BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037K11

Length=717
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                316   6e-102   Erythranthe guttata [common monkey flower]
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                315   9e-102   Erythranthe guttata [common monkey flower]
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             312   2e-100   Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    312   2e-100   Citrus sinensis [apfelsine]
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    311   4e-100   Solanum tuberosum [potatoes]
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    311   4e-100   Vitis vinifera
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    310   7e-100   Fragaria vesca subsp. vesca
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    311   9e-100   Populus euphratica
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    310   1e-99    Sesamum indicum [beniseed]
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    310   2e-99    Nicotiana sylvestris
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    309   5e-99    Solanum lycopersicum
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    307   1e-98    Ricinus communis
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  308   2e-98    Morus notabilis
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         307   2e-98    Jatropha curcas
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    307   3e-98    Nicotiana tomentosiformis
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    306   4e-98    Sesamum indicum [beniseed]
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          306   4e-98    Phaseolus vulgaris [French bean]
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    306   5e-98    Glycine max [soybeans]
ref|XP_002320868.1|  aspartyl protease family protein                   306   5e-98    Populus trichocarpa [western balsam poplar]
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             306   6e-98    Phaseolus vulgaris [French bean]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             306   7e-98    Phaseolus vulgaris [French bean]
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    306   1e-97    Populus euphratica
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                304   2e-97    Erythranthe guttata [common monkey flower]
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    304   2e-97    
ref|XP_002302634.2|  aspartyl protease family protein                   304   3e-97    Populus trichocarpa [western balsam poplar]
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    303   5e-97    Eucalyptus grandis [rose gum]
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             301   2e-96    
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    301   4e-96    Tarenaya hassleriana [spider flower]
emb|CDX90023.1|  BnaA10g00590D                                          301   6e-96    
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    300   8e-96    Glycine max [soybeans]
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    300   9e-96    Malus domestica [apple tree]
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    300   1e-95    Brassica rapa
emb|CDP08669.1|  unnamed protein product                                300   1e-95    Coffea canephora [robusta coffee]
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    300   1e-95    Arabis alpina [alpine rockcress]
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   2e-95    
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             301   2e-95    Phaseolus vulgaris [French bean]
emb|CDY15187.1|  BnaC05g00660D                                          298   6e-95    Brassica napus [oilseed rape]
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    297   9e-95    Glycine max [soybeans]
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    297   1e-94    Cucumis melo [Oriental melon]
gb|EPS66029.1|  hypothetical protein M569_08742                         296   1e-94    Genlisea aurea
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             297   1e-94    Eutrema salsugineum [saltwater cress]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    297   2e-94    Cucumis sativus [cucumbers]
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    297   2e-94    
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       298   2e-94    Cucumis sativus [cucumbers]
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   3e-94    
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    297   4e-94    
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    295   5e-94    Solanum lycopersicum
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   5e-94    
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    296   5e-94    Pyrus x bretschneideri [bai li]
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             294   2e-93    Medicago truncatula
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             294   3e-93    Capsella rubella
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    293   3e-93    Cucumis sativus [cucumbers]
gb|KJB09627.1|  hypothetical protein B456_001G154400                    291   3e-93    Gossypium raimondii
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    294   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    293   4e-93    Camelina sativa [gold-of-pleasure]
ref|XP_002892074.1|  aspartyl protease family protein                   293   8e-93    
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    291   2e-92    Solanum tuberosum [potatoes]
gb|KJB49569.1|  hypothetical protein B456_008G125700                    292   2e-92    Gossypium raimondii
gb|KJB09626.1|  hypothetical protein B456_001G154400                    291   4e-92    Gossypium raimondii
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    291   4e-92    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    291   5e-92    Camelina sativa [gold-of-pleasure]
ref|NP_171637.1|  aspartyl protease family protein                      290   1e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    290   4e-91    
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      286   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    281   5e-88    Tarenaya hassleriana [spider flower]
emb|CDX89133.1|  BnaA04g00530D                                          280   5e-88    
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    280   7e-88    Brassica rapa
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    279   1e-87    
ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    279   1e-87    Nicotiana sylvestris
ref|XP_002878415.1|  aspartyl protease family protein                   276   1e-86    
emb|CDY25081.1|  BnaC06g18230D                                          276   2e-86    Brassica napus [oilseed rape]
emb|CDY43952.1|  BnaC04g21580D                                          276   2e-86    Brassica napus [oilseed rape]
ref|NP_191741.1|  aspartyl protease                                     276   2e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    275   7e-86    Nelumbo nucifera [Indian lotus]
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    275   7e-86    Brassica rapa
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    275   7e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    275   8e-86    Camelina sativa [gold-of-pleasure]
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             275   1e-85    Eutrema salsugineum [saltwater cress]
emb|CDX67868.1|  BnaA07g19080D                                          274   2e-85    
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    274   2e-85    Arabis alpina [alpine rockcress]
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    273   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    258   7e-79    Elaeis guineensis
gb|ABK24467.1|  unknown                                                 256   2e-78    Picea sitchensis
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    251   2e-76    Phoenix dactylifera
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   3e-76    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    250   6e-76    Elaeis guineensis
ref|XP_008795461.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    241   2e-74    Phoenix dactylifera
dbj|BAF01866.1|  chloroplast nucleoid DNA binding protein like          227   1e-71    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    235   2e-70    Setaria italica
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          234   5e-70    Amborella trichopoda
ref|NP_001183392.1|  uncharacterized protein LOC100501808               228   3e-69    
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    231   1e-68    Brachypodium distachyon [annual false brome]
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358              229   5e-68    
ref|NP_001043485.1|  Os01g0598600                                       229   5e-68    
dbj|BAJ86414.1|  predicted protein                                      227   3e-67    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970          226   7e-67    
gb|EMS49734.1|  Aspartic proteinase nepenthesin-1                       221   1e-66    Triticum urartu
emb|CDM83204.1|  unnamed protein product                                222   2e-65    Triticum aestivum [Canadian hard winter wheat]
gb|ABK24255.1|  unknown                                                 219   2e-64    Picea sitchensis
ref|XP_001757102.1|  predicted protein                                  215   1e-63    
ref|XP_001759252.1|  predicted protein                                  213   5e-63    
gb|KJB09628.1|  hypothetical protein B456_001G154400                    211   8e-62    Gossypium raimondii
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...    211   2e-61    
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134              206   1e-60    
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135              206   1e-60    
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    208   3e-60    
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    208   4e-60    Fragaria vesca subsp. vesca
gb|EPS61272.1|  hypothetical protein M569_13524                         207   6e-60    Genlisea aurea
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    207   6e-60    Sesamum indicum [beniseed]
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    207   9e-60    
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g             207   1e-59    Populus trichocarpa [western balsam poplar]
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         207   1e-59    Jatropha curcas
gb|KCW48530.1|  hypothetical protein EUGRSUZ_K02206                     207   1e-59    Eucalyptus grandis [rose gum]
gb|AAT38006.1|  unknow protein                                          206   1e-59    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001056485.1|  Os05g0590000                                       206   1e-59    
gb|EAY99240.1|  hypothetical protein OsI_21202                          206   1e-59    Oryza sativa Indica Group [Indian rice]
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein            206   2e-59    Medicago truncatula
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              206   2e-59    
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    206   2e-59    Cicer arietinum [garbanzo]
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    206   2e-59    Nelumbo nucifera [Indian lotus]
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              203   4e-59    
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             205   4e-59    Citrus clementina [clementine]
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   205   4e-59    Citrus sinensis [apfelsine]
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    205   6e-59    Brassica rapa
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    205   7e-59    Citrus sinensis [apfelsine]
gb|KJB41527.1|  hypothetical protein B456_007G108800                    204   1e-58    Gossypium raimondii
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   1e-58    Elaeis guineensis
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg             203   2e-58    Eutrema salsugineum [saltwater cress]
ref|XP_003637416.1|  Aspartic proteinase nepenthesin-2                  194   2e-58    
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    203   3e-58    Elaeis guineensis
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             202   4e-58    Phaseolus vulgaris [French bean]
gb|KDO36875.1|  hypothetical protein CISIN_1g037264mg                   196   4e-58    Citrus sinensis [apfelsine]
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    202   5e-58    Pyrus x bretschneideri [bai li]
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    202   6e-58    Populus euphratica
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    202   6e-58    Camelina sativa [gold-of-pleasure]
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein        202   6e-58    
emb|CDY24395.1|  BnaCnng04620D                                          202   7e-58    Brassica napus [oilseed rape]
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    202   1e-57    Phoenix dactylifera
emb|CDP20336.1|  unnamed protein product                                201   1e-57    Coffea canephora [robusta coffee]
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg                201   2e-57    Erythranthe guttata [common monkey flower]
gb|KDO70056.1|  hypothetical protein CISIN_1g0117492mg                  194   2e-57    Citrus sinensis [apfelsine]
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...    201   2e-57    Ricinus communis
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    200   3e-57    Camelina sativa [gold-of-pleasure]
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    199   6e-57    Pyrus x bretschneideri [bai li]
gb|EMT00623.1|  Aspartic proteinase nepenthesin-1                       193   6e-57    
gb|KDP29378.1|  hypothetical protein JCGZ_18299                         199   1e-56    Jatropha curcas
gb|EEE64882.1|  hypothetical protein OsJ_19741                          198   1e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    198   2e-56    Camelina sativa [gold-of-pleasure]
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230              197   2e-56    
ref|XP_002890686.1|  aspartyl protease family protein                   198   2e-56    Arabidopsis lyrata subsp. lyrata
ref|NP_173922.1|  aspartyl protease family protein                      198   2e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    198   2e-56    Prunus mume [ume]
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369             196   3e-56    
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   3e-56    
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    198   3e-56    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   4e-56    Glycine max [soybeans]
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   4e-56    Pyrus x bretschneideri [bai li]
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg             197   4e-56    Capsella rubella
ref|XP_002315953.1|  aspartyl protease family protein                   197   5e-56    Populus trichocarpa [western balsam poplar]
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             197   6e-56    Phaseolus vulgaris [French bean]
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   7e-56    
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   7e-56    
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                    197   8e-56    Arabis alpina [alpine rockcress]
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             196   1e-55    Prunus persica
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   1e-55    Tarenaya hassleriana [spider flower]
gb|ABR16474.1|  unknown                                                 197   2e-55    Picea sitchensis
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    195   3e-55    Citrus sinensis [apfelsine]
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg             195   3e-55    Citrus clementina [clementine]
gb|KJB52970.1|  hypothetical protein B456_008G285900                    195   3e-55    Gossypium raimondii
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    195   3e-55    Solanum lycopersicum
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    195   4e-55    Phoenix dactylifera
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    194   5e-55    
emb|CDM80984.1|  unnamed protein product                                195   5e-55    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    194   5e-55    Cucumis sativus [cucumbers]
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    194   5e-55    Nicotiana tomentosiformis
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    194   6e-55    Cicer arietinum [garbanzo]
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein        194   6e-55    
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    194   7e-55    Arabis alpina [alpine rockcress]
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    194   9e-55    Vitis vinifera
gb|EAY72467.1|  hypothetical protein OsI_00323                          193   2e-54    Oryza sativa Indica Group [Indian rice]
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    194   3e-54    Prunus mume [ume]
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   3e-54    Camelina sativa [gold-of-pleasure]
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg             193   3e-54    
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    193   4e-54    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   4e-54    Tarenaya hassleriana [spider flower]
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440          192   4e-54    Amborella trichopoda
dbj|BAK07248.1|  predicted protein                                      192   4e-54    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001041979.1|  Os01g0140100                                       192   5e-54    
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   5e-54    Tarenaya hassleriana [spider flower]
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    192   7e-54    Setaria italica
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   8e-54    Nicotiana sylvestris
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-53    Solanum tuberosum [potatoes]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-53    Cucumis melo [Oriental melon]
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-53    Populus euphratica
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   1e-53    Vitis vinifera
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   2e-53    Camelina sativa [gold-of-pleasure]
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   3e-53    Camelina sativa [gold-of-pleasure]
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    191   3e-53    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001784204.1|  predicted protein                                  187   3e-53    
ref|NP_001168599.1|  uncharacterized protein LOC100382383               186   3e-53    
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             190   4e-53    Capsella rubella
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   4e-53    Sesamum indicum [beniseed]
gb|KJB50738.1|  hypothetical protein B456_008G185200                    189   6e-53    Gossypium raimondii
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    190   6e-53    Brachypodium distachyon [annual false brome]
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg             189   6e-53    Eutrema salsugineum [saltwater cress]
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   7e-53    Brassica rapa
emb|CDY69364.1|  BnaCnng63170D                                          189   9e-53    Brassica napus [oilseed rape]
emb|CDX75968.1|  BnaC03g40510D                                          189   9e-53    
emb|CDY24483.1|  BnaC05g34710D                                          188   1e-52    Brassica napus [oilseed rape]
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   1e-52    Nicotiana sylvestris
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    188   1e-52    Brassica rapa
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   2e-52    Cucumis sativus [cucumbers]
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    187   2e-52    
gb|ABR17085.1|  unknown                                                 187   3e-52    Picea sitchensis
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                  186   6e-52    Morus notabilis
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   7e-52    Pyrus x bretschneideri [bai li]
ref|XP_002885261.1|  aspartyl protease family protein                   186   7e-52    Arabidopsis lyrata subsp. lyrata
emb|CDX82342.1|  BnaA03g34790D                                          186   8e-52    
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   8e-52    
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              186   9e-52    
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   1e-51    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX92240.1|  BnaA05g21670D                                          186   1e-51    
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   2e-51    Fragaria vesca subsp. vesca
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   3e-51    Tarenaya hassleriana [spider flower]
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    185   3e-51    Brassica rapa
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   3e-51    Nicotiana tomentosiformis
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   3e-51    Brassica rapa
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   3e-51    Tarenaya hassleriana [spider flower]
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   6e-51    Glycine max [soybeans]
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    184   6e-51    Eucalyptus grandis [rose gum]
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   7e-51    Pyrus x bretschneideri [bai li]
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161              180   9e-51    
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   1e-50    
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470              181   1e-50    
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1             183   1e-50    Arabidopsis thaliana [mouse-ear cress]
gb|KJB37242.1|  hypothetical protein B456_006G195400                    182   1e-50    Gossypium raimondii
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210          182   1e-50    Sorghum bicolor [broomcorn]
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein       183   1e-50    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    183   1e-50    Setaria italica
emb|CDY03848.1|  BnaC07g10730D                                          182   2e-50    
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   3e-50    
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   4e-50    Beta vulgaris subsp. vulgaris [field beet]
emb|CDP20730.1|  unnamed protein product                                181   5e-50    Coffea canephora [robusta coffee]
gb|ABR17396.1|  unknown                                                 178   5e-50    Picea sitchensis
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   6e-50    
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                  181   7e-50    Morus notabilis
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   7e-50    Solanum lycopersicum
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   2e-49    Solanum tuberosum [potatoes]
ref|XP_002442590.1|  hypothetical protein SORBIDRAFT_08g022570          179   2e-49    Sorghum bicolor [broomcorn]
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   3e-49    Glycine max [soybeans]
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630          179   6e-49    Sorghum bicolor [broomcorn]
gb|ABK24480.1|  unknown                                                 178   6e-49    Picea sitchensis
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    177   1e-48    Ricinus communis
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   3e-48    
emb|CDO98452.1|  unnamed protein product                                175   5e-48    Coffea canephora [robusta coffee]
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   6e-48    Zea mays [maize]
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   6e-48    Vitis vinifera
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    175   1e-47    
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   1e-47    Nicotiana sylvestris
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075          174   2e-47    
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    174   2e-47    Sesamum indicum [beniseed]
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430          174   2e-47    
gb|KDP40474.1|  hypothetical protein JCGZ_24473                         172   8e-47    Jatropha curcas
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein            172   1e-46    Medicago truncatula
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    170   5e-46    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP04865.1|  unnamed protein product                                171   7e-46    Coffea canephora [robusta coffee]
ref|XP_002442593.1|  hypothetical protein SORBIDRAFT_08g022613          169   1e-45    
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg                169   1e-45    Erythranthe guttata [common monkey flower]
emb|CBI35367.3|  unnamed protein product                                168   5e-45    Vitis vinifera
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   6e-45    
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   9e-45    Solanum tuberosum [potatoes]
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein            167   1e-44    Medicago truncatula
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   1e-44    
gb|AFK45956.1|  unknown                                                 160   1e-44    Medicago truncatula
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   2e-44    Populus euphratica
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    166   3e-44    Phoenix dactylifera
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    165   4e-44    Solanum lycopersicum
ref|XP_010542095.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   4e-44    
gb|ADJ67210.1|  aspartic proteinase nepenthesin-1 precursor             154   4e-44    Jatropha curcas
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    165   5e-44    
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   5e-44    
ref|XP_002443631.1|  hypothetical protein SORBIDRAFT_08g022620          165   6e-44    
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    164   1e-43    
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2             163   2e-43    
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   2e-43    
gb|ADJ67200.1|  aspartic proteinase nepenthesin-1 precursor             152   2e-43    
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                  162   2e-43    
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   3e-43    
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   4e-43    
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg             162   4e-43    
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   4e-43    
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   6e-43    
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                    162   6e-43    
gb|KJB79793.1|  hypothetical protein B456_013G067200                    162   8e-43    
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g             162   9e-43    
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   9e-43    
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                  162   1e-42    
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   1e-42    
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    162   1e-42    
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966              159   1e-42    
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   2e-42    
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg             160   2e-42    
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein            160   2e-42    
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g             161   2e-42    
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    161   2e-42    
gb|EAY75637.1|  hypothetical protein OsI_03542                          160   2e-42    
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   2e-42    
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   2e-42    
ref|XP_002885351.1|  pepsin A                                           160   2e-42    
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971              159   3e-42    
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like    160   3e-42    
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   3e-42    
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   3e-42    
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   4e-42    
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg             160   4e-42    
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative        160   5e-42    
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                   160   5e-42    
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   6e-42    
emb|CDY51131.1|  BnaA07g37140D                                          159   6e-42    
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   1e-41    
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900          159   1e-41    
ref|XP_004138238.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   1e-41    
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   1e-41    
ref|XP_004170575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    158   2e-41    
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   3e-41    
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg                157   6e-41    
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   1e-40    
ref|XP_008453384.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   2e-40    
gb|KJB77420.1|  hypothetical protein B456_012G135900                    155   3e-40    
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   3e-40    
ref|XP_004138341.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   4e-40    
gb|EAZ32412.1|  hypothetical protein OsJ_16623                          154   6e-40    
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   8e-40    
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   1e-39    
gb|KJB49971.1|  hypothetical protein B456_008G147500                    153   1e-39    
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g             153   1e-39    
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   1e-39    
gb|KHN27179.1|  Aspartic proteinase nepenthesin-1                       144   1e-39    
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   1e-39    
gb|KGN63808.1|  hypothetical protein Csa_1G021980                       150   2e-39    
emb|CAJ86229.1|  H0402C08.5                                             152   2e-39    
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g             151   4e-39    
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg             151   8e-39    
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   8e-39    
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    151   9e-39    
gb|EMT16849.1|  Aspartic proteinase nepenthesin-1                       145   1e-38    
emb|CAN80962.1|  hypothetical protein VITISV_022007                     142   1e-38    
emb|CDO98457.1|  unnamed protein product                                147   2e-38    
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    150   2e-38    
gb|KGN63809.1|  hypothetical protein Csa_1G022480                       149   3e-38    
emb|CDO98456.1|  unnamed protein product                                149   3e-38    
emb|CDM84701.1|  unnamed protein product                                149   4e-38    
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   4e-38    
gb|ABR16115.1|  unknown                                                 149   5e-38    
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   2e-37    
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   3e-37    
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    147   4e-37    
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   6e-37    
emb|CAD31717.1|  putative nucleoid DNA-binding protein                  137   7e-37    
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580          145   8e-37    
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   8e-37    
ref|XP_008453383.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    145   1e-36    
gb|ABK24493.1|  unknown                                                 144   2e-36    
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   3e-36    
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    143   3e-36    
emb|CDY24567.1|  BnaC05g32510D                                          142   4e-36    
emb|CDY25371.1|  BnaA05g19130D                                          142   4e-36    
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          143   8e-36    
gb|ABR18297.1|  unknown                                                 141   1e-35    
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   2e-35    
ref|NP_001054261.2|  Os04g0677100                                       141   2e-35    
ref|XP_010928894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    141   2e-35    
gb|EAZ12575.1|  hypothetical protein OsJ_02481                          141   2e-35    
emb|CAE05761.2|  OSJNBa0064G10.12                                       141   2e-35    
ref|XP_006645485.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   3e-35    
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016              141   3e-35    
dbj|BAJ97639.1|  predicted protein                                      140   3e-35    
gb|KCW64008.1|  hypothetical protein EUGRSUZ_G01690                     139   5e-35    
ref|XP_008783095.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   9e-35    
emb|CDO98455.1|  unnamed protein product                                139   1e-34    
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   1e-34    
ref|XP_010068575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   5e-34    
gb|ACN40790.1|  unknown                                                 137   6e-34    
ref|XP_002967518.1|  hypothetical protein SELMODRAFT_87804              136   7e-34    
gb|KHN09660.1|  Aspartic proteinase nepenthesin-1                       135   9e-34    
gb|AFK42325.1|  unknown                                                 131   9e-34    
ref|XP_010068543.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   9e-34    
ref|XP_010256103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   1e-33    
gb|KJB71343.1|  hypothetical protein B456_011G117400                    136   1e-33    
gb|KCW63938.1|  hypothetical protein EUGRSUZ_G01615                     136   1e-33    
gb|KCW63937.1|  hypothetical protein EUGRSUZ_G01615                     136   2e-33    
ref|XP_001774247.1|  predicted protein                                  134   5e-33    
ref|XP_002960187.1|  hypothetical protein SELMODRAFT_75184              133   6e-33    
ref|XP_010272925.1|  PREDICTED: aspartic proteinase nepenthesin-1...    134   6e-33    
ref|XP_003523200.1|  PREDICTED: aspartic proteinase nepenthesin-1...    134   7e-33    
ref|XP_003526889.1|  PREDICTED: aspartic proteinase nepenthesin-1...    133   1e-32    
gb|KJB58890.1|  hypothetical protein B456_009G230400                    133   1e-32    
ref|XP_010928895.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   1e-32    
gb|AFK40811.1|  unknown                                                 128   1e-32    
gb|KDP34587.1|  hypothetical protein JCGZ_12216                         132   2e-32    
dbj|BAJ04354.1|  pollen allergen CPA63                                  132   2e-32    
gb|KDP41467.1|  hypothetical protein JCGZ_15874                         132   2e-32    
gb|KDO58699.1|  hypothetical protein CISIN_1g013672mg                   132   3e-32    
ref|XP_008442220.1|  PREDICTED: aspartic proteinase nepenthesin-1       132   3e-32    
ref|XP_006466172.1|  PREDICTED: aspartic proteinase nepenthesin-1...    132   3e-32    
ref|XP_006426445.1|  hypothetical protein CICLE_v10025623mg             132   3e-32    
ref|XP_003530761.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   3e-32    
ref|XP_002460314.1|  hypothetical protein SORBIDRAFT_02g026340          132   4e-32    
gb|KGN54860.1|  hypothetical protein Csa_4G554680                       132   4e-32    
emb|CAA09458.1|  hypothetical protein                                   124   4e-32    
ref|XP_009588036.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   5e-32    
ref|XP_009770124.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   5e-32    
ref|XP_004168776.1|  PREDICTED: aspartic proteinase nepenthesin-1...    132   5e-32    
ref|XP_006291078.1|  hypothetical protein CARUB_v10017196mg             131   5e-32    
emb|CDP20729.1|  unnamed protein product                                131   8e-32    
gb|KEH35638.1|  aspartic proteinase nepenthesin                         131   8e-32    
ref|XP_002514026.1|  Aspartic proteinase nepenthesin-1 precursor,...    131   8e-32    
emb|CDP04617.1|  unnamed protein product                                131   8e-32    
emb|CDP11493.1|  unnamed protein product                                130   9e-32    
ref|XP_006828037.1|  hypothetical protein AMTR_s00008p00256490          130   1e-31    
ref|XP_010107692.1|  Aspartic proteinase nepenthesin-1                  130   1e-31    
ref|XP_004239638.1|  PREDICTED: aspartic proteinase nepenthesin-1       130   1e-31    
ref|XP_009410092.1|  PREDICTED: aspartic proteinase nepenthesin-2...    130   2e-31    
gb|KCW63732.1|  hypothetical protein EUGRSUZ_G01378                     129   2e-31    
ref|XP_011091829.1|  PREDICTED: aspartic proteinase nepenthesin-1       130   2e-31    
ref|XP_009342559.1|  PREDICTED: aspartic proteinase nepenthesin-1...    130   2e-31    
ref|XP_009373927.1|  PREDICTED: aspartic proteinase nepenthesin-1...    130   2e-31    
ref|XP_010674342.1|  PREDICTED: aspartic proteinase nepenthesin-1       130   2e-31    
ref|XP_004144695.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...    132   2e-31    
ref|XP_002446566.1|  hypothetical protein SORBIDRAFT_06g018170          130   2e-31    
ref|XP_009801916.1|  PREDICTED: aspartic proteinase nepenthesin-1       130   2e-31    
ref|XP_010060093.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   2e-31    
ref|XP_009625615.1|  PREDICTED: aspartic proteinase nepenthesin-1       129   2e-31    
ref|XP_006291121.1|  hypothetical protein CARUB_v10017234mg             129   3e-31    
ref|XP_001755275.1|  predicted protein                                  129   3e-31    
ref|XP_010258628.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   3e-31    
emb|CDO98454.1|  unnamed protein product                                127   3e-31    
ref|XP_010276658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   3e-31    
ref|XP_006366418.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   4e-31    
gb|ABP93696.1|  unknown protein isoform 1                               128   4e-31    
ref|XP_004237984.1|  PREDICTED: aspartic proteinase nepenthesin-1...    129   4e-31    
ref|XP_001773068.1|  predicted protein                                  128   4e-31    
ref|XP_008380197.1|  PREDICTED: aspartic proteinase nepenthesin-2       129   5e-31    
ref|XP_010922206.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   5e-31    
emb|CDP17284.1|  unnamed protein product                                129   5e-31    
ref|XP_006345762.1|  PREDICTED: aspartic proteinase nepenthesin-1...    129   5e-31    
ref|XP_009390629.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   5e-31    
gb|AFW58416.1|  hypothetical protein ZEAMMB73_998053                    129   5e-31    
gb|AET05305.2|  eukaryotic aspartyl protease family protein             129   5e-31    
ref|XP_010025709.1|  PREDICTED: aspartic proteinase nepenthesin-1       128   6e-31    
ref|XP_003630829.1|  Aspartic proteinase nepenthesin-2                  129   6e-31    
ref|XP_008664185.1|  PREDICTED: aspartic proteinase nepenthesin-1       129   6e-31    
ref|XP_008806589.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   7e-31    
ref|XP_004956985.1|  PREDICTED: aspartic proteinase nepenthesin-1...    128   7e-31    
ref|XP_006395734.1|  hypothetical protein EUTSA_v10004149mg             128   8e-31    
ref|XP_002272802.1|  PREDICTED: aspartic proteinase nepenthesin-1       128   8e-31    
ref|XP_007048585.1|  Eukaryotic aspartyl protease family protein        128   9e-31    
ref|XP_010916755.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   9e-31    
ref|XP_007018203.1|  Eukaryotic aspartyl protease family protein        128   1e-30    
ref|XP_002522914.1|  Aspartic proteinase nepenthesin-1 precursor,...    127   1e-30    
emb|CDX85746.1|  BnaA02g00670D                                          128   1e-30    
ref|XP_009125277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   1e-30    
gb|KJB73115.1|  hypothetical protein B456_011G215800                    125   1e-30    
ref|XP_004252715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   1e-30    
emb|CAN74010.1|  hypothetical protein VITISV_003547                     127   1e-30    
emb|CDX97058.1|  BnaC09g45670D                                          128   1e-30    
ref|XP_009386344.1|  PREDICTED: aspartic proteinase nepenthesin-2...    127   1e-30    
ref|NP_001046662.1|  Os02g0314600                                       127   2e-30    
gb|EAY85563.1|  hypothetical protein OsI_06935                          127   2e-30    
gb|KFK33485.1|  hypothetical protein AALP_AA5G019300                    127   2e-30    
ref|XP_009411894.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30    
emb|CDX69804.1|  BnaA10g21530D                                          127   2e-30    
ref|XP_002524401.1|  basic 7S globulin 2 precursor small subunit,...    127   2e-30    
ref|XP_002300215.2|  aspartyl protease family protein                   127   2e-30    
ref|XP_010266126.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30    
ref|XP_009391129.1|  PREDICTED: aspartic proteinase nepenthesin-2...    127   2e-30    
ref|XP_009122022.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   2e-30    
ref|XP_010553675.1|  PREDICTED: aspartic proteinase nepenthesin-1       127   2e-30    
dbj|BAF98915.1|  aspartic proteinase nepenthesin I                      127   3e-30    
gb|KJB73114.1|  hypothetical protein B456_011G215800                    126   3e-30    
ref|XP_009356605.1|  PREDICTED: aspartic proteinase nepenthesin-2...    127   3e-30    
ref|XP_006847614.1|  hypothetical protein AMTR_s00014p00246430          127   3e-30    
dbj|BAJ94496.1|  predicted protein                                      126   3e-30    
gb|EMT14245.1|  Aspartic proteinase nepenthesin-1                       127   3e-30    
ref|XP_001752852.1|  predicted protein                                  126   3e-30    
gb|KFK43273.1|  hypothetical protein AALP_AA1G102700                    126   3e-30    
ref|XP_004503002.1|  PREDICTED: aspartic proteinase nepenthesin-1...    126   4e-30    
ref|XP_010099762.1|  Aspartic proteinase nepenthesin-1                  126   4e-30    
ref|XP_002302336.2|  chloroplast nucleoid DNA-binding family protein    126   4e-30    
gb|ABK95290.1|  unknown                                                 126   4e-30    
gb|AAC34482.2|  putative chloroplast nucleoid DNA binding protein       125   4e-30    
emb|CDY40117.1|  BnaC02g00130D                                          126   4e-30    
ref|XP_007033357.1|  Eukaryotic aspartyl protease family protein        126   4e-30    
gb|KHG22262.1|  Asparticase nepenthesin-1                               125   5e-30    
ref|XP_009757207.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   5e-30    
ref|XP_009377195.1|  PREDICTED: aspartic proteinase nepenthesin-2...    126   5e-30    
ref|XP_002283889.2|  PREDICTED: aspartic proteinase nepenthesin-1       125   5e-30    
ref|XP_011045692.1|  PREDICTED: aspartic proteinase nepenthesin-1...    125   5e-30    
ref|XP_011021582.1|  PREDICTED: aspartic proteinase nepenthesin-1       126   5e-30    
ref|XP_010095993.1|  Aspartic proteinase nepenthesin-1                  125   6e-30    



