKGDKGK-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAM  623

Query  218  DLAASFASIKLS  183
             LA  FAS+KL+
Sbjct  624  GLAVKFASVKLT  635



>gb|AES89417.2| alanyl-tRNA synthetase [Medicago truncatula]
Length=635

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 96/192 (50%), Positives = 132/192 (69%), Gaps = 1/192 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
              + +K A     +  ++KV +L ++VE   IPAAKK E K E+   Q ++ +A+K +A 
Sbjct  445  FHRAMKAARERSKTAPKKKVLSLKSNVETLSIPAAKKAENKIEIVLPQDQMRKAQKHVAE  504

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            E+   AVK  +E A+ AVS GK +CI  + +GLD AAVR+AV KV++QKG++V++FSTDE
Sbjct  505  EDKRKAVKITTEKADLAVSDGKYFCISHVDVGLDVAAVREAVKKVIDQKGLSVMVFSTDE  564

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK +VCAGVPEKGD  K L   EWL+ AL PL G+ G GKGGLA GQ +D  H++EAM
Sbjct  565  STNKAVVCAGVPEKGDKGK-LDASEWLSNALGPLKGRCGKGKGGLATGQGTDASHLNEAM  623

Query  218  DLAASFASIKLS  183
             LA  FAS+KL+
Sbjct  624  GLAVKFASVKLT  635



>ref|NP_001185186.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
 gb|AEE32525.1| Alanyl-tRNA synthetase [Arabidopsis thaliana]
Length=963

 Score =   134 bits (336),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 101/200 (51%), Positives = 144/200 (72%), Gaps = 8/200 (4%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQ--------TRVI  603
            LE+++++A+  E S LE+KV+ L + V+ A IPAAKK +++ +++ LQ          V 
Sbjct  764  LEREVEDASRAEGSALEKKVSALKSRVDAAIIPAAKKADIRTKIASLQVISSFSLTNEVR  823

Query  602  QAKKRIAAENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIA  423
            +A+K+IA +N   +VK A+E AE+A S GK +CI++L +GLD AAVR+AV KVME+KG++
Sbjct  824  KAQKKIAEQNLKKSVKLATEAAESAASDGKTFCIIQLDVGLDAAAVREAVSKVMEKKGMS  883

Query  422  VLIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASD  243
            +++FSTDE+ NK +VCAGVPEK D  K L V EWL  AL PL G+ G GKGGLA GQ +D
Sbjct  884  IMVFSTDESTNKAVVCAGVPEKSDQFKPLDVTEWLTTALGPLKGRCGKGKGGLASGQGTD  943

Query  242  LKHVDEAMDLAASFASIKLS  183
               V  A+D+A+SFAS+KL+
Sbjct  944  ASQVQAALDMASSFASMKLN  963



>ref|XP_003619277.1| Alanyl-tRNA synthetase, partial [Medicago truncatula]
Length=452

 Score =   128 bits (322),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 105/147 (71%), Gaps = 6/147 (4%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             EK++ E A +E SLLEEKV++L ++VE   IPAAKK E+K +++ LQ + +     +  
Sbjct  312  FEKQVDEVAKLEGSLLEEKVSSLKSNVETLSIPAAKKAEIKTKIALLQRKSV-----LLE  366

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV   +E A+ AVS GK++CI  + +GLD AAVR+AV KV++QKG++V++FSTDE
Sbjct  367  ENKRKAVTITAEKADLAVSDGKSFCISHVNVGLDVAAVREAVTKVIDQKGLSVMVFSTDE  426

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWL  318
            + NK +VCAGVPEKGD  K L V EWL
Sbjct  427  STNKAVVCAGVPEKGDKGK-LDVSEWL  452



>ref|XP_010904628.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase-like [Elaeis 
guineensis]
Length=995

 Score =   131 bits (329),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 103/192 (54%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L  +I +A+  E  LLE+KV +L + ++ A IPAA K +L+ ++S+L+ +V +AKK+I  
Sbjct  806  LASEISDASKCEGGLLEKKVASLKSKIDAAAIPAAMKADLRAKISQLEDQVRKAKKKIGE  865

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A++AA+++AEAA S GKA+CI R+ +GLDT AVR+AV+KVM+QKG+A ++FSTDE
Sbjct  866  ENIQKAIQAATKIAEAAASEGKAFCISRVDVGLDTTAVREAVLKVMDQKGLATMVFSTDE  925

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD  +VDEAM
Sbjct  926  TLNKAVVYAGVPKSKD---GLGVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASYVDEAM  982

Query  218  DLAASFASIKLS  183
            D+A+  AS+KL 
Sbjct  983  DVASKLASMKLG  994



>ref|XP_009386816.1| PREDICTED: alanine--tRNA ligase {ECO:0000255|HAMAP-Rule:MF_03133} 
[Musa acuminata subsp. malaccensis]
Length=990

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 107/191 (56%), Positives = 145/191 (76%), Gaps = 1/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L+ +I E++  E SLLE+KV TL + ++ A IPAA K +L+ ++S+L+ RV +AKK+IA 
Sbjct  800  LDAEITESSKSEGSLLEKKVATLKSKIDAAAIPAAIKADLRAKISQLEDRVRKAKKKIAE  859

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVKAA+E+A+AA S  KA+CI ++ +GLDTAAVR+AV+KV+E +G+AV++FSTDE
Sbjct  860  ENIQKAVKAATEVAKAAASERKAFCIAQVDVGLDTAAVREAVLKVLELQGLAVMVFSTDE  919

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVP  G     L+V EWLN  +KPL GKGGGGK G+AQGQ SD   ++EAM
Sbjct  920  TLNKAVVYAGVPNSGSKTG-LAVLEWLNEVMKPLKGKGGGGKNGIAQGQGSDASRLEEAM  978

Query  218  DLAASFASIKL  186
            D+AA FAS+KL
Sbjct  979  DVAAKFASLKL  989



>ref|XP_010927937.1| PREDICTED: alanine--tRNA ligase-like [Elaeis guineensis]
Length=995

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 104/192 (54%), Positives = 143/192 (74%), Gaps = 3/192 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L  +I  A+  E SLLE+KV +L + ++ A IPAA K +L+ ++S+L+ +V +AKK+I  
Sbjct  806  LASEISSASKFEGSLLEKKVASLKSKIDAAAIPAAMKADLRAKISQLEDQVRKAKKKIGE  865

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A++AA+E+AEAA S GKA+CI ++ +GLDT AVR+AV+KVM+QKG+AV++FSTD+
Sbjct  866  ENIQKAIEAATEIAEAAASEGKAFCISQVDVGLDTTAVREAVLKVMDQKGLAVMVFSTDK  925

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD   V+EAM
Sbjct  926  TLNKAVVYAGVPKSRD---GLVVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASRVEEAM  982

Query  218  DLAASFASIKLS  183
            D+A+ FAS+KL 
Sbjct  983  DVASKFASMKLG  994



>ref|XP_003619276.1| Alanyl-tRNA synthetase, partial [Medicago truncatula]
Length=900

 Score =   127 bits (320),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 105/147 (71%), Gaps = 6/147 (4%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             EK++ E A +E SLLEEKV++L ++VE   IPAAKK E+K +++ LQ + +     +  
Sbjct  760  FEKQVDEVAKLEGSLLEEKVSSLKSNVETLSIPAAKKAEIKTKIALLQRKSV-----LLE  814

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AV   +E A+ AVS GK++CI  + +GLD AAVR+AV KV++QKG++V++FSTDE
Sbjct  815  ENKRKAVTITAEKADLAVSDGKSFCISHVNVGLDVAAVREAVTKVIDQKGLSVMVFSTDE  874

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWL  318
            + NK +VCAGVPEKGD  K L V EWL
Sbjct  875  STNKAVVCAGVPEKGDKGK-LDVSEWL  900



>ref|XP_008810673.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Phoenix dactylifera]
Length=983

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L  +I +A+  E SLLE+KV +L + ++ A IPAA K +L+ + S+L+ +V +AKK+I  
Sbjct  794  LASEISDASKYEGSLLEKKVASLKSKIDAAAIPAAIKADLRAKTSQLEDQVRKAKKKIGE  853

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A+KAA+++AEAA S GKA+CI R+ +GLDT AVR+AV+KVM+QK +A+++FSTDE
Sbjct  854  ENIQKAIKAATKIAEAAASEGKAFCISRVDVGLDTTAVREAVLKVMDQKALAIMVFSTDE  913

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD   VDEAM
Sbjct  914  TLNKAVVYAGVPKSKD---GLVVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASRVDEAM  970

Query  218  DLAASFASIKLS  183
            D+A+ FAS+KL 
Sbjct  971  DVASKFASMKLG  982



>ref|XP_008810668.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Phoenix dactylifera]
Length=993

 Score =   127 bits (319),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 105/192 (55%), Positives = 142/192 (74%), Gaps = 3/192 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L  +I +A+  E SLLE+KV +L + ++ A IPAA K +L+ + S+L+ +V +AKK+I  
Sbjct  804  LASEISDASKYEGSLLEKKVASLKSKIDAAAIPAAIKADLRAKTSQLEDQVRKAKKKIGE  863

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A+KAA+++AEAA S GKA+CI R+ +GLDT AVR+AV+KVM+QK +A+++FSTDE
Sbjct  864  ENIQKAIKAATKIAEAAASEGKAFCISRVDVGLDTTAVREAVLKVMDQKALAIMVFSTDE  923

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVP+  D    L V EWL AA+ PL GKGGGGK G+AQGQ SD   VDEAM
Sbjct  924  TLNKAVVYAGVPKSKD---GLVVLEWLTAAMGPLKGKGGGGKNGIAQGQGSDASRVDEAM  980

Query  218  DLAASFASIKLS  183
            D+A+ FAS+KL 
Sbjct  981  DVASKFASMKLG  992



>gb|KDO52981.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=972

 Score =   126 bits (316),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 96/191 (50%), Positives = 123/191 (64%), Gaps = 30/191 (16%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SLLE                              + +V +A+K++A 
Sbjct  811  LEKEVDDASKIEGSLLE------------------------------KNQVRKAQKKVAE  840

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQKG+ V++FSTDE
Sbjct  841  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQKGMPVMVFSTDE  900

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +VCAGVPEK D  KQL V EWL AAL+PL G+ G GKGGLA GQ +D   V  AM
Sbjct  901  TTNKAVVCAGVPEKSDQSKQLEVSEWLTAALQPLKGRCGKGKGGLASGQGTDAAQVTPAM  960

Query  218  DLAASFASIKL  186
            DLAA FA++KL
Sbjct  961  DLAAEFAAMKL  971



>emb|CDY29328.1| BnaA05g15950D [Brassica napus]
Length=928

 Score =   126 bits (316),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 130/192 (68%), Gaps = 11/192 (6%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            + K++ EA+    + LE+KV  L   V+   IPAAK+ ++K ++++LQ  V +A+K+IA 
Sbjct  748  ISKEVDEASKAVGNALEKKVNALKRRVDEVDIPAAKRADIKAKIAQLQNEVRKAQKKIAK  807

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   +V+ A+E AE+A S GK +CI++L +GLD AAVR+AV KVM++KG++V++FSTDE
Sbjct  808  ENLKKSVEIATEAAESAASDGKNFCIVQLDVGLDAAAVREAVSKVMQKKGMSVMVFSTDE  867

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK            V KQL V EWL  AL P+ GK G GK GLA GQ +D   V  A+
Sbjct  868  STNKA-----------VFKQLDVTEWLTTALSPIKGKCGKGKSGLASGQGTDASQVSSAL  916

Query  218  DLAASFASIKLS  183
            DLAASFAS+KL+
Sbjct  917  DLAASFASMKLN  928



>gb|KJB50037.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1070

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  819  LLQEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAE  878

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V++FS DE
Sbjct  879  QNMQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDE  938

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  300
              NK +V AGVPEK +  K+L V EWL  AL P
Sbjct  939  TTNKAVVYAGVPEKSESIKRLEVSEWLTKALGP  971


 Score = 69.7 bits (169),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 58/81 (72%), Gaps = 0/81 (0%)
 Frame = -1

Query  428   IAVLIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqA  249
             + V++FS DE  NK +V AGVPEK +  K+L V EWL  AL PL GK G GKGGLA GQ 
Sbjct  989   MPVMVFSIDETTNKAVVYAGVPEKSESIKRLEVSEWLTKALGPLKGKCGRGKGGLATGQG  1048

Query  248   SDLKHVDEAMDLAASFASIKL  186
             +D   V+EA+DLA SFAS+KL
Sbjct  1049  TDASRVNEAIDLATSFASMKL  1069



>gb|KJB50041.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=997

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  819  LLQEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAE  878

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V++FS DE
Sbjct  879  QNMQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDE  938