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   316 bits (809),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 157/184 (85%), Positives = 170/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAVSR+AVFTPLLTNPKLDTF+YV L G+S+GG RV GI  S+FKLDPTGNGG
Sbjct  288  SSMVFGESAVSRNAVFTPLLTNPKLDTFFYVGLNGVSVGGTRVPGIAASLFKLDPTGNGG  347

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR AYVA+RDAFR GAS+LK SSEFSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  348  VIVDSGTSVTRLTRPAYVALRDAFRIGASNLKRSSEFSLFDTCFDLSGKTEVKVPTVVLH  407

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
              GADVSLPA+NYLIPVD+EGKFCFAFAGT SGLSIIGNIQQQGFRVVFDLAG+R+GFA 
Sbjct  408  LEGADVSLPASNYLIPVDSEGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGNRVGFAP  467

Query  166  SGCA  155
             GCA
Sbjct  468  RGCA  471



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   315 bits (808),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 156/184 (85%), Positives = 171/184 (93%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAVSR+AVFTPLLTNPKLDTF+YV L G+S+GG RV G+  S+FKLDPTGNGG
Sbjct  286  SSMVFGESAVSRNAVFTPLLTNPKLDTFFYVGLNGVSVGGTRVPGVAASLFKLDPTGNGG  345

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR AYVA+RDAFR GAS+LK SS+FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  346  VIVDSGTSVTRLTRPAYVALRDAFRIGASNLKRSSDFSLFDTCFDLSGKTEVKVPTVVLH  405

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F GADVSLPA+NYLIPVD+EGKFCFAFAGT SGLSIIGNIQQQGFRVVFDLAG+R+GFA 
Sbjct  406  FEGADVSLPASNYLIPVDSEGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGNRVGFAP  465

Query  166  SGCA  155
             GCA
Sbjct  466  RGCA  469



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPLL NPKLDTFYYVEL GIS+GGA VRGI  S+FKLDP GNGG
Sbjct  297  SSMVFGDSAVSRTARFTPLLANPKLDTFYYVELVGISVGGAHVRGITASLFKLDPAGNGG  356

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+RDAFR GAS LK + +FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  357  VIIDSGTSVTRLTRPAYIALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLH  416

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVD+ G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  417  FRGADVSLPATNYLIPVDSSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRIGFAP  476

Query  166  SGCA  155
             GCA
Sbjct  477  RGCA  480



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPLL NPKLDTFYYVEL GIS+GGA VRGI  S+FKLDP GNGG
Sbjct  297  SSMVFGDSAVSRTARFTPLLANPKLDTFYYVELVGISVGGAHVRGITASLFKLDPAGNGG  356

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+RDAFR GAS LK + +FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  357  VIIDSGTSVTRLTRPAYIALRDAFRAGASSLKRAPDFSLFDTCFDLSGKTEVKVPTVVLH  416

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVD+ G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  417  FRGADVSLPATNYLIPVDSSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRIGFAP  476

Query  166  SGCA  155
             GCA
Sbjct  477  RGCA  480



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 1/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPS  +VFG+SAVSR+AVFTPL+ NPKLDTFYYVELTGIS+GGARV  I PS+FKLD  G
Sbjct  295  RPSY-LVFGESAVSRTAVFTPLVNNPKLDTFYYVELTGISVGGARVPAIRPSLFKLDAAG  353

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVIVDSGTSVTRLTR AYVA+RD+FR GA DLK + +FSLFDTCFDLSGKTEVKVPTV
Sbjct  354  DGGVIVDSGTSVTRLTRPAYVALRDSFRMGARDLKRAPDFSLFDTCFDLSGKTEVKVPTV  413

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V+HFRGADVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSRLG
Sbjct  414  VMHFRGADVSLPASNYLIPVDSDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRLG  473

Query  175  FAASGCA  155
            FA  GCA
Sbjct  474  FAPRGCA  480



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   311 bits (798),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 168/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG SAVSR+AVFTPL+TNPKLDTFYY+ELTGIS+GGARV GI  S+FKLD  GNGG
Sbjct  306  SSVVFGQSAVSRTAVFTPLITNPKLDTFYYLELTGISVGGARVAGITASLFKLDTAGNGG  365

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYV++RDAFR GA+DLK + ++SLFDTCFDLSGKTEVKVPTVV+H
Sbjct  366  VIIDSGTSVTRLTRRAYVSLRDAFRAGAADLKRAPDYSLFDTCFDLSGKTEVKVPTVVMH  425

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT G FCFAFAGT SGLSIIGNIQQQGFRVVFD+A SR+GFAA
Sbjct  426  FRGADVSLPATNYLIPVDTNGVFCFAFAGTMSGLSIIGNIQQQGFRVVFDVAASRIGFAA  485

Query  166  SGCA  155
             GCA
Sbjct  486  RGCA  489



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   310 bits (795),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPL+ NPKLDTFYY+EL GIS+GG RVRGI  S+FKLDP+GNGG
Sbjct  284  SSVVFGDSAVSRTARFTPLVPNPKLDTFYYIELLGISVGGTRVRGITASLFKLDPSGNGG  343

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR+AY+++RDAFR GA  LK + EFSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  344  VIIDSGTSVTRLTRSAYISLRDAFRAGARSLKRAPEFSLFDTCFDLSGKTEVKVPTVVLH  403

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVD+ G FCFAFAGTT GLSIIGNIQQQGFRVV+DLAG R+GFA 
Sbjct  404  FRGADVSLPATNYLIPVDSSGTFCFAFAGTTGGLSIIGNIQQQGFRVVYDLAGKRVGFAP  463

Query  166  SGCA  155
             GCA
Sbjct  464  RGCA  467



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   311 bits (797),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 1/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPSS IVFGDSA+SR+A FTPLL+NPKLDTFYY+EL GIS+GG RV GI+ S+FKLD TG
Sbjct  320  RPSS-IVFGDSAISRTARFTPLLSNPKLDTFYYLELLGISVGGTRVSGISASLFKLDSTG  378

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLTRAAYVA+RDAFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTV
Sbjct  379  NGGVIIDSGTSVTRLTRAAYVALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTV  438

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            VLHFRGADVSLPA+NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRVV+D+A SR+G
Sbjct  439  VLHFRGADVSLPASNYLIPVDNSGSFCFAFAGTASGLSIIGNIQQQGFRVVYDVATSRVG  498

Query  175  FAASGCA  155
            FA  GCA
Sbjct  499  FAPRGCA  505



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/184 (83%), Positives = 169/184 (92%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAVSR+AVFTPLLTNPKLDTFYYV L GIS+GG RV GI PS+FK+D  G+GG
Sbjct  293  SSMVFGESAVSRNAVFTPLLTNPKLDTFYYVGLNGISVGGVRVPGITPSLFKMDQMGSGG  352

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR AYVA+RDAFR GAS+LK + +FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  353  VIVDSGTSVTRLTRPAYVALRDAFRAGASNLKRAPDFSLFDTCFDLSGKTEVKVPTVVLH  412

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F GADVSLPA+NYLIPVD+EGKFCFAFAGT SGLSIIGNIQQQGFRVVFD+A +R+GFAA
Sbjct  413  FGGADVSLPASNYLIPVDSEGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDMASNRVGFAA  472

Query  166  SGCA  155
             GCA
Sbjct  473  RGCA  476



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   310 bits (794),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 170/187 (91%), Gaps = 1/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPS  IVFG+S VSR+AVFTPL+TNPKLDTFYYVELTGIS+GG RV  I PS+FKLD  G
Sbjct  306  RPSY-IVFGESTVSRTAVFTPLVTNPKLDTFYYVELTGISVGGTRVPSIRPSLFKLDAAG  364

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVIVDSGTSVTRLTR AYVA+RDAFR GA++LK + +FSLFDTCFDLSGKTEVKVPTV
Sbjct  365  DGGVIVDSGTSVTRLTRPAYVALRDAFRIGAANLKRAPDFSLFDTCFDLSGKTEVKVPTV  424

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            VLHF+GADVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSRLG
Sbjct  425  VLHFKGADVSLPASNYLIPVDSDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRLG  484

Query  175  FAASGCA  155
            FA  GCA
Sbjct  485  FAPRGCA  491



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   309 bits (792),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S +VFG+SAVSR+AVFTPL+ NPKLDTFYYVELTG S+GGARV  I PS+FKLD  G+GG
Sbjct  317  SYLVFGESAVSRTAVFTPLVKNPKLDTFYYVELTGFSVGGARVPAIRPSLFKLDAAGDGG  376

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR AYVA+RDAFR GA DLK + +FSLFDTCFDLSGKTEVKVPTVV+H
Sbjct  377  VIVDSGTSVTRLTRPAYVALRDAFRMGAKDLKRAPDFSLFDTCFDLSGKTEVKVPTVVMH  436

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAG+RLGFA 
Sbjct  437  FRGADVSLPASNYLIPVDSDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGNRLGFAP  496

Query  166  SGCA  155
             GCA
Sbjct  497  RGCA  500



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 151/184 (82%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPL++NPKLDTFYYVEL GIS+GG RV GI  S+FKLD TGNGG
Sbjct  286  SSMVFGDSAVSRTARFTPLVSNPKLDTFYYVELLGISVGGTRVPGITASLFKLDQTGNGG  345

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A RDAFR GAS+LK + +FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  346  VIIDSGTSVTRLTRPAYIAFRDAFRAGASNLKRAPQFSLFDTCFDLSGKTEVKVPTVVLH  405

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVDT G FC AFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GFA 
Sbjct  406  FRGADVSLPASNYLIPVDTSGNFCLAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFAP  465

Query  166  SGCA  155
             GCA
Sbjct  466  HGCA  469



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   308 bits (788),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPLLTNPKLDTFYY+EL  IS+GG+RVRGI+ S+FKLD  GNGG
Sbjct  308  SSMVFGDSAVSRTARFTPLLTNPKLDTFYYLELLAISVGGSRVRGISASLFKLDQAGNGG  367

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR G+ +LK + EFSLFDTC+DLSGKTEVKVPTVVLH
Sbjct  368  VIIDSGTSVTRLTRPAYVALRDAFRAGSVNLKRAPEFSLFDTCYDLSGKTEVKVPTVVLH  427

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVS PA NYLIPVD+ G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA 
Sbjct  428  FRGADVSFPATNYLIPVDSSGTFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAP  487

Query  166  SGCA  155
             GCA
Sbjct  488  RGCA  491



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   307 bits (786),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 167/183 (91%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSA+SR+A FTPL++NPKLDTFYYVEL GIS+GG RV GI  S+FKLD TGNGG
Sbjct  295  SSVVFGDSAISRTARFTPLISNPKLDTFYYVELLGISVGGTRVPGITASLFKLDQTGNGG  354

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+R+AFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTV LH
Sbjct  355  VIIDSGTSVTRLTRPAYVALRNAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVALH  414

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA 
Sbjct  415  FRGADVSLPASNYLIPVDSDGSFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAP  474

Query  166  SGC  158
             GC
Sbjct  475  RGC  477



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   307 bits (787),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 170/187 (91%), Gaps = 1/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPS  IVFG+SAVSR+AVFTPL+ NPKLDTFYYVELTGIS+GG RV  I PS+FKLD  G
Sbjct  325  RPSY-IVFGESAVSRTAVFTPLVNNPKLDTFYYVELTGISVGGTRVPSIRPSLFKLDAAG  383