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  300
              NK +V AGVPEK +  K+L V EWL  AL P
Sbjct  939  TTNKAVVYAGVPEKSESIKRLEVSEWLTKALGP  971



>gb|KJB50039.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=1001

 Score =   124 bits (310),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 109/153 (71%), Gaps = 0/153 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  819  LLQEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAE  878

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            +N   AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK + V++FS DE
Sbjct  879  QNMQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQKEMPVMVFSIDE  938

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  300
              NK +V AGVPEK +  K+L V EWL  AL P
Sbjct  939  TTNKAVVYAGVPEKSESIKRLEVSEWLTKALGP  971



>gb|EPS72880.1| hypothetical protein M569_01869, partial [Genlisea aurea]
Length=950

 Score =   123 bits (309),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 131/191 (69%), Gaps = 4/191 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LE+++ EA   E S+LE+KV +LN+ V  A I ++KK +LK +LS LQ++V++ KK+IA 
Sbjct  764  LEQEVNEAFDAEGSILEQKVASLNSRVASAAISSSKKADLKAKLSVLQSQVLKEKKKIAE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             N   AV AA++ AE A S GK +CI  + +G DT A+R+AV+KVM+ KG+AV++FS DE
Sbjct  824  ANMQKAVDAATKTAEIASSNGKNFCISVVEVGSDTTAIREAVIKVMDDKGMAVMVFSKDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             ANK  VCAG+PE+     +LS  EWL   L+ L    GGGKG +AQGQ S    ++ A+
Sbjct  884  EANKAFVCAGIPEQ---LSELSPAEWLKEVLE-LINGKGGGKGSVAQGQGSYASGIESAV  939

Query  218  DLAASFASIKL  186
            D+A  FA++KL
Sbjct  940  DVAEKFAALKL  950



>ref|XP_008778009.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778010.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778012.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778013.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
 ref|XP_008778014.1| PREDICTED: alanine--tRNA ligase-like [Phoenix dactylifera]
Length=991

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 101/192 (53%), Positives = 136/192 (71%), Gaps = 3/192 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L  +I  A     SLLE+KV +L   ++ A IPAA K +L+ ++S+L+ +V +AKK++  
Sbjct  802  LASEISGAPKFGGSLLEKKVASLKNKIDAAAIPAAMKADLRVKVSQLEDQVRKAKKKMGE  861

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A+KAA+E+AE+A S GKA+CI R+ +GLDT A+R+AV+KVM+QKG+A ++FSTDE
Sbjct  862  ENIQKAIKAATEIAESAASEGKAFCISRVDVGLDTTAIREAVLKVMDQKGLATMVFSTDE  921

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
              NK +V AGVP+  D    L V EWL  A+ PL GKGGGGK G AQGQ SD   V EAM
Sbjct  922  TLNKAVVYAGVPKSRD---GLVVLEWLTTAMGPLKGKGGGGKNGTAQGQGSDASRVAEAM  978

Query  218  DLAASFASIKLS  183
            D+A+ FAS+KL 
Sbjct  979  DVASKFASMKLG  990



>emb|CDY42520.1| BnaC06g03380D [Brassica napus]
Length=947

 Score =   119 bits (298),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 86/112 (77%), Gaps = 0/112 (0%)
 Frame = -1

Query  518  GKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDEAANKVLVCAGVPEKGDVCKQ  339
            GK +CI++L +GLD AAVR+AV KVME+KG+++++FSTDE  NK +VCAGVP+K D  KQ
Sbjct  836  GKTFCIIQLDVGLDAAAVREAVSKVMEKKGMSIMVFSTDETTNKAVVCAGVPDKSDEFKQ  895

Query  338  LSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKLS  183
            L V EWL  AL PL G+ G GK GLA GQ +D   V  A+DLAASFAS+KL+
Sbjct  896  LDVTEWLTTALGPLKGRCGKGKSGLASGQGTDASQVKAALDLAASFASMKLN  947



>gb|KFK23692.1| hypothetical protein AALP_AAs48168U000100, partial [Arabis alpina]
Length=796

 Score =   118 bits (295),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 85/194 (44%), Positives = 120/194 (62%), Gaps = 3/194 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L+ ++ +A   E+  LEEKV +L    + A I    K  +KR+L  LQ  V +A+K+ A 
Sbjct  603  LKGELYDALIAEEFELEEKVNSLERRCDEAVISPDIKAGIKRKLVGLQNEVRKAQKKRAQ  662

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             N   AV+ A+E AE+A S GK +C++++ IGLD  AVR AV++VME+KG+++++ S DE
Sbjct  663  LNLKRAVELATEAAESATSEGKTFCVVKVDIGLDIVAVRAAVLQVMEKKGMSIMVLSADE  722

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqAS---DLKHVD  228
              NKV VCAGVPEK D  ++L V EW N A+ P+ GKG G         +    D   +D
Sbjct  723  TTNKVDVCAGVPEKSDQFRKLDVIEWFNTAMAPINGKGKGKDKDKDGRVSGQGMDASQLD  782

Query  227  EAMDLAASFASIKL  186
             A DLA SFAS+KL
Sbjct  783  AAFDLAVSFASLKL  796



>ref|XP_006662230.1| PREDICTED: alanine--tRNA ligase-like, partial [Oryza brachyantha]
Length=898

 Score =   118 bits (296),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 84/191 (44%), Positives = 130/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++  I EA+ +E +LLE+ + ++ + ++ A IPAA+K +LK  + KL+  + +AKK++  
Sbjct  709  IDSDINEASKLEGALLEKNIASIKSKLDTAPIPAARKADLKARVLKLEDELRKAKKKMGE  768

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   A+K A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + +++FSTDE
Sbjct  769  ENMQKAIKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDE  828

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            A NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ SD   + EAM
Sbjct  829  ATNKAVIYAGVPPS--ATNSLKVLDWLTPSIVPLKGKGGGGKNGVAQGQGSDASQIKEAM  886

Query  218  DLAASFASIKL  186
            +LA   AS+KL
Sbjct  887  ELATQIASLKL  897



>gb|AAK70636.1|AC091238_14 Putative cytosolic tRNA-Ala synthetase [Oryza sativa Japonica 
Group]
Length=694

 Score =   114 bits (286),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++ +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  
Sbjct  505  IDSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGE  564

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + +++FSTDE
Sbjct  565  ENIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDE  624

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            A NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM
Sbjct  625  ATNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAM  682

Query  218  DLAASFASIKL  186
            ++A   AS+KL
Sbjct  683  EVATQIASMKL  693



>ref|XP_003571715.1| PREDICTED: LOW QUALITY PROTEIN: alanine--tRNA ligase [Brachypodium 
distachyon]
Length=993

 Score =   114 bits (286),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 86/193 (45%), Positives = 135/193 (70%), Gaps = 3/193 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++  I EA+ +E ++LE+K+ ++  +++ A IPAA+K +L+ +++KL+ ++ +AKK++  
Sbjct  803  IDADIDEASKLEGAILEKKIASIKNTLDAASIPAARKADLRGKVTKLEDQLRKAKKKMGD  862

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFSTD  402
            EN   AVK A + AEAA+S GK +C+  + +GLDT AVR+AVVK M + K + +++FS+D
Sbjct  863  ENIQKAVKTAIDAAEAALSDGKPFCVAHVDVGLDTTAVREAVVKAMNRFKSLPIMLFSSD  922

Query  401  EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
            EA+NK ++ AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   + EA
Sbjct  923  EASNKAVIYAGVPP--DAPDGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASQLKEA  980

Query  221  MDLAASFASIKLS  183
            M+LA   AS+KL+
Sbjct  981  MELATQIASMKLN  993



>gb|EEC66648.1| hypothetical protein OsI_32912 [Oryza sativa Indica Group]
Length=953

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++ +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  
Sbjct  764  IDSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGE  823

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + +++FSTDE
Sbjct  824  ENIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDE  883

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            A NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM
Sbjct  884  ATNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAM  941

Query  218  DLAASFASIKL  186
            ++A   AS+KL
Sbjct  942  EVATQIASMKL  952



>ref|NP_001064254.1| Os10g0182000 [Oryza sativa Japonica Group]
 gb|ABG65948.1| Alanyl-tRNA synthetase, mitochondrial precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26168.1| Os10g0182000 [Oryza sativa Japonica Group]
 dbj|BAG89937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=999

 Score =   114 bits (286),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++ +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  
Sbjct  810  IDSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGE  869

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + +++FSTDE
Sbjct  870  ENIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDE  929

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            A NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM
Sbjct  930  ATNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAM  987

Query  218  DLAASFASIKL  186
            ++A   AS+KL
Sbjct  988  EVATQIASMKL  998



>gb|EEE50661.1| hypothetical protein OsJ_30891 [Oryza sativa Japonica Group]
Length=901

 Score =   114 bits (285),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 82/191 (43%), Positives = 132/191 (69%), Gaps = 2/191 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++ +I EA+ +E ++LE+ + ++ + ++ A IPAA+K +LK  +SKL+  + +AKK++  
Sbjct  712  IDSEINEASKLEGAILEKTIASIKSKLDTALIPAARKADLKGRVSKLEDELRKAKKKMGE  771

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
            EN   AVK A + A+ A+S GK +C+  + +GLDT+A+R+AV+KV +QK + +++FSTDE
Sbjct  772  ENIQKAVKFAIDAAQTALSEGKRFCVAHVDVGLDTSAIREAVIKVKDQKDLPIMLFSTDE  831

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            A NK ++ AGVP        L V +WL  ++ PL GKGGGGK G+AQGQ ++   + EAM
Sbjct  832  ATNKAVIYAGVPPS--AANSLKVLDWLTPSIAPLKGKGGGGKNGIAQGQGTEASQLKEAM  889

Query  218  DLAASFASIKL  186
            ++A   AS+KL
Sbjct  890  EVATQIASMKL  900



>ref|XP_002443089.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
 gb|EES16927.1| hypothetical protein SORBIDRAFT_08g008230 [Sorghum bicolor]
Length=1006

 Score =   113 bits (282),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 138/192 (72%), Gaps = 2/192 (1%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             ++  I EA+ +E +LLE+K+ ++ + ++ A IPAAKK +L+ ++SKL+  + +AKK++  
Sbjct  817   IDSDINEASQLEGALLEKKIASIKSGLDAAAIPAAKKADLRGKVSKLEDELRKAKKKMGE  876

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   AVK+A + AEAA+SG K +C+  + +GLDT AVR+AV+KVM++KG+ +++FSTDE
Sbjct  877   QNIQKAVKSAMDAAEAALSGNKLFCVTHVDVGLDTTAVREAVIKVMDKKGLPIMLFSTDE  936

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             A+NK ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM
Sbjct  937   ASNKAVIYAGVPP--NAPNGFKVLDWLTPSIAPLKGRGGGGKNGIAQGQGSDASQLKEAM  994

Query  218   DLAASFASIKLS  183
              LA S AS+KLS
Sbjct  995   ALANSIASMKLS  1006



>ref|XP_008662576.1| PREDICTED: alanine--tRNA ligase [Zea mays]
 gb|AFW56406.1| hypothetical protein ZEAMMB73_266824 [Zea mays]
Length=1002

 Score =   112 bits (280),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 88/191 (46%), Positives = 137/191 (72%), Gaps = 2/191 (1%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             ++  I +A+ +E +LLE+K+ ++ + ++ A IPAA+K +L+ ++SKL+  + +AKK++  
Sbjct  813   IDSDINKASQLEGALLEKKIASIKSGLDAAAIPAARKADLRGKVSKLEDELRKAKKKMGE  872

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
             +N   AVK+A + AEAA+SG K +C+  + +GLDT AVR+AV+KVM+QKG+ +++FSTDE
Sbjct  873   QNIQKAVKSAMDAAEAALSGNKPFCVTHVDVGLDTTAVREAVIKVMDQKGLPIMLFSTDE  932

Query  398   AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
             A+NK ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM
Sbjct  933   ASNKAVIYAGVPP--NAPSGFKVLDWLTPSIAPLKGRGGGGKNGVAQGQGSDASQLKEAM  990

Query  218   DLAASFASIKL  186
              LA S AS+KL
Sbjct  991   ALANSIASMKL  1001



>ref|XP_008350821.1| PREDICTED: alanine--tRNA ligase-like [Malus domestica]
Length=133

 Score =   101 bits (252),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = -1

Query  518  GKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDEAANKVLVCAGVPEKGDVCKQ  339
            GKAYC+ ++ +GLD AAVR+AV+K+    GI  ++FSTDE  NK LVCAGVP  GD   Q
Sbjct  25   GKAYCVSQVDVGLDAAAVREAVLKITGM-GIPAMVFSTDETTNKALVCAGVP--GDKGTQ  81