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVIVDSGTSVTRLTR AYVA+RD+FR GA++LK + +FSLFDTCFDLSGKTEVKVPTV
Sbjct  384  DGGVIVDSGTSVTRLTRPAYVALRDSFRMGAANLKRAPDFSLFDTCFDLSGKTEVKVPTV  443

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            VLHF+GA+VSLPA+NYLIPVD++G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSRLG
Sbjct  444  VLHFKGAEVSLPASNYLIPVDSDGTFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRLG  503

Query  175  FAASGCA  155
            FA  GCA
Sbjct  504  FAPRGCA  510



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 167/184 (91%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SSI+FG++AVSR AVFTPLLTNPKLDTFYYV L GIS+GG RV GI  S+FKLD  GNGG
Sbjct  295  SSILFGEAAVSRRAVFTPLLTNPKLDTFYYVGLNGISVGGVRVPGITASLFKLDAAGNGG  354

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR AYVA+R+AFR GAS+LKP+ +FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  355  VIVDSGTSVTRLTRPAYVALRNAFRVGASNLKPAPDFSLFDTCFDLSGKTEVKVPTVVLH  414

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F GADVSLPA+NYLIPVD++GKFCFAFAGT SGLSIIGNIQQQGFRVVFDLA +R+GFA 
Sbjct  415  FAGADVSLPASNYLIPVDSDGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLASNRVGFAP  474

Query  166  SGCA  155
             GCA
Sbjct  475  RGCA  478



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score =   306 bits (784),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SSIVFGDSAVSR+A FTP++ NPKLDTFYY+EL GIS+GGA VRGI+ S+F+LD TGNGG
Sbjct  293  SSIVFGDSAVSRTARFTPIINNPKLDTFYYLELLGISVGGAPVRGISASLFRLDSTGNGG  352

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVV+H
Sbjct  353  VIIDSGTSVTRLTRPAYVALRDAFRVGASHLKRAPEFSLFDTCYDLSGISEVKVPTVVMH  412

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVS PAANYLIPVD  G+FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA 
Sbjct  413  FRGADVSFPAANYLIPVDNSGRFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAP  472

Query  166  SGCA  155
             GCA
Sbjct  473  RGCA  476



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   306 bits (783),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/184 (83%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SSIVFGDSAVSR+A FTPL+ NPKLDTFYYVEL GIS+GGA VRGI+ S F+LD TGNGG
Sbjct  290  SSIVFGDSAVSRTARFTPLVKNPKLDTFYYVELLGISVGGAPVRGISASFFRLDSTGNGG  349

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYV++RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVVLH
Sbjct  350  VIIDSGTSVTRLTRPAYVSLRDAFRVGASHLKRAPEFSLFDTCYDLSGLSEVKVPTVVLH  409

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPAANYL+PVD  G FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA 
Sbjct  410  FRGADVSLPAANYLVPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAP  469

Query  166  SGCA  155
             GCA
Sbjct  470  RGCA  473



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   306 bits (784),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/187 (82%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPSS IVFGDSA+SR+  FTPLL+NPKLDTFYYVEL GIS+GG RV GI+ S+FKLD TG
Sbjct  303  RPSS-IVFGDSAISRTTRFTPLLSNPKLDTFYYVELLGISVGGTRVSGISASLFKLDSTG  361

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLTRAAYVA+RDAF  GAS+LK + EFSLFDTCFDLSGKTEVKVPTV
Sbjct  362  NGGVIIDSGTSVTRLTRAAYVALRDAFLVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTV  421

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            VLHFRGADV LPA+NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+G
Sbjct  422  VLHFRGADVPLPASNYLIPVDNSGSFCFAFAGTASGLSIIGNIQQQGFRVVYDLATSRVG  481

Query  175  FAASGCA  155
            FA  GCA
Sbjct  482  FAPRGCA  488



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score =   306 bits (783),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SSIVFGDSAVSR+A FTP++ NPKLDTFYY+EL GIS+GGA VRGI+ S+F+LD TGNGG
Sbjct  294  SSIVFGDSAVSRTARFTPIINNPKLDTFYYLELLGISVGGAPVRGISASLFRLDSTGNGG  353

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVV+H
Sbjct  354  VIIDSGTSVTRLTRPAYVALRDAFRVGASHLKRAPEFSLFDTCYDLSGISEVKVPTVVMH  413

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVS PAANYLIPVD  G+FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA 
Sbjct  414  FRGADVSFPAANYLIPVDNSGRFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAP  473

Query  166  SGCA  155
             GCA
Sbjct  474  RGCA  477



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   306 bits (783),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SSIVFGDSAVSR+A FTP++ NPKLDTFYY+EL GIS+GGA VRGI+ S+F+LD TGNGG
Sbjct  294  SSIVFGDSAVSRTARFTPIINNPKLDTFYYLELLGISVGGAPVRGISASLFRLDSTGNGG  353

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR GAS LK + EFSLFDTC+DLSG +EVKVPTVV+H
Sbjct  354  VIIDSGTSVTRLTRPAYVALRDAFRVGASHLKRAPEFSLFDTCYDLSGISEVKVPTVVMH  413

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVS PAANYLIPVD  G+FCFAFAGT SGLSIIGNIQQQGFRVVFDLAGSR+GFA 
Sbjct  414  FRGADVSFPAANYLIPVDNSGRFCFAFAGTMSGLSIIGNIQQQGFRVVFDLAGSRVGFAP  473

Query  166  SGCA  155
             GCA
Sbjct  474  RGCA  477



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   306 bits (783),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S +VFGDSA+SR+A FTPL++NPKLDTFYYVEL G+S+GG RV GI  S+FKLD TGNGG
Sbjct  309  SYMVFGDSAISRTARFTPLVSNPKLDTFYYVELLGVSVGGTRVPGITASLFKLDSTGNGG  368

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  369  VIIDSGTSVTRLTRPAYVALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLH  428

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  429  FRGADVSLPASNYLIPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAASRVGFAP  488

Query  166  SGCA  155
             GCA
Sbjct  489  RGCA  492



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 166/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS++FG+SAVSR AVFTPLLTNPKLDTFYYV L G+S+GGARV GI  S+FKLD +GNGG
Sbjct  291  SSLLFGESAVSRKAVFTPLLTNPKLDTFYYVGLNGMSVGGARVPGITASLFKLDASGNGG  350

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRL R AYVA+RDAFR GAS+LK   +FSLFDTCFDLSGKTEVKVPTVV+H
Sbjct  351  VIVDSGTSVTRLNRPAYVALRDAFRAGASNLKRGPDFSLFDTCFDLSGKTEVKVPTVVMH  410

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F GADVSLPA+NYLIPVD+ GKFCFAFAGT SGLSIIGNIQQQGFRVVFDLA +R+GF A
Sbjct  411  FTGADVSLPASNYLIPVDSNGKFCFAFAGTMSGLSIIGNIQQQGFRVVFDLASNRVGFTA  470

Query  166  SGCA  155
            +GCA
Sbjct  471  NGCA  474



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/183 (82%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SSIVFGDSAVSR+A FTPLL NPKLDTFYY+EL GIS+GGA VRG++ S+FKLDP GNGG
Sbjct  290  SSIVFGDSAVSRTARFTPLLKNPKLDTFYYLELLGISVGGAPVRGVSASLFKLDPAGNGG  349

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+RDAFR GAS LK + EFSLFDTCFDLSG TEVKVPTVVLH
Sbjct  350  VIIDSGTSVTRLTRPAYIALRDAFRVGASHLKRAPEFSLFDTCFDLSGLTEVKVPTVVLH  409

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FR +DVSLPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA 
Sbjct  410  FRDSDVSLPATNYLIPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAP  469

Query  166  SGC  158
             GC
Sbjct  470  RGC  472



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   304 bits (779),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 149/184 (81%), Positives = 165/184 (90%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S +VFGDSA+SR+A FTPL++NPKLDTFYYVEL G+S+GG RV GI  S+FKLD TGNGG
Sbjct  307  SYMVFGDSAISRTARFTPLVSNPKLDTFYYVELLGVSVGGTRVPGITASLFKLDSTGNGG  366

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR GAS+LK + EFSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  367  VIIDSGTSVTRLTRPAYVALRDAFRVGASNLKRAPEFSLFDTCFDLSGKTEVKVPTVVLH  426

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD  G FCFAFAGT SGLSI+GNIQQQGFRVV+DLA SR+GFA 
Sbjct  427  FRGADVSLPASNYLIPVDNSGSFCFAFAGTMSGLSIVGNIQQQGFRVVYDLAASRVGFAP  486

Query  166  SGCA  155
             GCA
Sbjct  487  RGCA  490



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   303 bits (777),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 151/187 (81%), Positives = 167/187 (89%), Gaps = 1/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPSS ++FGD+A+SR A FT LLTNPKLDTFYYVEL G+S+GGARVRGI  S+FKLD  G
Sbjct  300  RPSS-VIFGDNALSRPARFTKLLTNPKLDTFYYVELLGMSVGGARVRGITASLFKLDAAG  358

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGG+IVDSGTSVTRLTR AY A+RDAFR GAS LK + +FSLFDTCFDLSGKTEVKVPTV
Sbjct  359  NGGLIVDSGTSVTRLTRPAYNALRDAFRAGASGLKRAPDFSLFDTCFDLSGKTEVKVPTV  418

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            VLHFRGADVSLPA+NYLIPVD++G FCFAFA T SGLSIIGNIQQQGFRVVFDLAGSR+G
Sbjct  419  VLHFRGADVSLPASNYLIPVDSQGTFCFAFAATMSGLSIIGNIQQQGFRVVFDLAGSRVG  478

Query  175  FAASGCA  155
            F+  GCA
Sbjct  479  FSPRGCA  485



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPL+ NPKLDTFYYVEL GIS+GG RVRGI  S+FKLDP GNGG
Sbjct  285  SSVVFGDSAVSRTARFTPLIANPKLDTFYYVELIGISVGGTRVRGITASLFKLDPAGNGG  344

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY ++RDAFR G S LK + EFSLFDTCFDLSGK+EVKVPTVVLH
Sbjct  345  VILDSGTSVTRLTRVAYNSLRDAFRAGTSGLKRAPEFSLFDTCFDLSGKSEVKVPTVVLH  404

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FR ADVSLPA NYLIPVD+ G FCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  405  FRNADVSLPATNYLIPVDSSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAP  464

Query  166  SGCA  155
             GCA
Sbjct  465  RGCA  468



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   301 bits (770),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SSIVFGD++VSR+A FTP+L NPKLDTFYYVEL GIS+GG RV G++ S+FKL  TGNGG
Sbjct  284  SSIVFGDASVSRTARFTPMLLNPKLDTFYYVELLGISVGGTRVPGVSASLFKLAQTGNGG  343

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+AMRDAFR GA +LK ++ FSLFDTCFDLSG TEVKVPTVVLH
Sbjct  344  VILDSGTSVTRLTRPAYIAMRDAFRVGAKNLKRATSFSLFDTCFDLSGLTEVKVPTVVLH  403

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA 
Sbjct  404  FRGADVSLPATNYLIPVDTNGKFCFAFAGTASGLSIIGNIQQQGFRVVYDLVGSRVGFAP  463

Query  166  SGC  158
             GC
Sbjct  464  RGC  466



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLDP GNGG
Sbjct  298  SSVVFGNAAVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDPIGNGG  357

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + ++SLFDTCFDLS + EVKVPTVVLH
Sbjct  358  VIIDSGTSVTRLVRPAYIAMRDAFRVGAKSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLH  417

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA 
Sbjct  418  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLMGSRVGFAP  477

Query  166  SGCA  155
             GCA
Sbjct  478  RGCA  481



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score =   300 bits (768),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 147/183 (80%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPL+ NPKLDTFYY+EL GIS+GG+ VRG++ S+F+LD  GNGG
Sbjct  289  SSVVFGDSAVSRTARFTPLIKNPKLDTFYYLELLGISVGGSPVRGLSASLFRLDAAGNGG  348

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+RDAFR GAS LK ++EFSLFDTCFDLSG TEVKVPTVVLH
Sbjct  349  VIIDSGTSVTRLTRPAYIALRDAFRVGASHLKRAAEFSLFDTCFDLSGLTEVKVPTVVLH  408

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRV FDLAGSR+GFA 
Sbjct  409  FRGADVSLPATNYLIPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRVSFDLAGSRVGFAP  468

Query  166  SGC  158
             GC
Sbjct  469  RGC  471



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 147/182 (81%), Positives = 159/182 (87%), Gaps = 0/182 (0%)
 Frame = -3

Query  700  IVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVI  521
            ++FGDSAVSR+A FTPLL NPKLDTFYYVEL GIS+GG RVRGI  S+F LDP GNGGVI
Sbjct  306  VLFGDSAVSRTARFTPLLANPKLDTFYYVELIGISVGGTRVRGITASLFNLDPAGNGGVI  365

Query  520  VDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR  341
            +DSGTSVTRLTR+AY A+RDAFR G S LK   EFSLFDTCFDLSGKTEVKVPTVVLHFR
Sbjct  366  LDSGTSVTRLTRSAYNALRDAFRAGTSGLKRGPEFSLFDTCFDLSGKTEVKVPTVVLHFR  425

Query  340  GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASG  161
             ADVSLPA NYLIPVD+ G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+  G
Sbjct  426  NADVSLPATNYLIPVDSSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSPRG  485

Query  160  CA  155
            CA
Sbjct  486  CA  487



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLDP GNGG
Sbjct  298  SSVVFGNAAVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDPIGNGG  357

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + ++SLFDTCFDLS + EVKVPTVVLH
Sbjct  358  VIIDSGTSVTRLVRPAYIAMRDAFRVGAKSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLH  417

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA 
Sbjct  418  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLMGSRVGFAP  477

Query  166  SGCA  155
             GCA
Sbjct  478  RGCA  481



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   300 bits (769),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 149/182 (82%), Positives = 163/182 (90%), Gaps = 0/182 (0%)
 Frame = -3

Query  700  IVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVI  521
            IVFG+S+VSR++VFTPLLTNPKLDTFYYV L GIS+GG+RV GI  S FKLD  GNGGVI
Sbjct  306  IVFGESSVSRTSVFTPLLTNPKLDTFYYVGLNGISVGGSRVPGITESHFKLDAAGNGGVI  365

Query  520  VDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFR  341
            VDSGTSVTRLTR AY+AMRDAFR GAS+L+ + +FSLFDTCFDLSGKTEVKVPTVVLHF 
Sbjct  366  VDSGTSVTRLTRPAYIAMRDAFRAGASNLRRAPDFSLFDTCFDLSGKTEVKVPTVVLHFN  425

Query  340  GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASG  161
            GADVSLPA+NYLIPVD  G+FCFAFAGT SGLSIIGNIQQQGFRV FDLAGSR+GFA  G
Sbjct  426  GADVSLPASNYLIPVDGNGRFCFAFAGTISGLSIIGNIQQQGFRVSFDLAGSRVGFAPRG  485

Query  160  CA  155
            CA
Sbjct  486  CA  487



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   300 bits (768),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 146/183 (80%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  SVFKLD  GNGG
Sbjct  294  SSVVFGNAAVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVTASVFKLDSIGNGG  353

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR G+  LK +++FSLFDTCFDLS + EVKVPTVVLH
Sbjct  354  VIIDSGTSVTRLIRPAYIAMRDAFRVGSRTLKRATDFSLFDTCFDLSNQNEVKVPTVVLH  413

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA 
Sbjct  414  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLAGSRVGFAP  473

Query  166  SGC  158
             GC
Sbjct  474  RGC  476



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAVSR+A FTPLLTNP+LDTFYYVEL GIS+GG  V GI  S FKLD TGNGG
Sbjct  201  SSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGITASHFKLDRTGNGG  260

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+D GTSVTRL + AY+A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLH
Sbjct  261  VIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLH  320

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD  G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+ 
Sbjct  321  FRGADVSLPASNYLIPVDGSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSP  380

Query  166  SGCA  155
             GCA
Sbjct  381  RGCA  384



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   301 bits (770),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/183 (81%), Positives = 162/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPLL NPKLDTFYYVEL GIS+GG  VRG++ S+F+LD  GNGG
Sbjct  351  SSVVFGDSAVSRTARFTPLLQNPKLDTFYYVELLGISVGGTPVRGLSASLFRLDSAGNGG  410

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+RDAFR GAS LK +SEFSLFDTCFDLSG TEVKVPTVVLH
Sbjct  411  VIIDSGTSVTRLTRPAYIALRDAFRVGASRLKRASEFSLFDTCFDLSGLTEVKVPTVVLH  470

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRV +DL GSR+GFA 
Sbjct  471  FRGADVSLPASNYLIPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRVSYDLGGSRVGFAP  530

Query  166  SGC  158
             GC
Sbjct  531  RGC  533



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLDP GNGG
Sbjct  298  SSVVFGNAAVSRTAKFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDPIGNGG  357

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AYVAMRDAFR  A  LK + ++SLFDTCFDLS + EVKVPTVVLH
Sbjct  358  VIIDSGTSVTRLVRPAYVAMRDAFRVRARSLKRAPDYSLFDTCFDLSHQNEVKVPTVVLH  417

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA 
Sbjct  418  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLMGSRVGFAP  477

Query  166  SGCA  155
             GCA
Sbjct  478  RGCA  481



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score =   297 bits (760),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 161/183 (88%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS++FGDSAVSR+A FTPL+ NPKLDTFYY+EL GIS+GGA VRG++ S+F+LD  GNGG
Sbjct  278  SSVIFGDSAVSRTAHFTPLIKNPKLDTFYYLELLGISVGGAPVRGLSASLFRLDAAGNGG  337

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+RDAFR GAS LK + EFSLFDTCFDLSG TEVKVPTVVLH
Sbjct  338  VIIDSGTSVTRLTRPAYIALRDAFRIGASHLKRAPEFSLFDTCFDLSGLTEVKVPTVVLH  397

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFR+ +DL GSR+GFA 
Sbjct  398  FRGADVSLPATNYLIPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRISYDLTGSRVGFAP  457

Query  166  SGC  158
             GC
Sbjct  458  RGC  460



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 163/184 (89%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAVSR+A FTPLLTNP+LDTFYYVEL GIS+GG  V GI+ S FKLD TGNGG
Sbjct  291  SSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGISSSHFKLDRTGNGG  350

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+D GTSVTRL + AY+A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLH
Sbjct  351  VIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLH  410

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD  G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+ 
Sbjct  411  FRGADVSLPASNYLIPVDGSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSP  470

Query  166  SGCA  155
             GCA
Sbjct  471  RGCA  474



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   296 bits (759),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS++FGDSAVSR++VFTPLLTNPKLDTFYY+ LTGIS+GG+RV G+ PS+FKLD +G GG
Sbjct  279  SSVMFGDSAVSRNSVFTPLLTNPKLDTFYYIGLTGISVGGSRVPGVTPSLFKLDSSGAGG  338

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR GA  L  + +FSLFDTC+DLSGKTEVKVPTVVLH
Sbjct  339  VIIDSGTSVTRLTRPAYVALRDAFRIGAYHLNRAPDFSLFDTCYDLSGKTEVKVPTVVLH  398

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F GADVSLPA+NYLIPVDT G+FCFAFAGT SGLSIIGNIQQQGFRV FDLA +R+GFA 
Sbjct  399  FEGADVSLPASNYLIPVDTSGRFCFAFAGTMSGLSIIGNIQQQGFRVSFDLASNRVGFAP  458

Query  166  SGC  158
             GC
Sbjct  459  RGC  461



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   297 bits (761),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLD  GNGG
Sbjct  303  SSVVFGNAAVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVTASLFKLDQIGNGG  362

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDTCFDLS + EVKVPTVVLH
Sbjct  363  VIIDSGTSVTRLIRPAYIAMRDAFRVGAKTLKRAPDFSLFDTCFDLSNQNEVKVPTVVLH  422

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVD+ GKFCFAFAGT SGLSIIGNIQQQGFRVV+DL GSR+GFA 
Sbjct  423  FRGADVSLPATNYLIPVDSNGKFCFAFAGTMSGLSIIGNIQQQGFRVVYDLTGSRVGFAP  482

Query  166  SGCA  155
             GCA
Sbjct  483  RGCA  486



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   297 bits (760),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAVSR+A FTPLLTNP+LDTFYYVEL GIS+GG  V GI  S FKLD TGNGG
Sbjct  288  SSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGITASHFKLDRTGNGG  347

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+D GTSVTRL + AY+A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLH
Sbjct  348  VIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLH  407

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD  G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+ 
Sbjct  408  FRGADVSLPASNYLIPVDGSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSP  467

Query  166  SGCA  155
             GCA
Sbjct  468  RGCA  471



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   297 bits (761),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 147/186 (79%), Positives = 162/186 (87%), Gaps = 1/186 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPSS +VFGD+AV R+A+ TPLLTNPKLDTFYY+EL GIS+GG RV  I PS+FK+D  G
Sbjct  303  RPSS-LVFGDAAVPRAAMLTPLLTNPKLDTFYYIELLGISVGGIRVPRITPSLFKMDQAG  361

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLTR AY+AMRDAFR GAS+LK + +FSLFDTCFDLSGKT VKVPTV
Sbjct  362  NGGVIIDSGTSVTRLTRPAYIAMRDAFRIGASNLKGAPDFSLFDTCFDLSGKTSVKVPTV  421