Query  338  LSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKL  186
            L V EWL AA+ PL G+ G GKGGLA GQ +D   ++EA+DLA SFA +KL
Sbjct  82   LEVSEWLTAAMGPLNGRCGKGKGGLASGQGTDASRLNEAIDLATSFAQMKL  132



>ref|XP_006826671.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
 gb|ERM93908.1| hypothetical protein AMTR_s00137p00047050 [Amborella trichopoda]
Length=996

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 139/193 (72%), Gaps = 2/193 (1%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L+++I EA+  E SLLE+KV +L + ++ A IPAA K +L+  +S+LQ +V +A+K+IA 
Sbjct  805  LDEEINEASMGEGSLLEKKVASLKSRLDAAAIPAAMKADLRARISQLQDQVRKAQKQIAE  864

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME-QKGIAVLIFSTD  402
             N   A+KAA E+AE A S GK +C+ ++ +GLDT+AVR+AVVKV+E QKGI ++I STD
Sbjct  865  GNLQKAIKAAIEIAETAASEGKPFCVAQIDVGLDTSAVREAVVKVLEKQKGIPIMIISTD  924

Query  401  EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
              +NK +V  GVP+  +  K L   EWL  ALKPL GKGGGGKGG+AQGQ SD   V +A
Sbjct  925  ATSNKAVVYTGVPDTVEK-KGLLPLEWLRTALKPLKGKGGGGKGGIAQGQGSDASRVTDA  983

Query  221  MDLAASFASIKLS  183
            ++ A +FA +KLS
Sbjct  984  LEAAENFAKMKLS  996



>gb|EMT00983.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=712

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            +E  I EA+ ++ + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  
Sbjct  522  IETDINEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLKGNVSKLEDQLREAKKKMGK  581

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFSTD  402
            EN   AVK A + AEAAVS GK +C++   +GLDT AVR+AVVK M++ KG+ +++FSTD
Sbjct  582  ENIQKAVKTAIDAAEAAVSEGKPFCVIHADVGLDTTAVREAVVKAMDRFKGLPIMVFSTD  641

Query  401  EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
            EA+NK ++ AGVP   D      V +WL  ++ PL GKGGGGK GLAQGQ SD   V EA
Sbjct  642  EASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGKGGGGKNGLAQGQGSDGSRVKEA  699

Query  221  MDLAASFASIKLS  183
            M+LA   AS+KL 
Sbjct  700  MELATQIASMKLG  712



>dbj|BAJ98134.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1004

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 134/193 (69%), Gaps = 3/193 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             ++  I EA+ ++ + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  
Sbjct  814   IDSDINEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLKGNVSKLEEQLREAKKKMGK  873

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFSTD  402
             EN   AVK A + AEAAVS GK +C+    +GLDT AVR+AVVK M++ KG+ +++FSTD
Sbjct  874   ENIQKAVKTAIDAAEAAVSEGKPFCVTHADVGLDTTAVREAVVKAMDRFKGLPIMVFSTD  933

Query  401   EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
             EA+NK ++ AGVP   D      V +WL  ++ PL GKGGGGK GLAQGQ SD   V EA
Sbjct  934   EASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGKGGGGKNGLAQGQGSDASRVKEA  991

Query  221   MDLAASFASIKLS  183
             M+LA   AS+KLS
Sbjct  992   MELATQIASMKLS  1004



>gb|EMT18589.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1012

 Score =   108 bits (269),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 133/193 (69%), Gaps = 3/193 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             ++  I EA+ +E + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  
Sbjct  822   IDTDINEASKLEGATLEKKIGSIKNTLDAAAIPAARKADLKGNISKLEDQLRKAKKKMGE  881

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFSTD  402
             EN   AVK A + AEAA+S GK +C+    +GLDT AVR+AVVK M + KG+ +++FSTD
Sbjct  882   ENIQKAVKIAIDAAEAALSEGKTFCVTHADVGLDTTAVREAVVKAMNRFKGLPIMVFSTD  941

Query  401   EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
             EA+NK ++ AGVP   D      V +WL  ++ PL GKGGGGK GLAQGQ SD   V EA
Sbjct  942   EASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGKGGGGKNGLAQGQGSDASRVKEA  999

Query  221   MDLAASFASIKLS  183
             M+LA   AS+KLS
Sbjct  1000  MELATQIASMKLS  1012



>dbj|BAJ92565.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++  I EA+ ++ + LE+K+ ++  +++ A IPAA+K +L+  +SKL+ ++ +AKK++  
Sbjct  115  IDTDINEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLRGNISKLEDQLRKAKKKMGE  174

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFSTD  402
            EN   AVK   + AEA +S GK +C+  + +GLDT AVR+AVVK M + K + +++FSTD
Sbjct  175  ENIQKAVKTVIDAAEATLSEGKPFCVAHVDVGLDTTAVREAVVKAMNRFKSLPIMVFSTD  234

Query  401  EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
            EA+NK ++ AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   V EA
Sbjct  235  EASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASRVKEA  292

Query  221  MDLAASFASIKLS  183
            M+LA   AS+KLS
Sbjct  293  MELATQIASMKLS  305



>ref|XP_001773539.1| predicted protein [Physcomitrella patens]
 gb|EDQ61577.1| predicted protein [Physcomitrella patens]
Length=937

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 4/155 (3%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
               +I +A+ +E   LE++V +L  S+E   IPAAKK E +  L +LQ R+ +A+K  A 
Sbjct  758  FSSQIDKASKLEGPALEKEVASLKNSLENVVIPAAKKAEFRTRLGELQERIRKAQKAAAG  817

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME-QKGIAVLIFSTD  402
             N   A+  A   A+ AV+  + +C+LR+ +GLDT AVR+AV  VME  K +AV+IFS D
Sbjct  818  SNLQTALNGAVSSADTAVAQNQPFCVLRIDVGLDTNAVREAVTLVMEKHKDLAVMIFSVD  877

Query  401  EAANKVLVCAGVPEKGDVCKQ-LSVKEWLNAALKP  300
            E  NKVLV AGVP+     KQ L V +WL  +L P
Sbjct  878  EQKNKVLVYAGVPDS--AAKQGLKVLDWLRGSLAP  910



>dbj|BAJ96541.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1008

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 87/193 (45%), Positives = 131/193 (68%), Gaps = 3/193 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             ++  I EA+ ++ + LE+K+ ++  +++ A IPAA+K +L+  +SKL+ ++ +AKK++  
Sbjct  818   IDTDINEASKLDGATLEKKIGSIKNTLDAAAIPAARKADLRGNISKLEDQLRKAKKKMGE  877

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFSTD  402
             EN   AVK   + AEA +S GK +C+  + +GLDT AVR+AVVK M + K + +++FSTD
Sbjct  878   ENIQKAVKTVIDAAEATLSEGKPFCVAHVDVGLDTTAVREAVVKAMNRFKSLPIMVFSTD  937

Query  401   EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
             EA+NK ++ AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   V EA
Sbjct  938   EASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASRVKEA  995

Query  221   MDLAASFASIKLS  183
             M+LA   AS+KLS
Sbjct  996   MELATQIASMKLS  1008



>ref|XP_004983349.1| PREDICTED: alanine--tRNA ligase-like isoform X2 [Setaria italica]
Length=1005

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  746   IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  567
             I  A+ +E ++LE+K+ ++   ++ A IPAA+K +L+ ++SKL+ ++ +AKK++  +N  
Sbjct  820   ISGASQLEGAMLEKKIASIKNKLDAAAIPAARKADLRGKVSKLEDQLRKAKKKMGEQNIQ  879

Query  566   NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDEAANK  387
              AVK A + AEAA+   K +C+  + +GLDT AVR+AV+KVM+QKG+ +++FS DEA+NK
Sbjct  880   KAVKTAMDAAEAALFKKKPFCVTHVDVGLDTTAVREAVIKVMDQKGLPIMLFSKDEASNK  939

Query  386   VLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAA  207
              ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM+LA 
Sbjct  940   AVIYAGVPP--NTPNGFKVLDWLTPSIAPLKGRGGGGKNGVAQGQGSDASQLKEAMELAN  997

Query  206   SFASIKLS  183
             + A++KLS
Sbjct  998   NIAAMKLS  1005



>ref|XP_004983350.1| PREDICTED: alanine--tRNA ligase-like isoform X3 [Setaria italica]
Length=1005

 Score =   102 bits (255),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 132/188 (70%), Gaps = 2/188 (1%)
 Frame = -1

Query  746   IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  567
             I  A+ +E ++LE+K+ ++   ++ A IPAA+K +L+ ++SKL+ ++ +AKK++  +N  
Sbjct  820   ISGASQLEGAMLEKKIASIKNKLDAAAIPAARKADLRGKVSKLEDQLRKAKKKMGEQNIQ  879

Query  566   NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDEAANK  387
              AVK A + AEAA+   K +C+  + +GLDT AVR+AV+KVM+QKG+ +++FS DEA+NK
Sbjct  880   KAVKTAMDAAEAALFKKKPFCVTHVDVGLDTTAVREAVIKVMDQKGLPIMLFSKDEASNK  939

Query  386   VLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAA  207
              ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQGQ SD   + EAM+LA 
Sbjct  940   AVIYAGVPP--NTPNGFKVLDWLTPSIAPLKGRGGGGKNGVAQGQGSDASQLKEAMELAN  997

Query  206   SFASIKLS  183
             + A++KLS
Sbjct  998   NIAAMKLS  1005



>gb|EMT07345.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=949

 Score =   100 bits (250),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 92/194 (47%), Positives = 132/194 (68%), Gaps = 4/194 (2%)
 Frame = -1

Query  758  LEKKIKEAASVED-SLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIA  582
            +E  I EA+ + D + LE+K+ ++  +++ A IPAA+K +L+  +SKL+ ++ +AKK++ 
Sbjct  758  IETDINEASKLLDGATLEKKIGSIKNTLDAAAIPAARKADLRGNISKLEDQLRKAKKKMG  817

Query  581  AENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFST  405
             EN   AVK A + AEAAVS GK +C+ R  +GLDT AVR+AVVK M + K + V++FS 
Sbjct  818  EENIQKAVKTAMDAAEAAVSQGKPFCVTRADVGLDTTAVREAVVKAMNRFKSLPVMVFSI  877

Query  404  DEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDE  225
            DE++NK +V AGVP   D      V +WL  ++ PL G+GGGGK GLAQGQ SD   V E
Sbjct  878  DESSNKAVVYAGVPP--DAPNGFKVLDWLTPSIAPLKGRGGGGKNGLAQGQGSDASRVQE  935

Query  224  AMDLAASFASIKLS  183
            AM++A   AS+KLS
Sbjct  936  AMEIATQIASMKLS  949



>gb|EMS67609.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=1858

 Score = 97.4 bits (241),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 66/154 (43%), Positives = 104/154 (68%), Gaps = 3/154 (2%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            ++  I EA+ +E + LE+K+ ++  +++ A IPAA+K +LK  +SKL+ ++ +AKK++  
Sbjct  822  IDTDINEASKLEGATLEKKIGSIKNTLDAAAIPAARKADLKGNISKLEDQLRKAKKKMGE  881

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIFSTD  402
            EN   AVK A + AEAA+S GK +C+    +GLDT AVR+AVVK M + KG+ +++FSTD
Sbjct  882  ENIQKAVKIAIDAAEAALSEGKTFCVTHADVGLDTTAVREAVVKAMNRFKGLPIMVFSTD  941

Query  401  EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKP  300
            EA+NK ++ AGVP   D      V +WL  ++ P
Sbjct  942  EASNKAVIYAGVPP--DAPNGFKVLDWLTPSIAP  973



>ref|XP_004983348.1| PREDICTED: alanine--tRNA ligase-like isoform X1 [Setaria italica]
Length=1022

 Score = 93.6 bits (231),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 84/205 (41%), Positives = 132/205 (64%), Gaps = 19/205 (9%)
 Frame = -1

Query  746   IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKL-----------------  618
             I  A+ +E ++LE+K+ ++   ++ A IPAA+K +L+ ++SKL                 
Sbjct  820   ISGASQLEGAMLEKKIASIKNKLDAAAIPAARKADLRGKVSKLEVCKCFFFTSDCVCCMS  879

Query  617   QTRVIQAKKRIAAENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME  438
             Q ++ +AKK++  +N   AVK A + AEAA+   K +C+  + +GLDT AVR+AV+KVM+
Sbjct  880   QDQLRKAKKKMGEQNIQKAVKTAMDAAEAALFKKKPFCVTHVDVGLDTTAVREAVIKVMD  939

Query  437   QKGIAVLIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaq  258
             QKG+ +++FS DEA+NK ++ AGVP   +      V +WL  ++ PL G+GGGGK G+AQ
Sbjct  940   QKGLPIMLFSKDEASNKAVIYAGVPP--NTPNGFKVLDWLTPSIAPLKGRGGGGKNGVAQ  997