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            VLHFRGADVSLPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRV +DLAGSR+G
Sbjct  422  VLHFRGADVSLPATNYLIPVDGSGTFCFAFAGTMSGLSIIGNIQQQGFRVSYDLAGSRIG  481

Query  175  FAASGC  158
            F   GC
Sbjct  482  FTPRGC  487



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   298 bits (763),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 146/184 (79%), Positives = 162/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAVSR+A FTPLLTNP+LDTFYYVEL GIS+GG  V GI  S FKLD TGNGG
Sbjct  329  SSVVFGNSAVSRTARFTPLLTNPRLDTFYYVELLGISVGGTPVSGITASHFKLDRTGNGG  388

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+D GTSVTRL + AY+A+RDAFR GAS LK + EFSLFDTC+DLSGKT VKVPTVVLH
Sbjct  389  VIIDCGTSVTRLNKPAYIALRDAFRAGASSLKSAPEFSLFDTCYDLSGKTTVKVPTVVLH  448

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA+NYLIPVD  G+FCFAFAGTTSGLSIIGNIQQQGFRVV+DLA SR+GF+ 
Sbjct  449  FRGADVSLPASNYLIPVDGSGRFCFAFAGTTSGLSIIGNIQQQGFRVVYDLASSRVGFSP  508

Query  166  SGCA  155
             GCA
Sbjct  509  RGCA  512



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   296 bits (759),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPL+ NPKLDTFYYVEL G S+GG RV GI  S+FKLD  GNGG
Sbjct  303  SSVVFGDSAVSRTARFTPLIANPKLDTFYYVELIGXSVGGTRVPGITASLFKLDRAGNGG  362

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR+AY A+RDAFR G S LK   +FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  363  VILDSGTSVTRLTRSAYNALRDAFRAGTSGLKRGPQFSLFDTCFDLSGKTEVKVPTVVLH  422

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FR ADVSLPAANYLIPVD+ G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+ 
Sbjct  423  FRNADVSLPAANYLIPVDSSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSP  482

Query  166  SGCA  155
             GCA
Sbjct  483  RGCA  486



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   297 bits (761),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGD+A+SR A FTPL+ NPKLDTFYYVEL GIS+GG RVRG+ PS+FKLD  GNGG
Sbjct  334  SSMVFGDAAISRLARFTPLIRNPKLDTFYYVELIGISVGGVRVRGVYPSLFKLDSAGNGG  393

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY A+RDAFR GA  LK   EFSLFDTC+DLSG++ VKVPTVVLH
Sbjct  394  VIIDSGTSVTRLTRPAYTALRDAFRAGARHLKRGPEFSLFDTCYDLSGQSSVKVPTVVLH  453

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGAD+ LPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA 
Sbjct  454  FRGADMPLPATNYLIPVDENGSFCFAFAGTISGLSIIGNIQQQGFRVVYDLAGSRIGFAP  513

Query  166  SGC  158
             GC
Sbjct  514  RGC  516



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   295 bits (755),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 160/184 (87%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S IVFG+SAV+R+ +FTPLLTNPKLDTFYYVELTGIS+GG +V  + P +FKLD  GNGG
Sbjct  274  SYIVFGESAVTRNTIFTPLLTNPKLDTFYYVELTGISVGGTKVPAVTPELFKLDAEGNGG  333

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR  Y+A+RDAFR GA DLK +  FSLFDTC+DLSGK + KVPT+VLH
Sbjct  334  VIVDSGTSVTRLTRPGYIAVRDAFRLGAKDLKRAPNFSLFDTCYDLSGKKQAKVPTMVLH  393

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F GADV+LPAANY+IPV+TEG++CF FAGT  GLSIIGNIQQQGFRVVFDLAGSRLGFA 
Sbjct  394  FAGADVALPAANYMIPVNTEGRYCFGFAGTNGGLSIIGNIQQQGFRVVFDLAGSRLGFAP  453

Query  166  SGCA  155
             GC+
Sbjct  454  RGCS  457



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPL+ NPKLDTFYYVEL G S+GG RV GI  S+FKLD  GNGG
Sbjct  303  SSVVFGDSAVSRTARFTPLIANPKLDTFYYVELIGXSVGGTRVPGITASLFKLDRAGNGG  362

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY A+RDAFR G S LK   +FSLFDTCFDLSGKTEVKVPTVVLH
Sbjct  363  VILDSGTSVTRLTRXAYNALRDAFRAGTSGLKRGPQFSLFDTCFDLSGKTEVKVPTVVLH  422

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FR ADVSLPAANYLIPVD+ G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+ 
Sbjct  423  FRNADVSLPAANYLIPVDSSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSP  482

Query  166  SGCA  155
             GCA
Sbjct  483  RGCA  486



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   296 bits (757),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 147/184 (80%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPLL NPKLDTFYYVEL GIS+GG RV GI  S+FKLD  GNGG
Sbjct  302  SSVVFGDSAVSRTARFTPLLANPKLDTFYYVELIGISVGGTRVPGITASLFKLDQAGNGG  361

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY A+RDAFR G S LK   +FSLFDTCFDLSG+TEVKVPTVVLH
Sbjct  362  VILDSGTSVTRLTRPAYNALRDAFRAGTSGLKRGPQFSLFDTCFDLSGRTEVKVPTVVLH  421

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FR ADVSLPA NYLIPVD+ G FCFAFAGT  GLSIIGNIQQQGFRVV+DLAGSR+GF+ 
Sbjct  422  FRNADVSLPATNYLIPVDSSGSFCFAFAGTMGGLSIIGNIQQQGFRVVYDLAGSRVGFSP  481

Query  166  SGCA  155
             GCA
Sbjct  482  RGCA  485



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   294 bits (753),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 160/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGDSAVSR+A FTPLL NPKLDTFYYV L GIS+GGA VRG++ S+FKLD  GNGG
Sbjct  302  SSVVFGDSAVSRTARFTPLLKNPKLDTFYYVGLLGISVGGAPVRGVSASLFKLDTAGNGG  361

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+RDAFR GA+ LK + EFSLFDTCFDLSG TEVKVPT+VLH
Sbjct  362  VIIDSGTSVTRLTRPAYIALRDAFRLGATHLKKAPEFSLFDTCFDLSGLTEVKVPTLVLH  421

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F+GADVSLPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRV +DLA SR+GFA 
Sbjct  422  FQGADVSLPAQNYLIPVDNSGSFCFAFAGTMSGLSIIGNIQQQGFRVSYDLATSRVGFAP  481

Query  166  SGC  158
             GC
Sbjct  482  KGC  484



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLD  GNGG
Sbjct  298  SSVVFGNAAVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVTASLFKLDQIGNGG  357

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLH
Sbjct  358  VIIDSGTSVTRLIRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLH  417

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  418  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAP  477

Query  166  SGCA  155
             GCA
Sbjct  478  RGCA  481



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   293 bits (750),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 142/183 (78%), Positives = 159/183 (87%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGD+A+SR A FTPL+ NPKLDTFYYV L GIS+GG RVRG++PS+FKLD  GNGG
Sbjct  270  SSMVFGDAAISRLARFTPLIRNPKLDTFYYVGLIGISVGGVRVRGVSPSLFKLDSAGNGG  329

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY A+RDAFR GA  LK   EFSLFDTC+DLSG++ VKVPTVVLH
Sbjct  330  VIIDSGTSVTRLTRPAYTALRDAFRVGARHLKRGPEFSLFDTCYDLSGQSSVKVPTVVLH  389

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGAD++LPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRVV+DLAGSR+GFA 
Sbjct  390  FRGADMALPATNYLIPVDENGSFCFAFAGTISGLSIIGNIQQQGFRVVYDLAGSRIGFAP  449

Query  166  SGC  158
             GC
Sbjct  450  RGC  452



>gb|KJB09627.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=416

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGD+A+ R A+FTPLLTNPKLDTFYY+EL GIS+GG RV  I+PS+FK+D  GNGG
Sbjct  233  SSLVFGDAAIPRGALFTPLLTNPKLDTFYYIELLGISVGGTRVPKISPSLFKMDQDGNGG  292

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLT+ AY A RDAFR GA+ LK + +FSLFDTCFDLSG+T VKVPT+VLH
Sbjct  293  VIIDSGTSVTRLTQPAYTATRDAFRLGATHLKRAPDFSLFDTCFDLSGQTSVKVPTLVLH  352

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGAD+SLPA NYLIPVD+ G FCFAFAGT +GLSIIGNIQQQGFRV +DLAGSR+GF+ 
Sbjct  353  FRGADLSLPATNYLIPVDSSGTFCFAFAGTMNGLSIIGNIQQQGFRVAYDLAGSRVGFSP  412

Query  166  SGCA  155
             GCA
Sbjct  413  RGCA  416



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLD  GNGG
Sbjct  301  SSVVFGNAAVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGG  360

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLH
Sbjct  361  VIIDSGTSVTRLIRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLH  420

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  421  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAP  480

Query  166  SGCA  155
             GCA
Sbjct  481  RGCA  484



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   293 bits (751),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLD  GNGG
Sbjct  302  SSVVFGNAAVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGG  361

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLH
Sbjct  362  VIIDSGTSVTRLIRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLH  421

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  422  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAP  481

Query  166  SGCA  155
             GCA
Sbjct  482  RGCA  485



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   293 bits (749),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 145/184 (79%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLD  GNGG
Sbjct  302  SSVVFGNAAVSRIARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGG  361

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLH
Sbjct  362  VIIDSGTSVTRLIRPAYIAMRDAFRVGAKALKRAPDFSLFDTCFDLSNMNEVKVPTVVLH  421

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  422  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAP  481

Query  166  SGCA  155
             GCA
Sbjct  482  GGCA  485



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   291 bits (745),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 159/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S IVFG+SA++R+ +FTPLLTNPKLDTFYYVELTGIS+GG +V  + P +FKLD  GNGG
Sbjct  277  SYIVFGESAITRNTIFTPLLTNPKLDTFYYVELTGISVGGTKVPAVTPELFKLDTEGNGG  336

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR  Y+A+RDAFR GA DLK +  FSLFDTC+DLSGKT+ KVPT+VLH
Sbjct  337  VIVDSGTSVTRLTRPGYIAVRDAFRLGAKDLKRAPNFSLFDTCYDLSGKTQAKVPTLVLH  396

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F GADV+LPAANY+IPV+ EG++C  FAGT  GLSIIGNIQQQGFRVVFDLAGSRLGFA 
Sbjct  397  FAGADVALPAANYMIPVNGEGRYCLGFAGTNGGLSIIGNIQQQGFRVVFDLAGSRLGFAP  456

Query  166  SGCA  155
             GC+
Sbjct  457  RGCS  460



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score =   292 bits (747),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 140/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS++FGD+A+ R+AVFTPLLTNPKLDTFYYV+L GIS+GG RV  I PS+FK+D  GNGG
Sbjct  305  SSLLFGDTAIPRTAVFTPLLTNPKLDTFYYVQLLGISVGGTRVPKIRPSLFKMDRDGNGG  364

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AY+A+R+AFR G+S+LK +  FSLFDTC+D SGKT VKVPTVVLH
Sbjct  365  VIIDSGTSVTRLTRPAYIALRNAFRLGSSNLKRAPAFSLFDTCYDFSGKTSVKVPTVVLH  424

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVD+ G FCFAFAGT SGLSIIGNIQQQGF V +DLAGSR+GF  
Sbjct  425  FRGADVSLPATNYLIPVDSSGTFCFAFAGTMSGLSIIGNIQQQGFLVAYDLAGSRIGFKP  484

Query  166  SGCA  155
            +GCA
Sbjct  485  NGCA  488



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score =   291 bits (745),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 161/184 (88%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGD+A+ R A+FTPLLTNPKLDTFYY+EL GIS+GG RV  I+PS+FK+D  GNGG
Sbjct  305  SSLVFGDAAIPRGALFTPLLTNPKLDTFYYIELLGISVGGTRVPKISPSLFKMDQDGNGG  364

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLT+ AY A RDAFR GA+ LK + +FSLFDTCFDLSG+T VKVPT+VLH
Sbjct  365  VIIDSGTSVTRLTQPAYTATRDAFRLGATHLKRAPDFSLFDTCFDLSGQTSVKVPTLVLH  424

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGAD+SLPA NYLIPVD+ G FCFAFAGT +GLSIIGNIQQQGFRV +DLAGSR+GF+ 
Sbjct  425  FRGADLSLPATNYLIPVDSSGTFCFAFAGTMNGLSIIGNIQQQGFRVAYDLAGSRVGFSP  484

Query  166  SGCA  155
             GCA
Sbjct  485  RGCA  488



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   291 bits (744),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/183 (76%), Positives = 163/183 (89%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG SAVSR+AVFTPL++NPKLDTFYYVEL GIS+GG+RV GI   +FK+D TGNGG
Sbjct  301  SSVVFGSSAVSRTAVFTPLISNPKLDTFYYVELVGISVGGSRVPGITGELFKIDRTGNGG  360

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR AY+A+RDAFR GA+ LK +  FSLFDTC+DLSGKTEV+VPTVV+H
Sbjct  361  VIVDSGTSVTRLTRPAYMALRDAFRAGATSLKSAPGFSLFDTCYDLSGKTEVRVPTVVMH  420

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            + GADV+LPA NYLIPVDT G+FCFAFAGT SGLSIIGNIQQQGFRV+FD+A +R+GF+ 
Sbjct  421  YNGADVALPANNYLIPVDTSGRFCFAFAGTMSGLSIIGNIQQQGFRVLFDVASNRVGFSP  480

Query  166  SGC  158
            + C
Sbjct  481  NAC  483



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   291 bits (744),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR+A FTPLL+NPKLDTFYYVEL GIS+GG RV G+  S+FKLD  GNGG
Sbjct  305  SSVVFGNAAVSRTARFTPLLSNPKLDTFYYVELLGISVGGTRVPGVAASLFKLDQIGNGG  364

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLH
Sbjct  365  VIIDSGTSVTRLIRPAYIAMRDAFRVGARTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLH  424

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FR ADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  425  FREADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLATSRVGFAP  484

Query  166  SGCA  155
             GCA
Sbjct  485  RGCA  488



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   290 bits (741),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 157/184 (85%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR A FTPLL+NPKLDTFYYV L GIS+GG RV G+  S+FKLD  GNGG
Sbjct  302  SSVVFGNAAVSRIARFTPLLSNPKLDTFYYVGLLGISVGGTRVPGVTASLFKLDQIGNGG  361

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDTCFDLS   EVKVPTVVLH
Sbjct  362  VIIDSGTSVTRLIRPAYIAMRDAFRVGAKTLKRAPDFSLFDTCFDLSNMNEVKVPTVVLH  421

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  422  FRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAP  481

Query  166  SGCA  155
             GCA
Sbjct  482  GGCA  485



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   290 bits (743),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 144/180 (80%), Positives = 159/180 (88%), Gaps = 1/180 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            RPSS +VFGD+AV R+A+ TPLLTNPKLDTFYY+EL GIS+GG RV  I PS+FK+D  G
Sbjct  303  RPSS-LVFGDAAVPRAAMLTPLLTNPKLDTFYYIELLGISVGGIRVPRITPSLFKMDQAG  361

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLTR AY+AMRDAFR GAS+LK + +FSLFDTCFDLSGKT VKVPTV
Sbjct  362  NGGVIIDSGTSVTRLTRPAYIAMRDAFRIGASNLKGAPDFSLFDTCFDLSGKTSVKVPTV  421

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            VLHFRGADVSLPA NYLIPVD  G FCFAFAGT SGLSIIGNIQQQGFRV +DLAGSR+G
Sbjct  422  VLHFRGADVSLPATNYLIPVDGSGTFCFAFAGTMSGLSIIGNIQQQGFRVSYDLAGSRIG  481



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   286 bits (732),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/184 (78%), Positives = 155/184 (84%), Gaps = 0/184 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG++AVSR A FTPLL+NPKLDTFYYV L GIS+GG RV G+  S+FKLD  GNGG
Sbjct  302  SSVVFGNAAVSRIARFTPLLSNPKLDTFYYVGLLGISVGGTRVPGVTASLFKLDQIGNGG  361

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRL R AY+AMRDAFR GA  LK +  FSLFDTCFDLS   EVKVPTVVLH
Sbjct  362  VIIDSGTSVTRLIRPAYIAMRDAFRVGAKTLKRAPNFSLFDTCFDLSNMNEVKVPTVVLH  421

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FR ADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQQGFRVV+DLA SR+GFA 
Sbjct  422  FRRADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQQGFRVVYDLASSRVGFAP  481

Query  166  SGCA  155
             GCA
Sbjct  482  GGCA  485



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 154/183 (84%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S+IVFGD A   +AV+TPLLT+PKLDTFYY+EL GIS+GG RVRG+  S+FK  P GNGG
Sbjct  328  STIVFGDGAAVNTAVYTPLLTSPKLDTFYYLELLGISVGGTRVRGVTASLFKTAPAGNGG  387

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTRAAYVA+RDAFR GAS LK +  +SLFDTCFDLSG T VKVPTVV H
Sbjct  388  VIIDSGTSVTRLTRAAYVALRDAFRAGASRLKRAPAYSLFDTCFDLSGMTTVKVPTVVFH  447

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F G DVSLPA NYLIPVD++G+FCFAFAGT  GLSI GNIQQQ FRVV+DL GSR+GFA 
Sbjct  448  FSGGDVSLPATNYLIPVDSKGRFCFAFAGTMGGLSIFGNIQQQSFRVVYDLIGSRVGFAP  507

Query  166  SGC  158
             GC
Sbjct  508  RGC  510



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   280 bits (717),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            +P S+IVFG+ AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RVRG++ S FKLD TG
Sbjct  298  KPPSTIVFGNDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATG  357

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLT++AYVA+RDAFR GA  LK +  +SLFDTCFDLSG + VKVPTV
Sbjct  358  NGGVIIDSGTSVTRLTQSAYVALRDAFRLGAKRLKRAPSYSLFDTCFDLSGMSTVKVPTV  417

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V HF G +VSLPA+NYLIPV+T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+G
Sbjct  418  VFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLTGSRVG  477

Query  175  FAASGC  158
            F    C
Sbjct  478  FLPRAC  483



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   280 bits (716),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            +P S+IVFG+ AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RVRG++ S FKLD TG
Sbjct  298  KPPSTIVFGNDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATG  357

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLT++AYVA+RDAFR GA  LK +  +SLFDTCFDLSG + VKVPTV
Sbjct  358  NGGVIIDSGTSVTRLTQSAYVALRDAFRLGAKRLKRAPSYSLFDTCFDLSGMSTVKVPTV  417

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V HF G +VSLPA+NYLIPV+T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+G
Sbjct  418  VFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLTGSRVG  477

Query  175  FAASGC  158
            F    C
Sbjct  478  FLPRAC  483



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 157/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S ++FG+SAV+R+ +FTPLLTN KL+TFYYVELTGIS+GG RV  I   +FKL   G+GG
Sbjct  291  SYLIFGESAVTRNTIFTPLLTNQKLNTFYYVELTGISVGGTRVPLITSELFKLGANGDGG  350

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLTR AYVA+RDAF  G  +LK +  +SLFDTC+DLSGKTEVKVPT+VLH
Sbjct  351  VIVDSGTSVTRLTRPAYVALRDAFSLGTKNLKRAPNYSLFDTCYDLSGKTEVKVPTLVLH  410

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F+ ADV+LPA+NYLIPV +EG+FCF FAGT SGLSIIGNIQQQGFRVVFDLAGSRLGFA 
Sbjct  411  FKDADVALPASNYLIPVSSEGRFCFGFAGTASGLSIIGNIQQQGFRVVFDLAGSRLGFAP  470

Query  166  SGC  158
             GC
Sbjct  471  RGC  473



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   279 bits (714),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 134/183 (73%), Positives = 158/183 (86%), Gaps = 0/183 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S ++FG++AV+R+ +FTPLLTN KL+TFYYVELTGIS+GG RV GI P +FKL   GNGG
Sbjct  291  SYLIFGETAVTRNTIFTPLLTNQKLNTFYYVELTGISVGGTRVPGITPELFKLGADGNGG  350

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VIVDSGTSVTRLT+ AYVA+RDAFR G  +LK +  +SLFDTC+DLSGKTEVKVPT+VLH
Sbjct  351  VIVDSGTSVTRLTQPAYVALRDAFRLGTKNLKRAPNYSLFDTCYDLSGKTEVKVPTLVLH  410

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            F+ AD++LPA+NYLIPV +  +FCF FAGT SGLSIIGNIQQQGFRVVFD+AGSRLGFA 
Sbjct  411  FKDADLALPASNYLIPVSSGRRFCFGFAGTASGLSIIGNIQQQGFRVVFDVAGSRLGFAP  470

Query  166  SGC  158
             GC
Sbjct  471  RGC  473



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGV  524
            +IVFG+ AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RV G++ S FKLD TGNGGV
Sbjct  305  TIVFGNDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDATGNGGV  364

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF  344
            I+DSGTSVTRLT++AYVA+RDAFR GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF
Sbjct  365  IIDSGTSVTRLTQSAYVALRDAFRLGATKLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHF  424

Query  343  RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAAS  164
             G +VSLPA+NYLIPV+TEG+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF + 
Sbjct  425  GGGEVSLPASNYLIPVNTEGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVGFLSR  484

Query  163  GC  158
             C
Sbjct  485  AC  486



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   276 bits (707),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            +P S+IVFG+ AV  ++VFT LLTNPKLDTFYY++L GIS+GG+RVRG++ S FKLDPTG
Sbjct  300  KPPSTIVFGNDAVRETSVFTTLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDPTG  359

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVI+DSGTSVTRLTR AYVA RDAF  GA+ LK +  +SLFDTCFDLSG T VKVPTV
Sbjct  360  DGGVIIDSGTSVTRLTRPAYVAFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTV  419

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V HF G DVSLPA+NYLIPV+T+G+FCFAFA T   LSIIGNIQQQGFRV +DL GSR+G
Sbjct  420  VFHFSGGDVSLPASNYLIPVNTQGRFCFAFASTMGSLSIIGNIQQQGFRVAYDLVGSRVG  479

Query  175  FAASGC  158
            F +  C
Sbjct  480  FMSGAC  485



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 157/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            +P S+I FG+ AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RVRG++ S FKLD TG
Sbjct  298  KPPSTIAFGNDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATG  357

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLT++AYVA+RDAFR  A  LK +  +SLFDTCFDLSG + VKVPTV
Sbjct  358  NGGVIIDSGTSVTRLTQSAYVALRDAFRLAAKRLKRAPSYSLFDTCFDLSGMSTVKVPTV  417

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V HF G +VSLPA+NYLIPV+T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+G
Sbjct  418  VFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLTGSRVG  477

Query  175  FAASGC  158
            F    C
Sbjct  478  FLPRAC  483



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   276 bits (706),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 157/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGV  524
            +IVFG++AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RV G++ S FKLD TGNGGV
Sbjct  302  TIVFGNAAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDATGNGGV  361

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF  344
            I+DSGTSVTRLT+ AYVA+RDAFR GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF
Sbjct  362  IIDSGTSVTRLTQPAYVALRDAFRLGATKLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHF  421

Query  343  RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAAS  164
             G +VSLPA+NYLIPV+TEG+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF + 
Sbjct  422  GGGEVSLPASNYLIPVNTEGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVGFLSR  481

Query  163  GC  158
             C
Sbjct  482  AC  483



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 147/185 (79%), Positives = 163/185 (88%), Gaps = 1/185 (1%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFG+SAV RSAVFTP+LTNP+LDTFYYVEL GIS+GG RV GI  S+FK+D  GNGG
Sbjct  300  SSVVFGESAVPRSAVFTPMLTNPRLDTFYYVELIGISVGGVRVPGITASLFKMDSAGNGG  359

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSGTSVTRLTR AYVA+RDAFR GA  LK +  FSLFDTC+DLSGKT VKVPTVV+H
Sbjct  360  VIIDSGTSVTRLTRPAYVALRDAFRAGAIQLKRAEGFSLFDTCYDLSGKTVVKVPTVVMH  419

Query  346  FR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFA  170
            FR GAD+SLPAANYLIPVD+ G FCFAFAGTTSGLSI+GNIQQQGFRVVFD A SR+GFA
Sbjct  420  FRGGADLSLPAANYLIPVDSNGIFCFAFAGTTSGLSIVGNIQQQGFRVVFDGASSRIGFA  479

Query  169  ASGCA  155
            A GCA
Sbjct  480  AHGCA  484



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            +P S+IVFG+ AV  ++VFT LLTNPKLDTFYY++L GIS+GG+RV G++ S FKLDPTG
Sbjct  300  KPPSTIVFGNDAVQETSVFTTLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDPTG  359

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVI+DSGTSVTRLTR AYVA RDAF  GA+ LK +  +SLFDTCFDLSG T VKVPTV
Sbjct  360  DGGVIIDSGTSVTRLTRPAYVAFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTV  419

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V HF G DVSLPA+NYLIPV+++G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+G
Sbjct  420  VFHFSGGDVSLPASNYLIPVNSQGRFCFAFAGTMGNLSIIGNIQQQGFRVAYDLVGSRVG  479

Query  175  FAASGC  158
            F +  C
Sbjct  480  FMSGAC  485



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   275 bits (703),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGV  524
            +IVFG+ AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RVRG++ S FKLD TG+GGV
Sbjct  302  TIVFGNDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATGSGGV  361

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF  344
            I+DSGTSVTRLT+ AYVA+RDAFR GA  LK +  +SLFDTCFDLSG T VKVPTVV HF
Sbjct  362  IIDSGTSVTRLTQPAYVALRDAFRLGARSLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHF  421

Query  343  RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAAS  164
             G +VSLPA+NYLIPV+T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF + 
Sbjct  422  GGGEVSLPASNYLIPVNTQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRIGFLSR  481

Query  163  GC  158
             C
Sbjct  482  AC  483



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   275 bits (703),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGV  524
            +IVFGD AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RVRG++ S FKLD TG+GGV
Sbjct  307  TIVFGDDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDATGSGGV  366

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF  344
            I+DSGTSVTRLT+ AYVA+RDAFR GA+ LK +  +SLFDTCFDLSG   VKVPTVV HF
Sbjct  367  IIDSGTSVTRLTQPAYVALRDAFRLGATSLKRAPPYSLFDTCFDLSGMKTVKVPTVVFHF  426

Query  343  RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAAS  164
             G +VSLPA+NYLIPV+T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF + 
Sbjct  427  GGGEVSLPASNYLIPVNTQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRIGFLSR  486

Query  163  GC  158
             C
Sbjct  487  AC  488



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   275 bits (702),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 156/182 (86%), Gaps = 0/182 (0%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGV  524
            +IVFG+ AV ++AVFTPLLTNPKLDTFYY++L GIS+GG+RV G++ S FKLD TGNGGV
Sbjct  303  TIVFGNGAVPKTAVFTPLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDATGNGGV  362

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF  344
            I+DSGTSVTRLT++AYVA+RDAFR GA+ LK +  +SLFDTCFDLSG T VKVPTVV HF
Sbjct  363  IIDSGTSVTRLTQSAYVALRDAFRLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHF  422

Query  343  RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAAS  164
             G +VSLPA+NYLIPV+ +G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF + 
Sbjct  423  TGGEVSLPASNYLIPVNNQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVGFLSR  482

Query  163  GC  158
             C
Sbjct  483  AC  484



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/186 (71%), Positives = 156/186 (84%), Gaps = 0/186 (0%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            +P S+IVFG+ AV  ++VFT LLTNPKLDTFYY++L GIS+GG+RV G++ S FKLDPTG
Sbjct  300  KPPSTIVFGNDAVPETSVFTTLLTNPKLDTFYYLQLLGISVGGSRVPGVSESQFKLDPTG  359

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVI+DSGTSVTRLTR AYVA RDAF  GA+ LK +  +SLFDTCFDLSG T VKVPTV
Sbjct  360  DGGVIIDSGTSVTRLTRPAYVAFRDAFLLGATRLKRAPSYSLFDTCFDLSGMTTVKVPTV  419

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V HF G DVSLPA+NYLIPV+++G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+G
Sbjct  420  VFHFSGGDVSLPASNYLIPVNSQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRVG  479

Query  175  FAASGC  158
            F +  C
Sbjct  480  FMSGAC  485



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   274 bits (700),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 158/186 (85%), Gaps = 0/186 (0%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            +P S+IVFG+ AV +++VFTPL+TNPKLDTFYY++L GIS+GG RV G++ + FKLD +G
Sbjct  300  KPPSTIVFGNDAVPKTSVFTPLVTNPKLDTFYYLQLLGISVGGTRVPGVSETQFKLDASG  359

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            NGGVI+DSGTSVTRLT++AYVA+RDAFR GAS LK +  +SLFDTC+DL G T VKVPTV
Sbjct  360  NGGVIIDSGTSVTRLTQSAYVALRDAFRLGASKLKRAPSYSLFDTCYDLIGMTTVKVPTV  419

Query  355  VLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            V HF G +VSLPA+NYLIPV+T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+G
Sbjct  420  VFHFGGGEVSLPASNYLIPVNTQGRFCFAFAGTIGSLSIIGNIQQQGFRVAYDLVGSRVG  479

Query  175  FAASGC  158
            F +  C
Sbjct  480  FLSRAC  485



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   273 bits (697),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 155/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGV  524
            +IVFG+ AV +++VFTPLLTNPKLDTFYY++L GIS+GG+RVRG++ S FKLD TG+GGV
Sbjct  305  TIVFGNDAVPKTSVFTPLLTNPKLDTFYYLQLLGISVGGSRVRGVSESQFKLDSTGSGGV  364

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF  344
            I+DSGTSVTRL + AYVA+RDAFR GA  LK +  +SLFDTCFDLSG T VKVPTVV HF
Sbjct  365  IIDSGTSVTRLAQPAYVALRDAFRLGARSLKRAPSYSLFDTCFDLSGMTTVKVPTVVFHF  424

Query  343  RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAAS  164
             G +VSLPA+NYLIPV+T+G+FCFAFAGT   LSIIGNIQQQGFRV +DL GSR+GF + 
Sbjct  425  GGGEVSLPASNYLIPVNTQGRFCFAFAGTMGSLSIIGNIQQQGFRVAYDLVGSRIGFLSR  484

Query  163  GC  158
             C
Sbjct  485  AC  486



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   258 bits (658),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 156/190 (82%), Gaps = 6/190 (3%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAV---FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-  542
            SSS+VFGDSAV R+     +TP++ NPK+DTFYYVELTGIS+GG+RV G++    +LDP 
Sbjct  318  SSSVVFGDSAVPRAGAAVAYTPMVRNPKMDTFYYVELTGISVGGSRVAGVSAVDLRLDPA  377

Query  541  TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKV  365
            TG GGVIVDSGTSVTRL R AY AMRDAF+ GA+DL+ +   FSLFDTC++L+GKTEVKV
Sbjct  378  TGRGGVIVDSGTSVTRLARPAYAAMRDAFKAGAADLREAPGGFSLFDTCYNLAGKTEVKV  437

Query  364  PTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTVV+H  G A VSLPA NYLIPVDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD A 
Sbjct  438  PTVVMHLGGGASVSLPAENYLIPVDTKGTFCFAFAGTDSGVSIIGNIQQQGFRVVFDGAR  497

Query  187  SRLGFAASGC  158
            SR+GF   GC
Sbjct  498  SRVGFMPRGC  507



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   256 bits (654),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 124/185 (67%), Positives = 148/185 (80%), Gaps = 1/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +SS++FG +A+ +SA+FTPLL+NPKLDTFYYVEL GIS+GG R+  I  SVF++D TGNG
Sbjct  311  ASSLIFGKAAIPKSAIFTPLLSNPKLDTFYYVELVGISVGGRRLTSIPASVFRMDATGNG  370

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGTSVTRL  +AY  MRDAFR G  +LK +  FSLFDTC+DLSG   VKVPT+V 
Sbjct  371  GVIIDSGTSVTRLVDSAYSTMRDAFRVGTGNLKSAGGFSLFDTCYDLSGLKTVKVPTLVF  430

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF+ GA +SLPA NYLIPVD+   FCFAFAG T GLSIIGNIQQQG+RVVFD   +R+GF
Sbjct  431  HFQGGAHISLPATNYLIPVDSSATFCFAFAGNTGGLSIIGNIQQQGYRVVFDSLANRVGF  490

Query  172  AASGC  158
             A  C
Sbjct  491  KAGSC  495



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 155/190 (82%), Gaps = 6/190 (3%)
 Frame = -3

Query  709  SSSIVFGDSAVSR---SAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-  542
            SSS+VFG SAV R   +  +TP+L NP++DTFYYVEL GIS+GG+RV G++ +V +LDP 
Sbjct  315  SSSVVFGGSAVPRPGAAVAYTPMLRNPRMDTFYYVELMGISVGGSRVAGVSAAVLRLDPA  374

Query  541  TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKV  365
            TG GGVIVDSGTSVTRL R AY AMRDAF+  A++L+ +   FSLFDTC++L+G+T+VKV
Sbjct  375  TGKGGVIVDSGTSVTRLARQAYAAMRDAFKAAAAELREAPGGFSLFDTCYNLAGRTQVKV  434

Query  364  PTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTVV+H  G A VSLPA NYLIPVDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD A 
Sbjct  435  PTVVMHLGGGAAVSLPAENYLIPVDTKGTFCFAFAGTDSGVSIIGNIQQQGFRVVFDGAQ  494

Query  187  SRLGFAASGC  158
            SR+GF   GC
Sbjct  495  SRVGFMPLGC  504



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   250 bits (639),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 150/190 (79%), Gaps = 6/190 (3%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAV---FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT  539
            SSS+VFG SAV RS+    +TP++ NPK+DTFYYVEL G+S+GG RV G+  S  +LDPT
Sbjct  310  SSSVVFGGSAVPRSSARVAYTPMVRNPKVDTFYYVELMGVSVGGTRVTGVLASDLRLDPT  369

Query  538  -GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKV  365
             G GGVIVDSGTSVTRL R AY A+RDAF+ G S LK     FSLFDTC+DLSG+TEVKV
Sbjct  370  TGRGGVIVDSGTSVTRLARPAYQALRDAFKAGVSGLKLAPGGFSLFDTCYDLSGRTEVKV  429

Query  364  PTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTVVLH  G A VSLPA NYLIPVDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD   
Sbjct  430  PTVVLHLAGGAAVSLPAENYLIPVDTKGTFCFAFAGTDSGVSIIGNIQQQGFRVVFDAEK  489

Query  187  SRLGFAASGC  158
            SR+GF   GC
Sbjct  490  SRVGFMPRGC  499



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   250 bits (638),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 155/190 (82%), Gaps = 6/190 (3%)
 Frame = -3

Query  709  SSSIVFGDSAVSR---SAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-  542
            SS +VFGDSAV R   +  FTP+L NPK+DTFYYVELTGIS+GG++V G++ +  +L+P 
Sbjct  319  SSLVVFGDSAVPRPGAAVAFTPMLRNPKMDTFYYVELTGISVGGSQVAGVSAADLRLNPA  378

Query  541  TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKV  365
            TG GGVIVDSGTSVTRL R AY A+RDAF+ GA++L+ +   FSLFDTC++L+GKTEVKV
Sbjct  379  TGKGGVIVDSGTSVTRLVRPAYAALRDAFKAGAAELREAPGGFSLFDTCYNLAGKTEVKV  438

Query  364  PTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTVV+H  G A V LPA NYLIPVDT+G FCFAFAGT SG+SIIGNIQQQGFRVVFD A 
Sbjct  439  PTVVMHLGGGASVPLPAENYLIPVDTKGTFCFAFAGTESGVSIIGNIQQQGFRVVFDGAR  498

Query  187  SRLGFAASGC  158
            SR+GF   GC
Sbjct  499  SRVGFLPRGC  508



>ref|XP_008795461.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=343

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/192 (66%), Positives = 152/192 (79%), Gaps = 8/192 (4%)
 Frame = -3

Query  709  SSSIVFGDSAVS-----RSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLD  545
            SSS+VFGDS  +      +  FTP+L NPK DTFYYVELT IS+GG+RV G++ +   L+
Sbjct  152  SSSLVFGDSESAVPGPGAAVAFTPMLRNPKADTFYYVELTAISVGGSRVAGVSAAGLGLN  211

Query  544  P-TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEV  371
            P TG GGVIVDSGTSVTRL R AY A+RDAF+ GA++L+ +   FSLFDTC+DL+GKTEV
Sbjct  212  PATGRGGVIVDSGTSVTRLARPAYAALRDAFKAGAAELREAPGGFSLFDTCYDLAGKTEV  271

Query  370  KVPTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDL  194
            KVPTVV+H  G A V+LPA NYLIPVDT+G FCFAFA T +G+SIIGNIQQQGFRVVFD+
Sbjct  272  KVPTVVMHLGGGASVALPAENYLIPVDTKGTFCFAFAETDNGVSIIGNIQQQGFRVVFDV  331

Query  193  AGSRLGFAASGC  158
            A SR+GF   GC
Sbjct  332  ARSRVGFLPRGC  343



>dbj|BAF01866.1| chloroplast nucleoid DNA binding protein like [Arabidopsis thaliana]
Length=142

 Score =   227 bits (579),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = -3

Query  580  VRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDT  401
            V G+  S+FKLD  GNGGVI+DSGTSVTRL R AY+AMRDAFR GA  LK + +FSLFDT
Sbjct  1    VPGVTASLFKLDQIGNGGVIIDSGTSVTRLIRPAYIAMRDAFRVGAKTLKRAPDFSLFDT  60

Query  400  CFDLSGKTEVKVPTVVLHFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQ  221
            CFDLS   EVKVPTVVLHFRGADVSLPA NYLIPVDT GKFCFAFAGT  GLSIIGNIQQ
Sbjct  61   CFDLSNMNEVKVPTVVLHFRGADVSLPATNYLIPVDTNGKFCFAFAGTMGGLSIIGNIQQ  120

Query  220  QGFRVVFDLAGSRLGFAASGCA  155
            QGFRVV+DLA SR+GFA  GCA
Sbjct  121  QGFRVVYDLASSRVGFAPGGCA  142



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score =   235 bits (599),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 147/189 (78%), Gaps = 5/189 (3%)
 Frame = -3

Query  709  SSSIVFGDSAV--SRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-T  539
            SS++ FG  AV  S SA FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP T
Sbjct  305  SSTVTFGPGAVGPSASASFTPMVRNPRMETFYYVQLVGISVGGARVPGVAESDLRLDPST  364

Query  538  GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVP  362
            G GGVIVDSGTSVTRL R AY A+RDAFR  A+ L+ S S FSLFDTC+DL G+  VKVP
Sbjct  365  GRGGVIVDSGTSVTRLARPAYSALRDAFRGAAAGLRLSPSGFSLFDTCYDLGGRKVVKVP  424

Query  361  TVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGS  185
            TV +HF G A+ +LP  NYLIPVD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G 
Sbjct  425  TVSMHFAGGAEAALPPENYLIPVDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQ  484

Query  184  RLGFAASGC  158
            R+GFA  GC
Sbjct  485  RVGFAPKGC  493



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   234 bits (596),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGV  524
            S+ FG+     + VFT ++ NPKLDTFYY+ L GIS+GGAR+  I+ S+F+LDPTGNGGV
Sbjct  307  SLSFGNLPNPSTTVFTTMIKNPKLDTFYYLGLVGISVGGARLP-ISSSLFRLDPTGNGGV  365

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF  344
            IVDSGTSVTRL  +AY  +RDAFR GA+ L  +  FSLFDTC++L G+  VKVPT+V HF
Sbjct  366  IVDSGTSVTRLVSSAYDVVRDAFRAGATGLPLADSFSLFDTCYNLGGRDVVKVPTMVFHF  425

Query  343  R-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
              GAD+SLPA+NYLIPV+ +G FCFAFAGT SGLSIIGNIQQQGF VVFD   SR+GF  
Sbjct  426  DGGADLSLPASNYLIPVNNQGVFCFAFAGTRSGLSIIGNIQQQGFSVVFDGKNSRIGFVP  485

Query  166  SGCA  155
             GCA
Sbjct  486  KGCA  489



>ref|NP_001183392.1| uncharacterized protein LOC100501808 [Zea mays]
 gb|ACR36629.1| unknown [Zea mays]
Length=342

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 145/190 (76%), Gaps = 7/190 (4%)
 Frame = -3

Query  709  SSSIVFGDSAV-SRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-TG  536
            SS++ FG  +V + SA FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP TG
Sbjct  154  SSTVSFGAGSVGASSASFTPMVRNPRMETFYYVQLVGISVGGARVPGVAESDLRLDPSTG  213

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD---LKPSSEFSLFDTCFDLSGKTEVKV  365
             GGVIVDSGTSVTRL RA+Y A+RDAFR  A+    L P   FSLFDTC+DL G+  VKV
Sbjct  214  RGGVIVDSGTSVTRLARASYSALRDAFRAAAAGGLRLSPGG-FSLFDTCYDLGGRRVVKV  272

Query  364  PTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTV +HF G A+ +LP  NYLIPVD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G
Sbjct  273  PTVSMHFAGGAEAALPPENYLIPVDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDG  332

Query  187  SRLGFAASGC  158
             R+GFA  GC
Sbjct  333  QRVGFAPKGC  342



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 145/189 (77%), Gaps = 5/189 (3%)
 Frame = -3

Query  709  SSSIVFGDSAVSRS--AVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-  539
            SS++ FG  AV  +  A FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP+ 
Sbjct  306  SSTVTFGSGAVGSTVAASFTPMVKNPRMETFYYVQLVGISVGGARVSGVADSDLRLDPSS  365

Query  538  GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVP  362
            G GGVIVDSGTSVTRL R AY A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVP
Sbjct  366  GRGGVIVDSGTSVTRLARPAYSALRDAFRAAAAGLRLSPGGFSLFDTCYDLSGRKVVKVP  425

Query  361  TVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGS  185
            TV +HF G A+ +LP  NYLIPVD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G 
Sbjct  426  TVSMHFAGGAEAALPPENYLIPVDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQ  485