Query  257   gqASDLKHVDEAMDLAASFASIKLS  183
             GQ SD   + EAM+LA + A++KLS
Sbjct  998   GQGSDASQLKEAMELANNIAAMKLS  1022



>emb|CDY46263.1| BnaC05g50520D [Brassica napus]
Length=651

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 98/192 (51%), Gaps = 51/192 (27%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK + + +    + LE+KV  L   V+   IPAAK+ ++K ++++LQ            
Sbjct  511  LEKDVDDTSKAVGNALEKKVNALKRRVDEVDIPAAKRADIKAKIAQLQ------------  558

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDE  399
                                        L +G D AAVR AV KVM++KG++V++FSTDE
Sbjct  559  ----------------------------LDVGFDAAAVRGAVSKVMQKKGMSVMVFSTDE  590

Query  398  AANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAM  219
            + NK            V KQL V EWL  AL P+ GK G GK GLA GQ +D   V  A+
Sbjct  591  STNKA-----------VFKQLDVTEWLTIALSPIKGKCGKGKSGLASGQGTDASQVSSAL  639

Query  218  DLAASFASIKLS  183
            DLAASFAS+ L+
Sbjct  640  DLAASFASMNLN  651



>emb|CDY69088.1| BnaCnng61840D [Brassica napus]
Length=108

 Score = 79.3 bits (194),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = -1

Query  431  GIAVLIFSTDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgq  252
            G+++++FSTDE  NK +VCAGVP+K D  KQL V EWL  AL PL G+ G GK GLA GQ
Sbjct  26   GMSIMVFSTDETTNKAVVCAGVPDKSDEFKQLDVTEWLTTALGPLKGRCGKGKSGLASGQ  85

Query  251  ASDLKHVDEAMDLAASFASIKLS  183
             +D   V  A+DLAASFAS+KL+
Sbjct  86   GTDASQVKAALDLAASFASMKLN  108



>ref|XP_001769326.1| predicted protein [Physcomitrella patens]
 gb|EDQ65880.1| predicted protein, partial [Physcomitrella patens]
Length=222

 Score = 80.5 bits (197),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 89/155 (57%), Gaps = 4/155 (3%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
               +I +A  ++ + L+++V+ L   +E A +PAAKK E +   S+LQ  + QA+K   A
Sbjct  46   FSAQIDDANKMQGAALKKEVSALKNLLETAILPAAKKAEFRGRFSELQEGIKQAQKSAGA  105

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVME-QKGIAVLIFSTD  402
             +    +  A   A+ AV+  + YC+LR+  GLD  AVR+A   V+E  K +AV++FS D
Sbjct  106  ASLQLKLNEAVTSADVAVALCQEYCVLRIDDGLDANAVREAASLVIEKHKYLAVMLFSVD  165

Query  401  EAANKVLVCAGVPEKGDVCKQ-LSVKEWLNAALKP  300
            E  NKVL+CA VP      KQ L   +WL  +L P
Sbjct  166  EQRNKVLICAFVPNSA--AKQGLGALDWLQGSLVP  198



>gb|KDO52984.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=957

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  811  LEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  870

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  432
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQK
Sbjct  871  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQK  919



>gb|KDO52985.1| hypothetical protein CISIN_1g001826mg [Citrus sinensis]
Length=936

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 82/109 (75%), Gaps = 0/109 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            LEK++ +A+ +E SLLE+ V +L + V+ A IPA KK +++ +++ LQ +V +A+K++A 
Sbjct  811  LEKEVDDASKIEGSLLEKTVASLKSKVDGAAIPAPKKADIRAKIALLQNQVRKAQKKVAE  870

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  432
            EN   AVK A+E AEAA S GK +CI R+ +GLD AAVR+AV+KV+EQK
Sbjct  871  ENLQKAVKVATETAEAAASNGKPFCISRVEVGLDAAAVREAVLKVIEQK  919



>gb|KJB50034.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=927

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  819  LLQEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAE  878

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  432
            +N   AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK
Sbjct  879  QNMQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQK  927



>gb|KJB50035.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=930

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  819  LLQEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAE  878

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  432
            +N   AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK
Sbjct  879  QNMQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQK  927



>gb|KJB50038.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
 gb|KJB50040.1| hypothetical protein B456_008G149700 [Gossypium raimondii]
Length=941

 Score = 77.8 bits (190),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = -1

Query  758  LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
            L +++ +A+ +E +LLE+KV +L  SV+ A IPAAKK +++ ++++LQ ++ +A+K+IA 
Sbjct  819  LLQEVDDASKMEVNLLEKKVASLKTSVDSASIPAAKKADIRAKIAQLQNQLKKAQKKIAE  878

Query  578  ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQK  432
            +N   AV  A E+AE A   GK +CI R+ +GLD AA+R+AV KV++QK
Sbjct  879  QNMQKAVTIAIELAELAAKEGKTFCISRIDVGLDAAALREAVSKVIQQK  927



>ref|XP_002462563.1| hypothetical protein SORBIDRAFT_02g028270 [Sorghum bicolor]
 gb|EER99084.1| hypothetical protein SORBIDRAFT_02g028270 [Sorghum bicolor]
Length=105

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 10/74 (14%)
 Frame = -1

Query  521  GGKAYCILRLGIGLDTAAVRDAVVKVMEQKGIAVLIFSTDEAANKVLVCAGVPEKGDVCK  342
            G K +C+  + +GLDT+AVR+AV+KVM+Q        ST+EA+NK  + AGVP   +   
Sbjct  23   GNKLFCVTHVNVGLDTSAVREAVIKVMDQ--------STEEASNKAAIYAGVPP--NAPS  72

Query  341  QLSVKEWLNAALKP  300
               V +WL  ++ P
Sbjct  73   GFKVLDWLTPSIAP  86



>emb|CCI40732.1| unnamed protein product [Albugo candida]
Length=1362

 Score = 62.4 bits (150),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 58/192 (30%), Positives = 100/192 (52%), Gaps = 5/192 (3%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             L++++     ++DS     VT     ++ A I    KD+L++EL  L  RV   KK+ AA
Sbjct  837   LQRQLDCIKQMQDSDFIANVTAFRPILDVALISLPLKDQLRKELDVLVDRVKALKKKEAA  896

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRD---AVVKVMEQKGIAVLIFS  408
               + +A+K A +  +        + + R+  G D    R+   A+ +V+ +   + ++FS
Sbjct  897   LRAADAIKNAIKQVKETREKSSEFLVARMQAGTDVKLGREILAAMSRVLPEG--SFMVFS  954