Query  184  RLGFAASGC  158
            R+GF   GC
Sbjct  486  RVGFVPKGC  494



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score =   229 bits (583),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 145/190 (76%), Gaps = 7/190 (4%)
 Frame = -3

Query  709  SSSIVFGDSAV-SRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-TG  536
            SS++ FG  +V + SA FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP TG
Sbjct  297  SSTVSFGAGSVGASSASFTPMVRNPRMETFYYVQLVGISVGGARVPGVAESDLRLDPSTG  356

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASD---LKPSSEFSLFDTCFDLSGKTEVKV  365
             GGVIVDSGTSVTRL RA+Y A+RDAFR  A+    L P   FSLFDTC+DL G+  VKV
Sbjct  357  RGGVIVDSGTSVTRLARASYSALRDAFRAAAAGGLRLSPGG-FSLFDTCYDLGGRRVVKV  415

Query  364  PTVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTV +HF G A+ +LP  NYLIPVD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G
Sbjct  416  PTVSMHFAGGAEAALPPENYLIPVDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDG  475

Query  187  SRLGFAASGC  158
             R+GFA  GC
Sbjct  476  QRVGFAPKGC  485



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 5/186 (3%)
 Frame = -3

Query  700  IVFGDSAV--SRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-TGNG  530
            + FG  AV  S +A FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP TG G
Sbjct  315  VTFGSGAVGPSAAASFTPMVKNPRMETFYYVQLMGISVGGARVPGVAVSDLRLDPSTGRG  374

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVV  353
            GVIVDSGTSVTRL R AY A+RDAFR  A+ L+ S   FSLFDTC+DLSG   VKVPTV 
Sbjct  375  GVIVDSGTSVTRLARPAYAALRDAFRAAAAGLRLSPGGFSLFDTCYDLSGLKVVKVPTVS  434

Query  352  LHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            +HF G A+ +LP  NYLIPVD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G RLG
Sbjct  435  MHFAGGAEAALPPENYLIPVDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRLG  494

Query  175  FAASGC  158
            F   GC
Sbjct  495  FVPKGC  500



>dbj|BAJ86414.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   227 bits (578),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 143/189 (76%), Gaps = 5/189 (3%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAV--FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-  539
            SS++ FG  AV  +    FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP+ 
Sbjct  304  SSTVTFGSGAVGSTVASSFTPMVKNPRMETFYYVQLIGISVGGARVPGVANSDLRLDPSS  363

Query  538  GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVP  362
            G GGVIVDSGTSVTRL R AY A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVP
Sbjct  364  GRGGVIVDSGTSVTRLARPAYSALRDAFRGAAAGLRLSPGGFSLFDTCYDLSGRKVVKVP  423

Query  361  TVVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGS  185
            TV +HF G A+ +LP  NYLIPVD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G 
Sbjct  424  TVSMHFAGGAEAALPPENYLIPVDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQ  483

Query  184  RLGFAASGC  158
            R+ F   GC
Sbjct  484  RVAFTPKGC  492



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score =   226 bits (575),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = -3

Query  703  SIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-TGNGG  527
            ++ FG  + S +A FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP TG GG
Sbjct  310  TVTFGPPSAS-AASFTPMVRNPRMETFYYVQLVGISVGGARVPGVAESDLRLDPSTGRGG  368

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVL  350
            VIVDSGTSVTRL R +Y A+RDAFR  A+ L+ S   FSLFDTC+DL G+  VKVPTV +
Sbjct  369  VIVDSGTSVTRLARPSYSALRDAFRAAAAGLRLSPGGFSLFDTCYDLGGRKVVKVPTVSM  428

Query  349  HFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G A+ +LP  NYLIPVD+ G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+GF
Sbjct  429  HFAGGAEAALPPENYLIPVDSRGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRVGF  488

Query  172  AASGC  158
            A  GC
Sbjct  489  APKGC  493



>gb|EMS49734.1| Aspartic proteinase nepenthesin-1 [Triticum urartu]
Length=352

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 141/187 (75%), Gaps = 5/187 (3%)
 Frame = -3

Query  703  SIVFGDSAVSRSAV--FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            ++ FG  A+  +    FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP+ G 
Sbjct  166  TVTFGSGALGSTVASSFTPMVKNPRMETFYYVQLIGISVGGARVPGVANSDLRLDPSSGR  225

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTV  356
            GGVIVDSGTSVTRL R AY A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVPTV
Sbjct  226  GGVIVDSGTSVTRLARPAYSALRDAFRGAAAGLRLSPGGFSLFDTCYDLSGRKVVKVPTV  285

Query  355  VLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRL  179
             +HF G A+ +LP  NYLIPVD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+
Sbjct  286  SMHFAGGAEAALPPENYLIPVDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRV  345

Query  178  GFAASGC  158
             F   GC
Sbjct  346  AFVPKGC  352



>emb|CDM83204.1| unnamed protein product [Triticum aestivum]
Length=492

 Score =   222 bits (566),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 141/187 (75%), Gaps = 5/187 (3%)
 Frame = -3

Query  703  SIVFGDSAVSRSAV--FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            ++ FG  A+  +    FTP++ NP+++TFYYV+L GIS+GGARV G+  S  +LDP+ G 
Sbjct  306  TVTFGSGALGSTVASSFTPMVKNPRMETFYYVQLIGISVGGARVPGVANSDLRLDPSSGR  365

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTV  356
            GGVIVDSGTSVTRL R AY A+RDAFR  A+ L+ S   FSLFDTC+DLSG+  VKVPTV
Sbjct  366  GGVIVDSGTSVTRLARPAYSALRDAFRGAAAGLRLSPGGFSLFDTCYDLSGRKVVKVPTV  425

Query  355  VLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRL  179
             +HF G A+ +LP  NYLIPVD++G FCFAFAGT  G+SIIGNIQQQGFRVVFD  G R+
Sbjct  426  SMHFAGGAEAALPPENYLIPVDSKGTFCFAFAGTDGGVSIIGNIQQQGFRVVFDGDGQRV  485

Query  178  GFAASGC  158
             F   GC
Sbjct  486  AFVPKGC  492



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score =   219 bits (558),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 138/185 (75%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FG +AV   AV  P+L N +LDTFYYV L+GIS+GG ++  I+ SVF +D +GNG
Sbjct  302  SSTLQFGRAAVPNGAVLAPMLKNSRLDTFYYVSLSGISVGG-KMLSISDSVFGIDASGNG  360

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL  AAY ++RDAFR G  +L  +   SLFDTC+DLS K  V VPTVV 
Sbjct  361  GVIVDSGTAVTRLQTAAYDSLRDAFRAGTKNLPSTDGVSLFDTCYDLSSKESVDVPTVVF  420

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  +SLPA NYL+PVD+ G FCFAFA T+S LSI+GNIQQQG RV FD A +++GF
Sbjct  421  HFSGGGSMSLPAKNYLVPVDSMGTFCFAFAPTSSSLSIVGNIQQQGIRVSFDRANNQVGF  480

Query  172  AASGC  158
            A + C
Sbjct  481  AVNKC  485



>ref|XP_001757102.1| predicted protein [Physcomitrella patens]
 gb|EDQ77961.1| predicted protein [Physcomitrella patens]
Length=406

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 140/185 (76%), Gaps = 4/185 (2%)
 Frame = -3

Query  706  SSIVFGDSAVSRS-AVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS+VFG++AV  + A FTP  +N ++ TFYY+++TGIS+GG  +  I  S F+LD  GNG
Sbjct  223  SSLVFGEAAVPPAGARFTPQDSNMRVPTFYYLKMTGISVGGT-ILTIPTSAFQLDSLGNG  281

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGTSVTRL  AAY ++RDAFR G SDL P++ FSLFDTC+DLSG   V VPTV L
Sbjct  282  GVIIDSGTSVTRLQNAAYASLRDAFRAGTSDLAPTAGFSLFDTCYDLSGLASVDVPTVTL  341

Query  349  HFRGA-DVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF+G  D+ LPA+NYLIPVD    FC AFAGTT G SIIGNIQQQGFRV++D   +++GF
Sbjct  342  HFQGGTDLKLPASNYLIPVDNSNTFCLAFAGTT-GPSIIGNIQQQGFRVIYDNLHNQVGF  400

Query  172  AASGC  158
              S C
Sbjct  401  VPSQC  405



>ref|XP_001759252.1| predicted protein [Physcomitrella patens]
 gb|EDQ75936.1| predicted protein [Physcomitrella patens]
Length=385

 Score =   213 bits (542),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 142/185 (77%), Gaps = 4/185 (2%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAV-FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++FGD+AV  + V FTP  +N ++ TFYY+++TGIS+GG+ +  I  S F+LD  GNG
Sbjct  202  SSLIFGDAAVPPAGVRFTPQASNLRVSTFYYLKMTGISVGGS-ILTIPTSAFQLDSLGNG  260

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGTSVTRL  AAY ++R+AFR G SDL  ++EFSLFDTC++LS  + V VPTV L
Sbjct  261  GVIIDSGTSVTRLQNAAYASLREAFRAGTSDLVLTTEFSLFDTCYNLSDLSSVDVPTVTL  320

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF+ GAD+ LPA+NYL+PVD    FC AFAGTT G SIIGNIQQQGFRV++D   +++GF
Sbjct  321  HFQGGADLKLPASNYLVPVDNSSTFCLAFAGTT-GPSIIGNIQQQGFRVIYDNLHNQVGF  379

Query  172  AASGC  158
              S C
Sbjct  380  VPSQC  384



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 126/184 (68%), Gaps = 42/184 (23%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS+VFGD+A+ R A+FTPLLTNPKLDTFYY+EL GIS+GG RV  I+PS+FK+D  GNGG
Sbjct  305  SSLVFGDAAIPRGALFTPLLTNPKLDTFYYIELLGISVGGTRVPKISPSLFKMDQDGNGG  364

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSG                                          +T VKVPT+VLH
Sbjct  365  VIIDSG------------------------------------------QTSVKVPTLVLH  382

Query  346  FRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAA  167
            FRGAD+SLPA NYLIPVD+ G FCFAFAGT +GLSIIGNIQQQGFRV +DLAGSR+GF+ 
Sbjct  383  FRGADLSLPATNYLIPVDSSGTFCFAFAGTMNGLSIIGNIQQQGFRVAYDLAGSRVGFSP  442

Query  166  SGCA  155
             GCA
Sbjct  443  RGCA  446



>ref|XP_002529147.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF33260.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=479

 Score =   211 bits (537),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 136/185 (74%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +SA+   A+  PLL N +LDTFYYV +TG+S+GG  +  I  S+F++D +GNG
Sbjct  296  SASTLEFNSALLPHAITAPLLRNRELDTFYYVGMTGLSVGG-ELLSIPESMFEMDESGNG  354

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL  AAY A+RDAF KG  DL  +SE +LFDTC+DLS KT V+VPTV  
Sbjct  355  GIIIDSGTAVTRLQTAAYNALRDAFVKGTKDLPVTSEVALFDTCYDLSRKTSVEVPTVTF  414

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            H  G  V  LPA NYLIPVD++G FCFAFA T+S LSIIGN+QQQG RV FDLA S +GF
Sbjct  415  HLAGGKVLPLPATNYLIPVDSDGTFCFAFAPTSSALSIIGNVQQQGTRVGFDLANSLVGF  474

Query  172  AASGC  158
                C
Sbjct  475  EPRQC  479



>ref|XP_002971459.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
 gb|EFJ27208.1| hypothetical protein SELMODRAFT_64134, partial [Selaginella moellendorffii]
Length=357

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVF--TPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP  542
            R SS+++FGDSA+  SA F  T LL NPKLDTFYY  L+GISIGG  +  I  + FKL  
Sbjct  169  RASSALLFGDSALPTSASFAYTQLLKNPKLDTFYYAGLSGISIGGTLL-SIPSTAFKLSS  227

Query  541  -TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKV  365
             TG GGVI+DSGTSVTRL   AY  MRDAFR     L  +++FSLFDTC+D S  T V +
Sbjct  228  STGRGGVIIDSGTSVTRLPTYAYTVMRDAFRSATQKLPRAADFSLFDTCYDFSALTSVTI  287

Query  364  PTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTV  HF  GA V LP +NYL+PVDT G FCFAF+ T+  LSIIGNIQQQ  RV  DL  
Sbjct  288  PTVSFHFEGGASVQLPPSNYLVPVDTSGTFCFAFSKTSLDLSIIGNIQQQTMRVAIDLDS  347

Query  187  SRLGFAASGC  158
            SR+GFA   C
Sbjct  348  SRVGFAPRQC  357



>ref|XP_002966033.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
 gb|EFJ33453.1| hypothetical protein SELMODRAFT_64135, partial [Selaginella moellendorffii]
Length=357

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 113/190 (59%), Positives = 131/190 (69%), Gaps = 5/190 (3%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVF--TPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP  542
            R SS+++FGDSA+  SA F  T LL NPKLDTFYY  L+GISIGG  +  I  + FKL  
Sbjct  169  RASSALLFGDSALPTSASFAYTQLLKNPKLDTFYYAGLSGISIGGTLL-SIPSTAFKLSS  227

Query  541  -TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKV  365
             TG GGVI+DSGTSVTRL   AY  MRDAFR     L  +++FSLFDTC+D S  T V +
Sbjct  228  STGRGGVIIDSGTSVTRLPTYAYTVMRDAFRSATQKLPRAADFSLFDTCYDFSALTSVTI  287

Query  364  PTVVLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAG  188
            PTV  HF  GA V LP +NYL+PVDT G FCFAF+ T+  LSIIGNIQQQ  RV  DL  
Sbjct  288  PTVSFHFEGGASVQLPPSNYLVPVDTSGTFCFAFSKTSLDLSIIGNIQQQTMRVAIDLDS  347

Query  187  SRLGFAASGC  158
            SR+GFA   C
Sbjct  348  SRVGFAPRQC  357



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score =   208 bits (530),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PL+ N K+DTFYYV LTG S+GG  V  + PS+F +D +GNG
Sbjct  305  SSTLEF-NSAPPADSVTAPLVQNGKVDTFYYVGLTGFSVGGQPV-SVPPSLFAVDQSGNG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY ++RDAF++  SDL  +S F+LFDTC+DLS +T V+VPTV  
Sbjct  363  GIIVDSGTAITRLQTQAYNSLRDAFKRFTSDLPTASSFALFDTCYDLSSRTRVQVPTVAF  422

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G  +SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +DLA  R+GF
Sbjct  423  QFSGGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSSLSIIGNVQQQGIRVSYDLANKRVGF  482

Query  172  AASGC  158
            + + C
Sbjct  483  SPNKC  487



>ref|XP_004299230.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=492

 Score =   208 bits (529),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 137/185 (74%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +V  PLL + K+DTFYYV LTG+S+GG R   I PS+F++D +GNG
Sbjct  309  SSSTLEFNSAAPGDSVIAPLLKSRKVDTFYYVGLTGLSVGG-RPVSIPPSLFQMDESGNG  367

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL  AAY A+RD F++   DL  +  F+LFDTC+DLSG+T V+VPTV  
Sbjct  368  GIIVDSGTAITRLQTAAYDALRDQFKRLTPDLPAAGNFALFDTCYDLSGRTSVRVPTVSF  427

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   ++LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG RV +DLA +R+GF
Sbjct  428  LFAGGKSLALPAKNYLIPVDNSGTFCFAFAPTSSSLSIIGNVQQQGTRVSYDLANNRVGF  487

Query  172  AASGC  158
            + + C
Sbjct  488  SPNKC  492



>gb|EPS61272.1| hypothetical protein M569_13524, partial [Genlisea aurea]
Length=489

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  DS +   +V  PL+ NPK+ T+YYV+L+GIS+GG  +  I P  F L  +G G
Sbjct  306  SSSTLDFDSPLPSDSVAAPLVRNPKISTYYYVDLSGISVGGQSL-PIPPETFALTDSGTG  364

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGT+VTRL   AY +MRDAF+KG +DL P++  SLFDTC+DLS +  V+VPTV  
Sbjct  365  GVIIDSGTAVTRLQSDAYSSMRDAFKKGTADLPPANAVSLFDTCYDLSSRKSVEVPTVSF  424

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G +V LPA NY+IPVD+ G FCFAFA T+S L IIGN+QQQG RV +DLA S +GF
Sbjct  425  HFSNGKEVKLPAKNYMIPVDSSGTFCFAFAPTSSSLGIIGNVQQQGTRVSYDLANSLVGF  484

Query  172  AASGC  158
            + + C
Sbjct  485  SPNKC  489



>ref|XP_011077177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Sesamum 
indicum]
Length=492

 Score =   207 bits (528),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S  S  AV  PL+ N KLDTFYYV+LTGIS+ G  +  I PS F+L+  GNG
Sbjct  309  SASTLEFNSVPSPDAVTAPLVRNSKLDTFYYVDLTGISVAG-ELLPIPPSTFQLNDNGNG  367

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY +MRDAF+KG  DL  +   +LFDTC+DLS +  V+VPTV  
Sbjct  368  GVIVDSGTAVTRLQTEAYNSMRDAFKKGTKDLASTEGVALFDTCYDLSSRKSVEVPTVAF  427

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++SLPA NY+IPVD+ G FCFAFA T+S L IIGN+QQQG RV +DL  S +GF
Sbjct  428  HFGNGKELSLPAKNYMIPVDSSGTFCFAFAPTSSSLGIIGNVQQQGTRVSYDLTNSLIGF  487

Query  172  AASGC  158
            + + C
Sbjct  488  SPNKC  492



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score =   207 bits (527),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F  +A    +VF PL+ N K+DTFYYV LTG+S+GG  V  I PS+F++D +G+G
Sbjct  313  SSTLDFNSAAPGAESVFAPLVKNGKVDTFYYVGLTGMSVGGKTV-SIPPSLFQMDESGDG  371

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY ++RDAF K   DLK +S  +LFDTC+D S  + V+VPTV  
Sbjct  372  GIIVDSGTAITRLQTQAYNSLRDAFVKLTPDLKSTSGVALFDTCYDFSSLSSVQVPTVSF  431

Query  349  HFRGA-DVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   ++LPA NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV FDLA SR+GF
Sbjct  432  QFTGGRSLALPAKNYLIPVDSAGTFCFAFAPTTSSLSIIGNVQQQGTRVTFDLANSRVGF  491

Query  172  AASGC  158
              + C
Sbjct  492  TPNKC  496



>ref|XP_006374138.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
 gb|ABK94105.1| unknown [Populus trichocarpa]
 gb|ERP51935.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
Length=499

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F  + +   +V  PL+ N K+DTFYYV L+G+S+GG  V  I  S F+LD +GNG
Sbjct  315  SSTLDFNSAQLGVDSVTAPLMKNRKIDTFYYVGLSGMSVGGQMV-SIPESTFRLDESGNG  373

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVD GT++TRL   AY  +RDAF +   +LK +S  +LFDTC+DLSG+  V+VPTV  
Sbjct  374  GIIVDCGTAITRLQTQAYNPLRDAFVRMTQNLKLTSAVALFDTCYDLSGQASVRVPTVSF  433

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G   +LPAANYLIPVD+ G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF
Sbjct  434  HFADGKSWNLPAANYLIPVDSAGTYCFAFAPTTSSLSIIGNVQQQGTRVTFDLANNRMGF  493

Query  172  AASGC  158
            + + C
Sbjct  494  SPNKC  498



>gb|KDP20100.1| hypothetical protein JCGZ_05869 [Jatropha curcas]
Length=493

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 134/185 (72%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F   +V  S V  PL+ + K+DTFYYV LTGISIGG  +  I  S+F+LD +GNG
Sbjct  311  SSTLDFNSGSVGDS-VIAPLMKSRKIDTFYYVGLTGISIGG-HMLSIPESIFQLDESGNG  368

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVD GT++TRL   AY ++RDAF      LK +S  +LFDTC+DLSG+  VKVPTV  
Sbjct  369  GVIVDCGTAITRLQSQAYSSLRDAFVSMTQHLKSTSGVALFDTCYDLSGQNSVKVPTVSF  428

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF +G   +LPA NYLIPVD++G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF
Sbjct  429  HFSQGQSWNLPAMNYLIPVDSDGTYCFAFAPTTSSLSIIGNVQQQGTRVSFDLANNRVGF  488

Query  172  AASGC  158
            +   C
Sbjct  489  STDKC  493



>gb|KCW48530.1| hypothetical protein EUGRSUZ_K02206 [Eucalyptus grandis]
Length=497

 Score =   207 bits (527),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 135/185 (73%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F  +A    +VF PL+ N K+DTFYYV LTG+S+GG  V  I PS+F++D +G+G
Sbjct  314  SSTLDFNSAAPGAESVFAPLVKNGKVDTFYYVGLTGMSVGGKTV-SIPPSLFQMDESGDG  372

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY ++RDAF K   DLK +S  +LFDTC+D S  + V+VPTV  
Sbjct  373  GIIVDSGTAITRLQTQAYNSLRDAFVKLTPDLKSTSGVALFDTCYDFSSLSSVQVPTVSF  432

Query  349  HFRGA-DVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   ++LPA NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV FDLA SR+GF
Sbjct  433  QFTGGRSLALPAKNYLIPVDSAGTFCFAFAPTTSSLSIIGNVQQQGTRVTFDLANSRVGF  492

Query  172  AASGC  158
              + C
Sbjct  493  TPNKC  497



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 3/171 (2%)
 Frame = -3

Query  661  FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTR  485
            FTP+  NP++ TFYYV L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R
Sbjct  305  FTPMGRNPRMATFYYVHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLAR  364

Query  484  AAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAAN  311
              Y A+RDAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  N
Sbjct  365  PVYEAVRDAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPEN  424

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YLIPVDT G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  425  YLIPVDTSGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  475



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 3/171 (2%)
 Frame = -3

Query  661  FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTR  485
            FTP+  NP++ TFYYV L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R
Sbjct  311  FTPMGRNPRMATFYYVHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLAR  370

Query  484  AAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAAN  311
              Y A+RDAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  N
Sbjct  371  PVYEAVRDAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPEN  430

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YLIPVDT G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  431  YLIPVDTSGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  481



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 107/171 (63%), Positives = 126/171 (74%), Gaps = 3/171 (2%)
 Frame = -3

Query  661  FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTR  485
            FTP+  NP++ TFYYV L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R
Sbjct  305  FTPMGRNPRMATFYYVHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLAR  364

Query  484  AAYVAMRDAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAAN  311
              Y A+RDAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  N
Sbjct  365  PVYEAVRDAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPEN  424

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YLIPVDT G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  425  YLIPVDTSGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  475



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 127/178 (71%), Gaps = 2/178 (1%)
 Frame = -3

Query  688  DSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSG  509
            DS  SR AV  PL  NP+LDT+YYV L GIS+GG  +  I  + F++D  GNGG+IVDSG
Sbjct  291  DSPFSRDAVTAPLRRNPQLDTYYYVGLVGISVGG-ELLAIPETSFEVDSAGNGGIIVDSG  349

Query  508  TSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGAD  332
            T+VTRL    Y  +RDAF KG  DL  ++E SLFDTC+DLS KT V+VPTV  HF  G  
Sbjct  350  TAVTRLQSDVYNVVRDAFVKGTKDLLATNEVSLFDTCYDLSSKTSVEVPTVAFHFGEGKV  409

Query  331  VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            + LPA NYL+PVD+ G FCFAFA T S LSIIGNIQQQG RV FDLA S +GF+ + C
Sbjct  410  LVLPAKNYLVPVDSVGTFCFAFAPTMSSLSIIGNIQQQGTRVSFDLANSLVGFSPNRC  467



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 130/187 (70%), Gaps = 2/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            R SSS++FG +A+  +A  +PLL NPKLDTFYY  + G+S+GGA++  I+    +L  +G
Sbjct  297  RSSSSLIFGAAAIPSTAALSPLLKNPKLDTFYYAAMIGVSVGGAQL-PISLKSLQLSQSG  355

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVI+DSGTSVTR   + Y  +RDAFR   ++L  +  +SLFDTC++ SGK  V VP +
Sbjct  356  SGGVIIDSGTSVTRFPTSVYATIRDAFRNATTNLPSAPRYSLFDTCYNFSGKASVDVPAL  415

Query  355  VLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRL  179
            VLHF  GAD+ LP  NYLIP++T G FC AFA T+  L IIGNIQQQ FR+ FDL  S L
Sbjct  416  VLHFENGADLQLPPTNYLIPINTAGSFCLAFAPTSMELGIIGNIQQQSFRIGFDLQKSHL  475

Query  178  GFAASGC  158
             FA   C
Sbjct  476  AFAPQQC  482



>ref|XP_004497116.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=469

 Score =   206 bits (524),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 133/184 (72%), Gaps = 3/184 (2%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S+I F DS  SR AV  PL  NP+L TFYYV LTGIS+GG  +  I  + F++DPTG+GG
Sbjct  288  STIEF-DSPFSRDAVTAPLRRNPELSTFYYVGLTGISVGG-ELLPIPETSFEVDPTGSGG  345

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            +IVDSGT+VTRL    Y  +RDAF++G  DL  +++ SLFDTC+DLS KT V+VPTV  H
Sbjct  346  IIVDSGTAVTRLQSNVYNLVRDAFKRGTKDLPATNDVSLFDTCYDLSSKTSVEVPTVAFH  405

Query  346  F-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFA  170
            F  G  + LPA NYL+PVD+ G FCFAFA T S LSIIGNIQQQG RV FDL  S +GF+
Sbjct  406  FGEGKGLVLPAKNYLVPVDSVGTFCFAFAPTMSSLSIIGNIQQQGTRVSFDLGRSIVGFS  465

Query  169  ASGC  158
             + C
Sbjct  466  PNSC  469



>ref|XP_010265215.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nelumbo 
nucifera]
Length=494

 Score =   206 bits (525),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  D+     AV  PLL N +LDTFYYV LTGIS+GG  +  I PS+F +D +GNG
Sbjct  311  SSSTLEFDAPEPSDAVTAPLLRNTQLDTFYYVGLTGISVGG-ELLSIPPSLFAVDESGNG  369

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY ++RDAF KG  DL  +S  +LFDTC+DLS KT V+VPTV  
Sbjct  370  GVIVDSGTAVTRLKTEAYNSLRDAFVKGTGDLPSTSGVALFDTCYDLSSKTSVEVPTVTF  429

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   + LPA NYL+PVD++G FCFAFA T+S LSIIGNIQQQG RV  D   S +GF
Sbjct  430  HFPGGKSLPLPAKNYLVPVDSQGTFCFAFAPTSSALSIIGNIQQQGTRVSVDFQKSVVGF  489

Query  172  AASGC  158
            + S C
Sbjct  490  SPSKC  494



>ref|XP_002978584.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
 gb|EFJ20570.1| hypothetical protein SELMODRAFT_54048, partial [Selaginella moellendorffii]
Length=407

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 129/187 (69%), Gaps = 2/187 (1%)
 Frame = -3

Query  715  RPSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTG  536
            R SSS++FG +A+  +A  +PLL NPKLDTFYY  + G+S+GGA++  I+    +L  +G
Sbjct  222  RSSSSLIFGVAAIPSTAALSPLLKNPKLDTFYYAAMIGVSVGGAQLP-ISLKSLQLSQSG  280

Query  535  NGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTV  356
            +GGVI+DSGTSVTR   + Y  +RDAFR    +L  +  +SLFDTC++ SGK  V VP +
Sbjct  281  SGGVIIDSGTSVTRFPTSVYATIRDAFRNATINLPSAPRYSLFDTCYNFSGKASVDVPAL  340

Query  355  VLHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRL  179
            VLHF  GAD+ LP  NYLIP++T G FC AFA T+  L IIGNIQQQ FR+ FDL  S L
Sbjct  341  VLHFENGADLQLPPTNYLIPINTAGSFCLAFAPTSMELGIIGNIQQQSFRIGFDLQKSHL  400

Query  178  GFAASGC  158
             FA   C
Sbjct  401  AFAPQQC  407



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = -3

Query  712  PSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGN  533
            P+S ++  +SA    AV  PL+ N K+DTFYYV LTG S+GG  V+ I PS+F++D  G+
Sbjct  311  PASGVLEFNSARGGDAVTAPLIRNKKVDTFYYVGLTGFSVGGQAVQ-IPPSLFEMDEAGD  369

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GG+IVD GT++TRL   AY ++RD+F + A +LKP+S  +LFDTC+D SG   V+VPTV 
Sbjct  370  GGIIVDCGTAITRLQTQAYNSLRDSFVRLAGNLKPTSGVALFDTCYDFSGLRSVRVPTVS  429

Query  352  LHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            LHF  G  + LPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV FDLA +R+G
Sbjct  430  LHFGAGKALDLPAKNYLIPVDSAGTFCFAFAPTSSALSIIGNVQQQGTRVSFDLANNRVG  489

Query  175  FAASGC  158
            F  + C
Sbjct  490  FTPNKC  495



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score =   205 bits (522),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = -3

Query  712  PSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGN  533
            P+S ++  +SA    AV  PL+ N K+DTFYYV LTG S+GG  V+ I PS+F++D  G+
Sbjct  311  PASGVLEFNSARGGDAVTAPLIRNKKVDTFYYVGLTGFSVGGQAVQ-IPPSLFEMDEAGD  369

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GG+IVD GT++TRL   AY ++RD+F + A +LKP+S  +LFDTC+D SG   V+VPTV 
Sbjct  370  GGIIVDCGTAITRLQTQAYNSLRDSFVRLAGNLKPTSGVALFDTCYDFSGLRSVRVPTVS  429

Query  352  LHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            LHF  G  + LPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV FDLA +R+G
Sbjct  430  LHFGAGKALDLPAKNYLIPVDSAGTFCFAFAPTSSALSIIGNVQQQGTRVSFDLANNRVG  489

Query  175  FAASGC  158
            F  + C
Sbjct  490  FTPNKC  495



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FG S +   AV  PL+ N +LDTFYY+ LTGIS+GG  +  I+ S F++D +G G
Sbjct  300  SSTVEFG-SDIPNDAVVAPLMRNHQLDTFYYLGLTGISVGGEMLE-ISASSFEMDESGGG  357

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGTSVTRL    Y ++RDAF KG +DL+ + E ++FDTC+DLSGKT ++VP+V  
Sbjct  358  GVIIDSGTSVTRLQTGVYDSLRDAFVKGTTDLERAGEVAMFDTCYDLSGKTTIEVPSVAF  417

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G ++ +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S + F
Sbjct  418  HFPGGNMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIRF  477

Query  172  AASGC  158
            +A+ C
Sbjct  478  SANKC  482



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score =   205 bits (521),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = -3

Query  712  PSSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGN  533
            P+S ++  +SA    AV  PL+ N K+DTFYYV LTG S+GG  V+ I PS+F++D  G+
Sbjct  311  PASGVLEFNSARGGDAVTAPLIRNKKVDTFYYVGLTGFSVGGQAVQ-IPPSLFEMDEAGD  369

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GG+IVD GT++TRL   AY ++RD+F + A +LKP+S  +LFDTC+D SG   V+VPTV 
Sbjct  370  GGIIVDCGTAITRLQTQAYNSLRDSFVRLAGNLKPTSGVALFDTCYDFSGLRSVRVPTVS  429

Query  352  LHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            LHF  G  + LPA NYLIPVD+ G FCFAFA T+S +SIIGN+QQQG RV FDLA +R+G
Sbjct  430  LHFGAGKALDLPAKNYLIPVDSAGTFCFAFAPTSSAMSIIGNVQQQGTRVSFDLANNRVG  489

Query  175  FAASGC  158
            F  + C
Sbjct  490  FTPNKC  495



>gb|KJB41527.1| hypothetical protein B456_007G108800, partial [Gossypium raimondii]
Length=460

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            SS++FGD+ + R+ +FT LLTNPKLDTFYY+EL GIS+G   VRGI PS+FK+DP GNGG
Sbjct  296  SSMIFGDAPIPRTTMFTSLLTNPKLDTFYYIELLGISVGRTCVRGIMPSLFKMDPAGNGG  355

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            VI+DSG SVTRLTR AY+AMRD FR  AS+LK    FSLFDTCFDLS KT VKVPTVVLH
Sbjct  356  VIIDSGMSVTRLTRPAYIAMRDVFRIRASNLKRVPNFSLFDTCFDLSDKTSVKVPTVVLH  415

Query  346  FRGADVSLPAANYL  305
            FRGADVSLP  NYL
Sbjct  416  FRGADVSLPVTNYL  429



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score =   204 bits (520),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++  G SA S + V  PLL N KLDTFYYV L+GIS+GG ++  I PS F +D +G+G
Sbjct  329  SSTLELGASAASGAEVAAPLLRNRKLDTFYYVGLSGISVGG-KMLSIPPSSFAMDESGSG  387

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY A+RDAFR+G + L  +   SLFDTC+DLS +T V+VPTV  
Sbjct  388  GVIVDSGTAVTRLQADAYGALRDAFRRGTAGLPAAEGVSLFDTCYDLSSRTSVEVPTVGF  447

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF +G ++ LPA NYLIPVD  G +C AFA TT+ LSIIGN+QQQG RV FDL  S +GF
Sbjct  448  HFPQGRELRLPAKNYLIPVDGVGTYCLAFAPTTAPLSIIGNVQQQGIRVSFDLDNSVVGF  507

Query  172  AASGC  158
              + C
Sbjct  508  TPNNC  512



>ref|XP_006415880.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
 gb|ESQ34233.1| hypothetical protein EUTSA_v10009899mg [Eutrema salsugineum]
Length=487

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 139/185 (75%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S +SR AV  PLL N +LDTFYY+ LTGIS+GG  ++ I  S F++D +G+G
Sbjct  305  ASTVEFG-SGLSRDAVMAPLLRNHQLDTFYYLGLTGISVGGELLQ-IPASSFEMDESGSG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RDAF KG +DL+ ++  ++FDTC++LS KT ++VPTV  
Sbjct  363  GIIIDSGTAVTRLQTEVYNSLRDAFVKGTTDLERAAGVAMFDTCYNLSAKTTIEVPTVAF  422

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   ++LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF
Sbjct  423  HFPGGKMMALPAKNYMIPVDSVGTFCLAFAPTGSSLAIIGNVQQQGTRVAFDLANSLIGF  482

Query  172  AASGC  158
            +++ C
Sbjct  483  SSNKC  487



>ref|XP_003637416.1| Aspartic proteinase nepenthesin-2, partial [Medicago truncatula]
Length=165

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/166 (60%), Positives = 120/166 (72%), Gaps = 2/166 (1%)
 Frame = -3

Query  652  LLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAYV  473
            L  NP+LDT+YYV L GIS+GG  +  I  + F++D  GNGG+IVDSGT+VTRL    Y 
Sbjct  1    LRRNPQLDTYYYVGLVGISVGG-ELLAIPETSFEVDSAGNGGIIVDSGTAVTRLQSDVYN  59

Query  472  AMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIPV  296
             +RDAF KG  DL  ++E SLFDTC+DLS KT V+VPTV  HF  G  + LPA NYL+PV
Sbjct  60   VVRDAFVKGTKDLLATNEVSLFDTCYDLSSKTSVEVPTVAFHFGEGKVLVLPAKNYLVPV  119

Query  295  DTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            D+ G FCFAFA T S LSIIGNIQQQG RV FDLA S +GF+ + C
Sbjct  120  DSVGTFCFAFAPTMSSLSIIGNIQQQGTRVSFDLANSLVGFSPNRC  165



>ref|XP_010926497.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Elaeis guineensis]
Length=508

 Score =   203 bits (517),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++  G  + S +AV  P+L N KLDTFYYV L+GIS+GGA +  I PS F +D +G+G
Sbjct  325  SSTLELGGGSASTAAVAAPMLRNRKLDTFYYVGLSGISVGGAML-SIPPSAFAMDESGSG  383

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY A+RDAFR+G + L  ++  SLFDTC+DLS +T V VPTV  
Sbjct  384  GVIVDSGTAVTRLQAEAYEALRDAFRRGTAGLPAAAGVSLFDTCYDLSSRTSVDVPTVAF  443

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYLIPVD  G +C AFA T + LSIIGN+QQQG RV FDL  S +GF
Sbjct  444  HFPEGRELRLPAKNYLIPVDGVGTYCLAFAPTKAPLSIIGNVQQQGTRVSFDLDKSVVGF  503

Query  172  AASGC  158
              + C
Sbjct  504  TPNNC  508



>ref|XP_007153356.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
 gb|ESW25350.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
Length=483

 Score =   202 bits (515),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 129/178 (72%), Gaps = 2/178 (1%)
 Frame = -3

Query  688  DSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSG  509
            DS + R+AV  PL+ NP+LDTFYY+ L GIS+GG  ++ +  S F +D TG GG+IVDSG
Sbjct  307  DSPMPRNAVTAPLMRNPELDTFYYLGLKGISVGGETLQ-VPESSFAVDATGGGGIIVDSG  365

Query  508  TSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGAD  332
            T+VTRL    Y A+RDAF +G   L  ++  SLFDTC+DLS +  V VPTV LHF  G +
Sbjct  366  TAVTRLRSEVYDALRDAFVRGTKGLPKTNGVSLFDTCYDLSSRNSVDVPTVSLHFPEGRE  425

Query  331  VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            + LPA NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV FD+  S +GF+A+ C
Sbjct  426  LPLPAKNYLIPVDSVGTFCFAFAPTTSSLSIIGNVQQQGTRVSFDIGNSLVGFSANSC  483



>gb|KDO36875.1| hypothetical protein CISIN_1g037264mg, partial [Citrus sinensis]
Length=249

 Score =   196 bits (498),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  DS++  +AV  PLL N +LDTFYY+ LTGIS+GG  +  I+ + FK+D +GNG
Sbjct  66   STSTLEFDSSLPPNAVTAPLLRNHELDTFYYLGLTGISVGG-DLLPISETAFKIDESGNG  124

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  
Sbjct  125  GIIVDSGTAVTRLQTETYNALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSF  184

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF
Sbjct  185  HFPEGKVLPLPAKNYLIPVDSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLIGF  244

Query  172  AASGC  158
              + C
Sbjct  245  TPNKC  249



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   202 bits (515),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PLL + K+ TFYYV LTG S+GG  V  + PS+F +D +GNG
Sbjct  305  SSTLEF-NSAPPADSVTAPLLQSGKVSTFYYVGLTGFSVGGQPV-SVPPSLFAVDESGNG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY ++RDAF++   DL  +S F+LFDTC+DLS +T V+VPTV  
Sbjct  363  GIIVDSGTAITRLQTQAYNSLRDAFKRYTRDLPTASSFALFDTCYDLSSRTRVQVPTVAF  422

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G  +SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +DLA  R+GF
Sbjct  423  QFSGGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSSLSIIGNVQQQGTRVSYDLANKRVGF  482

Query  172  AASGC  158
            + + C
Sbjct  483  SPNKC  487



>ref|XP_011004863.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=501

 Score =   202 bits (515),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F    +   +V  PL+ N K+DTFYYV L+G+S+GG  V  I  S F+LD +GNG
Sbjct  317  SSTLDFNSVQLGVDSVTAPLMKNRKIDTFYYVGLSGMSVGGQMV-SIPESAFRLDESGNG  375

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVD GT++TRL   AY  +RDAF +   +LK +   +LFDTC+DLSG+  V+VPTV  
Sbjct  376  GIIVDCGTAITRLQTQAYNPLRDAFVRMTQNLKVAGAVALFDTCYDLSGQASVRVPTVSF  435

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G   +LPAANY+IPVD+ G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF
Sbjct  436  HFADGKSWNLPAANYMIPVDSAGTYCFAFAPTTSSLSIIGNVQQQGTRVTFDLANNRMGF  495

Query  172  AASGC  158
            + + C
Sbjct  496  SPNKC  500



>ref|XP_010460347.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 138/185 (75%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S + R AV  PLL N +LDTFYYV LTGIS+GG  ++ I  S F++D +G+G
Sbjct  300  ASTVEFGTS-LPRDAVEAPLLRNHQLDTFYYVGLTGISVGGELLQ-IPQSSFEMDESGSG  357

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  
Sbjct  358  GIIIDSGTAVTRLQTGIYNSLRDSFLKGTSDLEKANGVAMFDTCYNLSTKTTIEVPTVAF  417

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  + +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF
Sbjct  418  HFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGF  477

Query  172  AASGC  158
            +++ C
Sbjct  478  SSNKC  482



>ref|XP_007036465.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY20966.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=491

 Score =   202 bits (514),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 131/184 (71%), Gaps = 1/184 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +S ++  +V  PLL N K+DTFYYV LTG S+GG  V+ +   +F +D +G G
Sbjct  309  SSSTLDFNSGLTSDSVTAPLLRNQKIDTFYYVGLTGFSVGGQPVQ-LPTGLFDMDASGKG  367

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVD GT+VTRL   AY A+RDAF K   DL  +S  +LFDTC+DLS +T V+VPTV  
Sbjct  368  GVIVDCGTAVTRLQTQAYNALRDAFVKLTHDLPTASGVALFDTCYDLSSRTSVRVPTVAF  427

Query  349  HFRGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFA  170
            HF G  + LPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV FDLA +++GF+
Sbjct  428  HFGGQSLDLPAKNYLIPVDSSGVFCFAFAPTSSSLSIIGNVQQQGTRVSFDLANNKVGFS  487

Query  169  ASGC  158
               C
Sbjct  488  PRKC  491



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score =   202 bits (513),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FG S +   AV  PL+ N +LDTFYY+ L GIS+GG  +  I  S F++D +G G
Sbjct  300  SSTVEFG-SDIPSDAVVAPLMRNHQLDTFYYLGLAGISVGGEMLE-IPASSFEMDESGGG  357

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGT+VTRL    Y ++RDAF KG +DL+ ++  ++FDTC+DLSGKT ++VP+V  
Sbjct  358  GVIIDSGTAVTRLQTGVYDSLRDAFVKGTTDLERAAGVAMFDTCYDLSGKTTIEVPSVAF  417