Query  407   TDEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVD  228
             TD+ ANK      V +     KQL  ++W+N A+KP+ GKGGG     A GQA  ++H++
Sbjct  955   TDDDANKTAAFCQVSQHHADKKQLDARQWVNEAMKPMNGKGGGKSALNANGQAKTIEHIE  1014

Query  227   EAMDLAASFASI  192
              A+ +A SF  +
Sbjct  1015  VAIAIAESFLPV  1026



>emb|CCA14233.1| unnamed protein product [Albugo laibachii Nc14]
Length=1022

 Score = 61.2 bits (147),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 57/188 (30%), Positives = 96/188 (51%), Gaps = 3/188 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             L+K++    +++DS     VT     ++ + I    KD L++EL  L  RV   KK+ AA
Sbjct  834   LQKQLDCIKAMQDSDFIANVTAFRPILDASLISLPLKDHLRKELEVLVDRVKTLKKKEAA  893

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ--KGIAVLIFST  405
               + +A+  A +  + A      + + R+  G D    R+ +  +     +G + ++FST
Sbjct  894   LRAADAITQAIKQVKEAQEKSTKFVVARMQAGTDVKLGREILAAMSNALPEG-SFMVFST  952

Query  404   DEAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDE  225
             D+ A K      V +     KQL  ++W+N A+KP+ GKGGG     A GQA  + H++E
Sbjct  953   DDDAKKTAAFCQVSQHHADTKQLDARQWVNEAMKPMNGKGGGKSALNANGQAKIMDHIEE  1012

Query  224   AMDLAASF  201
             AM +A S+
Sbjct  1013  AMAIAESY  1020



>ref|XP_005849315.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
 gb|EFN57213.1| hypothetical protein CHLNCDRAFT_143654 [Chlorella variabilis]
Length=524

 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 63/177 (36%), Positives = 98/177 (55%), Gaps = 6/177 (3%)
 Frame = -1

Query  713  LEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSLNavkaasemae  534
            ++ +V  L  +V  A IP  +K  L   L  L   +++ +K+ AA N   AV AA + ++
Sbjct  353  MQGEVKALTQAVSGAVIPTVRKAALAEALQGLTRLILEEQKKAAAANKERAVAAAVDASD  412

Query  533  aavSGGKAYCILRLGIGLDTAAVRDAVVKVME-QKGIAVLIFSTDEAANKVLVCAGVPEK  357
            AA + G+ + + RL +GLD  AV++A   + +    + V+  +  E  +K L  AGVP+ 
Sbjct  413  AAAAAGQKFLVTRLDVGLDAKAVQEAWNAIQKKHPSLPVMFLTAGE--DKALAYAGVPQ-  469

Query  356  GDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEAMDLAASFASIKL  186
             D+ KQLS  +W+   +    G  GGGK   AQG   ++  VDEA+  AASFAS+KL
Sbjct  470  -DISKQLSAGDWIKE-VLGTLGGRGGGKPTNAQGTGPEVGKVDEALQAAASFASMKL  524



>ref|XP_002950616.1| hypothetical protein VOLCADRAFT_120886 [Volvox carteri f. nagariensis]
 gb|EFJ48362.1| hypothetical protein VOLCADRAFT_120886 [Volvox carteri f. nagariensis]
Length=1143

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 73/192 (38%), Positives = 106/192 (55%), Gaps = 4/192 (2%)
 Frame = -1

Query  758   LEKKIKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAA  579
             L+ ++   A++ +  LE+       SV+ A IPA  K  L+ EL+ L  RVI+ +K  AA
Sbjct  954   LKAELASIATLPEDQLEKACKGFKESVDAAVIPAVDKAALRDELAVLGRRVIEFQKAAAA  1013

Query  578   ENSLNavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVM-EQKGIAVLIFSTD  402
              N   A + A   A+AAV+ GK++ I RL +GLDT AV +A   ++ +   +A L  S D
Sbjct  1014  ANKALAAERAVAAADAAVAAGKSFVIGRLDVGLDTRAVGEACSAIIAKHSTLAALFVSVD  1073

Query  401   EAANKVLVCAGVPEKGDVCKQLSVKEWLNAALKPlggkggggkgglaqgqASDLKHVDEA  222
                 K L  A VP+   V  +L   EW++ AL    G  GGGK   AQGQ ++++ VDEA
Sbjct  1074  AEKGKALAYAAVPDS--VTDRLKANEWVSTALG-PLGGKGGGKANNAQGQGANVEKVDEA  1130

Query  221   MDLAASFASIKL  186
             +  A +FA  KL
Sbjct  1131  LGAATAFAESKL  1142



>gb|EMS64427.1| Alanyl-tRNA synthetase [Triticum urartu]
Length=751

 Score = 56.6 bits (135),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 76/113 (67%), Gaps = 1/113 (1%)
 Frame = -1

Query  746  IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  567
            I EA+ ++ + LE+K+ ++N +++ A IPAA+K +LK  +SKL+ ++ +AKK+   EN  
Sbjct  197  INEASKLDGATLEKKIGSINNTLDAAAIPAARKADLKGNVSKLEDQLREAKKKTGKENVQ  256

Query  566  NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIF  411
             A K   + AEAAVS  K +C+   G+GLDT A R+AVVK M++ K I  L++
Sbjct  257  KAAKTDIDAAEAAVSKEKLFCVTHAGVGLDTTAAREAVVKPMDRFKSIDALLY  309



>gb|EMT09528.1| Alanyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=706

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 74/113 (65%), Gaps = 1/113 (1%)
 Frame = -1

Query  746  IKEAASVEDSLLEEKVTTLNASVERAQIPAAKKDELKRELSKLQTRVIQAKKRIAAENSL  567
            I EA  ++ + LE+K+ ++N +++ A IPAA+K +LK  +SKL+ ++ +A+K+   EN  
Sbjct  197  INEATKLDGATLEKKIGSINNTLDAAAIPAARKADLKGNVSKLEDQLREAEKKTGKENVQ  256

Query  566  NavkaasemaeaavSGGKAYCILRLGIGLDTAAVRDAVVKVMEQ-KGIAVLIF  411
             A K   + AEAAVS  K +C+    +GLDT A R+AVVK M++ K I  L++
Sbjct  257  KAAKTDIDAAEAAVSKEKLFCVTHADVGLDTTAAREAVVKPMDRFKSIDALLY  309



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1414353888260