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G ++ +LPA NY+IPVDT G FC AFA T S L+IIGN+QQQG RV FDLA S +GF
Sbjct  418  HFPGGNMLALPAKNYMIPVDTVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGF  477

Query  172  AASGC  158
            +A+ C
Sbjct  478  SANKC  482



>ref|XP_008782298.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=513

 Score =   202 bits (514),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/185 (59%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FG ++ S SAV  PLL N KLDTFYYVEL+GIS+GG  +  I PS F +D +G+G
Sbjct  330  SSTLEFGGASASGSAVAAPLLRNRKLDTFYYVELSGISVGG-ELLSIPPSAFAMDESGSG  388

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY A+RDAFR+G S L  ++  SLFD+C+DLS +T V+VPTV  
Sbjct  389  GVIVDSGTAVTRLQAEAYEALRDAFRRGTSGLPAAAGVSLFDSCYDLSSRTSVEVPTVAF  448

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G D+ LPA NYLIPVD  G +C AFA T + LSIIGN+QQQG RV FDL  S +GF
Sbjct  449  HFPEGRDLRLPAKNYLIPVDGTGTYCLAFAPTKAPLSIIGNVQQQGTRVSFDLDNSVVGF  508

Query  172  AASGC  158
                C
Sbjct  509  TPKNC  513



>emb|CDP20336.1| unnamed protein product [Coffea canephora]
Length=484

 Score =   201 bits (512),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 106/185 (57%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F DS V   AV  PLL NPKLDTFYY++LTGIS+ G  +  + PS FKL   G G
Sbjct  302  SSTLDF-DSVVPADAVTAPLLQNPKLDTFYYLDLTGISVAG-ELLPVPPSNFKLADNGEG  359

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGT+VTRL    Y A+RDAF KG  +L  ++  +LFDTCF L  +  V+VPTV  
Sbjct  360  GVIIDSGTAVTRLPTETYNALRDAFVKGTKNLPSANGVALFDTCFALGSRKSVEVPTVSF  419

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G D+SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +D+A S + F
Sbjct  420  HFSNGKDLSLPAKNYLIPVDSTGTFCFAFAPTSSTLSIIGNVQQQGTRVSYDIAHSLIAF  479

Query  172  AASGC  158
            +++ C
Sbjct  480  SSNKC  484



>gb|EYU40867.1| hypothetical protein MIMGU_mgv1a023461mg [Erythranthe guttata]
Length=479

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +SA    AV  PL+ N KLDTFYYV++TGIS+ G  +  I PS F+++  G+G
Sbjct  296  SASTLEFNSAAPPDAVTAPLVRNSKLDTFYYVDVTGISVAG-DLLPIPPSTFEMNDNGSG  354

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY +MRDAFRKG  +L  ++  +LFDTC+DLS +  V+VPTV  
Sbjct  355  GVIVDSGTAVTRLQTEAYNSMRDAFRKGTKELPTAAGVALFDTCYDLSSRKSVEVPTVSF  414

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  +SLPA NY+IPVD+ G FCFAFA T S L IIGN+QQQG RV +DLA S +GF
Sbjct  415  HFSNGKSLSLPAKNYIIPVDSSGTFCFAFAPTASELGIIGNVQQQGTRVSYDLANSLIGF  474

Query  172  AASGC  158
            + + C
Sbjct  475  SPNKC  479



>gb|KDO70056.1| hypothetical protein CISIN_1g0117492mg, partial [Citrus sinensis]
Length=243

 Score =   194 bits (493),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  DS++  +AV  PLL N +LDTFYY+ LTGIS+GG  +  I+ + FK+D +GNG
Sbjct  60   STSTLEFDSSLPPNAVTAPLLRNHELDTFYYLGLTGISVGG-DLLPISETAFKIDESGNG  118

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  
Sbjct  119  GIIVDSGTAVTRLQTETYNALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSF  178

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA N+LIPVD+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF
Sbjct  179  HFPEGKVLPLPAKNFLIPVDSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLVGF  238

Query  172  AASGC  158
              + C
Sbjct  239  TPNKC  243



>ref|XP_002511962.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF50631.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=495

 Score =   201 bits (511),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F  + V  S V  PLL + K+DTFYYV L+G+S+GG  +R I   VFKLD +G+G
Sbjct  313  SSTLDFNSAPVGDS-VIAPLLKSSKIDTFYYVGLSGMSVGGELLR-IPQEVFKLDDSGDG  370

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVD GT++TRL   AY ++RD+F   +  L+ +S  +LFDTC+DLSG++ VKVPTV  
Sbjct  371  GVIVDCGTAITRLQSEAYNSLRDSFVSMSRHLRSTSGVALFDTCYDLSGQSSVKVPTVSF  430

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G     LPAANYLIPVD+ G +CFAFA TTS LSIIGN+QQQG RV FDLA +R+GF
Sbjct  431  HFDGGKSWDLPAANYLIPVDSAGTYCFAFAPTTSSLSIIGNVQQQGTRVSFDLANNRVGF  490

Query  172  AASGC  158
            + + C
Sbjct  491  STNKC  495



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   200 bits (509),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S +   AV  PLL N +LDTFYYV LTGIS+GG  ++ I  S F++D +G+G
Sbjct  301  ASTVEFGTS-LQPDAVEAPLLRNHQLDTFYYVGLTGISVGGELLQ-IPQSSFEMDESGSG  358

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  
Sbjct  359  GIIIDSGTAVTRLQTGIYNSLRDSFLKGTSDLEKANGVAMFDTCYNLSSKTTIEVPTVAF  418

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  + +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF
Sbjct  419  HFPGGKMLALPAKNYMIPVDSMGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGF  478

Query  172  AASGC  158
            +++ C
Sbjct  479  SSNKC  483



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   199 bits (507),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PL+ + K+ TFYYV LTG S+GG  V  ++PS+F +D +GNG
Sbjct  305  SSTLEF-NSAPPADSVTAPLIKSGKVGTFYYVGLTGFSVGGQPV-SVSPSLFAVDDSGNG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY A+RDAF++   DL  +S FSLFDTC++LS +T+V+VPTV  
Sbjct  363  GIIVDSGTAITRLQTQAYNALRDAFKRLTRDLPTASSFSLFDTCYNLSSRTKVQVPTVSF  422

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   +SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF
Sbjct  423  QFSGGKSLSLPAKNYLIPVDSAGAFCFAFAPTSSQLSIIGNVQQQGTRVSYDFANKRVGF  482

Query  172  AASGC  158
            + + C
Sbjct  483  SPNKC  487



>gb|EMT00623.1| Aspartic proteinase nepenthesin-1 [Aegilops tauschii]
Length=246

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 129/185 (70%), Gaps = 4/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FGDS   + AV  PLL +P+ +TFYYV L+GIS+GG  +  I  S F +D  G+G
Sbjct  65   SSTLQFGDS--EQPAVTAPLLRSPRTNTFYYVGLSGISVGGQTLS-IPSSAFAMDDAGSG  121

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY A+R+AF +G   L  +S  SLFDTC+DL+G+  V+VP V L
Sbjct  122  GVIVDSGTAVTRLQSGAYGALREAFVQGTQSLPRASGISLFDTCYDLAGRQSVQVPAVAL  181

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G ++ LPA NYLIPVD  G +C AFAGT+  +SIIGN+QQQG RV FD A + +GF
Sbjct  182  RFEGGGELKLPAKNYLIPVDGAGTYCLAFAGTSGAVSIIGNVQQQGVRVSFDTAKNTVGF  241

Query  172  AASGC  158
             A  C
Sbjct  242  TADKC  246



>gb|KDP29378.1| hypothetical protein JCGZ_18299 [Jatropha curcas]
Length=484

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 131/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +  SAV  PLL N +LDTFYY+ +TG+S+GG  +  I  S FK+D +GNG
Sbjct  301  SASTLEFNSPILPSAVTAPLLRNHELDTFYYIGMTGLSVGG-ELLSIPESAFKIDESGNG  359

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL    Y ++RDAF KG   L  ++  +LFDTC+DLS K  V+VP +  
Sbjct  360  GIIVDSGTAITRLQTDVYNSLRDAFVKGTEGLPSTNSVALFDTCYDLSSKYSVEVPALSF  419

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NYLIPVD++G FCFAFA T S LSIIGN+QQQG RV FDLA SR+GF
Sbjct  420  HFPDGKVLPLPAKNYLIPVDSDGTFCFAFAPTASALSIIGNVQQQGTRVSFDLANSRIGF  479

Query  172  AASGC  158
              + C
Sbjct  480  EPNKC  484



>gb|EEE64882.1| hypothetical protein OsJ_19741 [Oryza sativa Japonica Group]
Length=456

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/164 (63%), Positives = 121/164 (74%), Gaps = 3/164 (2%)
 Frame = -3

Query  640  PKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GNGGVIVDSGTSVTRLTRAAYVAMR  464
            P++ TFYYV L G S+GGARV+G++ S  +L+PT G GGVI+DSGTSVTRL R  Y A+R
Sbjct  293  PRMATFYYVHLLGFSVGGARVKGVSQSDLRLNPTTGRGGVILDSGTSVTRLARPVYEAVR  352

Query  463  DAFRKGASDLKPS-SEFSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLPAANYLIPVDT  290
            DAFR  A  L+ S   FSLFDTC++LSG+  VKVPTV +H  G A V+LP  NYLIPVDT
Sbjct  353  DAFRAAAVGLRVSPGGFSLFDTCYNLSGRRVVKVPTVSMHLAGGASVALPPENYLIPVDT  412

Query  289  EGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
             G FCFA AGT  G+SIIGNIQQQGFRVVFD    R+GF    C
Sbjct  413  SGTFCFAMAGTDGGVSIIGNIQQQGFRVVFDGDAQRVGFVPKSC  456



>ref|XP_010499100.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=482

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S + R  V  PLL N +LDTFYYV LTGIS+GG  ++ I  S F++D +G+G
Sbjct  300  ASTVEFGTS-LPRDVVEAPLLRNHQLDTFYYVGLTGISVGGELLQ-IPQSSFEMDESGSG  357

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  
Sbjct  358  GIIIDSGTAVTRLQTGIYNSLRDSFLKGTSDLEKANGVAMFDTCYNLSTKTTIEVPTVAF  417

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  + +LPA NY+IPVD+ G FC AFA TTS L+IIGN+QQQG RV F LA S +GF
Sbjct  418  HFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTTSSLAIIGNVQQQGTRVTFYLANSLIGF  477

Query  172  AASGC  158
            +++ C
Sbjct  478  SSNKC  482



>ref|XP_002965292.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
 gb|EFJ34130.1| hypothetical protein SELMODRAFT_83230 [Selaginella moellendorffii]
Length=423

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 129/184 (70%), Gaps = 4/184 (2%)
 Frame = -3

Query  700  IVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLD-PTGNGGV  524
            ++FG+ AV+ +A FT LLTNPKLDTFYYVE+ GI +GG  V  I      LD  TGNGGV
Sbjct  240  LIFGNQAVASNAQFTTLLTNPKLDTFYYVEMVGIKVGGTSVN-IPAGSLSLDSSTGNGGV  298

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGA-SDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            I+DSGT+VTRL  +AY  MRDAFR G  SD K +S FSLFDTC+DLSG++ + +P V   
Sbjct  299  ILDSGTAVTRLVTSAYNPMRDAFRAGMPSDAKMTSGFSLFDTCYDLSGRSSIMLPAVSFV  358

Query  346  FR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFA  170
            F  GA ++LPA N ++PVD  G +C AFA  +   SIIGNIQQQ FR+ FD  G+R+G  
Sbjct  359  FNGGATMALPAQNIMVPVDNSGTYCLAFAPNSENFSIIGNIQQQSFRMSFDSTGNRVGIG  418

Query  169  ASGC  158
            A+ C
Sbjct  419  ANQC  422



>ref|XP_002890686.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66945.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S +   AV  PLL N +LDTFYY+ LTGIS+GG  ++ I  S F++D +G+G
Sbjct  304  ASTVEFGTS-LPPDAVVAPLLRNHQLDTFYYLGLTGISVGGELLQ-IPQSSFEMDESGSG  361

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  
Sbjct  362  GIIIDSGTAVTRLQTGIYNSLRDSFLKGTSDLEKAAGVAMFDTCYNLSAKTTIEVPTVAF  421

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  + +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF
Sbjct  422  HFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGF  481

Query  172  AASGC  158
            +++ C
Sbjct  482  SSNKC  486



>ref|NP_173922.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAG50814.1|AC079281_16 hypothetical protein [Arabidopsis thaliana]
 gb|AAM20575.1| unknown protein [Arabidopsis thaliana]
 gb|AAN15613.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF00436.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE30636.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=483

 Score =   198 bits (503),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S +S  AV  PLL N +LDTFYY+ LTGIS+GG  ++ I  S F++D +G+G
Sbjct  301  ASTVDFGTS-LSPDAVVAPLLRNHQLDTFYYLGLTGISVGGELLQ-IPQSSFEMDESGSG  358

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RD+F KG  DL+ ++  ++FDTC++LS KT V+VPTV  
Sbjct  359  GIIIDSGTAVTRLQTEIYNSLRDSFVKGTLDLEKAAGVAMFDTCYNLSAKTTVEVPTVAF  418

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  + +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF
Sbjct  419  HFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSLIGF  478

Query  172  AASGC  158
            +++ C
Sbjct  479  SSNKC  483



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score =   198 bits (504),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PLL + +++TFYYV L G S+GG  V  + PSVF++D +GNG
Sbjct  312  SSTLEF-NSAPPSDSVTAPLLKDSRVETFYYVGLKGFSVGGQPV-SVPPSVFEVDESGNG  369

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY ++RDAF++   DL  +S F+LFDTC+DLS ++ V+VPTV  
Sbjct  370  GIIVDSGTAITRLQTEAYNSLRDAFKRLTRDLPSASGFALFDTCYDLSSRSRVQVPTVSF  429

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G  +SLPA NYLIPVD+ G FCFAFA T+S  SIIGN+QQQG RV +DLA +R+GF
Sbjct  430  LFAGGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSSPSIIGNVQQQGTRVSYDLANNRVGF  489

Query  172  AASGC  158
            +A+ C
Sbjct  490  SANKC  494



>ref|XP_002986620.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
 gb|EFJ12477.1| hypothetical protein SELMODRAFT_124369 [Selaginella moellendorffii]
Length=423

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/184 (56%), Positives = 129/184 (70%), Gaps = 4/184 (2%)
 Frame = -3

Query  700  IVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-TGNGGV  524
            ++FG+ AV+ +A FT LLTNPKLDTFYYVE+ GI +GG  V  I      LD  TGNGGV
Sbjct  240  LIFGNQAVASNAQFTTLLTNPKLDTFYYVEMVGIKVGGTSVS-IPAGSLSLDSSTGNGGV  298

Query  523  IVDSGTSVTRLTRAAYVAMRDAFRKGA-SDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            I+DSGT+VTRL  +AY  MRDAFR G  SD K +S FSLFDTC+DLSG++ + +P V   
Sbjct  299  ILDSGTAVTRLVTSAYNPMRDAFRAGMPSDAKMTSGFSLFDTCYDLSGRSSIMLPAVSFV  358

Query  346  FRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFA  170
            F G A ++LPA N ++PVD  G +C AFA  +   SIIGNIQQQ FR+ FD  G+R+G  
Sbjct  359  FNGGATMALPAQNIMVPVDNSGTYCLAFAPNSENFSIIGNIQQQSFRMSFDSTGNRVGIG  418

Query  169  ASGC  158
            A+ C
Sbjct  419  ANQC  422



>ref|XP_008351877.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   197 bits (502),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PL+ + K+ TFYYV LTG S+GG  V  + PS+F +D +GNG
Sbjct  305  SSTLEF-NSAPPADSVTAPLVKSXKVGTFYYVXLTGFSVGGXPV-SVPPSLFAVDNSGNG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY A+RDAF++   DL  +S F+LFDTC++LS +T+V+VPTV  
Sbjct  363  GIIVDSGTAITRLQTQAYNALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSF  422

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   +SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF
Sbjct  423  QFSGGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSPLSIIGNVQQQGTRVSYDFANKRVGF  482

Query  172  AASGC  158
            + + C
Sbjct  483  SPNKC  487



>ref|XP_010677970.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=507

 Score =   198 bits (503),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F +S     +V  PLL N +++TFYYV L+G S+GG ++  I PS+F +D +G+G
Sbjct  325  SSSLEF-NSVKPADSVTAPLLKNSRVNTFYYVALSGFSVGGQQI-SIPPSLFNMDESGSG  382

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY ++R+AF +    L  +S  +LFDTC+D S  + VKVPTV L
Sbjct  383  GVIVDSGTAVTRLPTQAYNSLRNAFTRLTQHLTSASAVALFDTCYDFSSMSSVKVPTVAL  442

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   + LPA NYLIPVD+ G +CFAFA TTS +SIIGN+QQQG RV +DLA S++ F
Sbjct  443  HFSGGQTLDLPAKNYLIPVDSSGTYCFAFAETTSSMSIIGNVQQQGIRVHYDLARSQVAF  502

Query  172  AASGC  158
            +A+ C
Sbjct  503  SANNC  507



>ref|XP_003534178.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Glycine 
max]
Length=492

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 125/171 (73%), Gaps = 2/171 (1%)
 Frame = -3

Query  667  AVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLT  488
            +V  PLL N K++TFYYVELTG+S+GG  V  + P  F +D +G GGVIVDSGT++TRL 
Sbjct  323  SVVAPLLKNQKVNTFYYVELTGVSVGGEIVT-VPPETFAVDQSGAGGVIVDSGTAITRLR  381

Query  487  RAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAAN  311
              AY ++RDAF++  S+L+P+   +LFDTC+DLS    V+VPTV  HF G    +LPA N
Sbjct  382  TQAYNSVRDAFKRKTSNLRPAEGVALFDTCYDLSSLQSVRVPTVSFHFSGDRAWALPAKN  441

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YLIPVD  G +CFAFA TTS +SIIGN+QQQG RV FDLA S +GF+ + C
Sbjct  442  YLIPVDGAGTYCFAFAPTTSSMSIIGNVQQQGTRVSFDLANSLVGFSPNKC  492



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   197 bits (502),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PL+ + K+ TFYYV LTG S+GG  V  ++PS+F +D +GNG
Sbjct  305  SSTLEF-NSAPPADSVTAPLVKSGKVGTFYYVGLTGFSVGGQPV-SVSPSLFAVDNSGNG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY A+RDAF++   DL  +S FSLFDTC++LS +T+V+VPTV  
Sbjct  363  GIIVDSGTAITRLQTQAYNALRDAFKRLTRDLPTASSFSLFDTCYNLSSRTKVQVPTVSF  422

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   +SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +D    R+GF
Sbjct  423  QFSGGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSQLSIIGNVQQQGTRVSYDFENKRVGF  482

Query  172  AASGC  158
            + + C
Sbjct  483  SPNKC  487



>ref|XP_006306517.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
 gb|EOA39415.1| hypothetical protein CARUB_v10012516mg [Capsella rubella]
Length=482

 Score =   197 bits (501),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 137/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S +   AV  PLL N +LDTFYY+ LTGIS+GG  ++ I  S F++D +G+G
Sbjct  300  ASTVEFGTS-LPPDAVVAPLLRNHQLDTFYYLGLTGISVGGELLQ-IPQSSFEMDESGSG  357

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RD+F KG SDL+ ++  ++FDTC++LS KT ++VPTV  
Sbjct  358  GIIIDSGTAVTRLQTGIYNSLRDSFLKGTSDLEKTTGVAMFDTCYNLSTKTTIEVPTVAF  417

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  + +LPA NY+IPVD+ G FC AFA T S L+I+GN+QQQG RV FDLA S +GF
Sbjct  418  HFPGGKMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIVGNVQQQGTRVTFDLANSLIGF  477

Query  172  AASGC  158
            +++ C
Sbjct  478  SSNKC  482



>ref|XP_002315953.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEF02124.1| aspartyl protease family protein [Populus trichocarpa]
Length=484

 Score =   197 bits (500),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +  +AV  PLL N  LDTFYYV LTG+S+GG  V  I  S F++D +GNG
Sbjct  301  SASTLEFNSTLPPNAVSAPLLRNHHLDTFYYVGLTGLSVGGELV-SIPESAFQIDESGNG  359

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT++TRL    Y ++RDAF K   DL  ++  +LFDTC+DLS K  V+VPTV  
Sbjct  360  GVIVDSGTAITRLQTDVYNSLRDAFVKRTRDLPSTNGIALFDTCYDLSSKGNVEVPTVSF  419

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYL+P+D+EG FCFAFA T S LSIIGN+QQQG RVV+DL    +GF
Sbjct  420  HFPDGKELPLPAKNYLVPLDSEGTFCFAFAPTASSLSIIGNVQQQGTRVVYDLVNHLVGF  479

Query  172  AASGC  158
              + C
Sbjct  480  VPNKC  484



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score =   197 bits (500),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 124/171 (73%), Gaps = 2/171 (1%)
 Frame = -3

Query  667  AVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLT  488
            +V  PLL N K++TFYYVELTG S+GG  V  I P  F +D +G GGVIVDSGT++TRL 
Sbjct  317  SVTAPLLKNQKVNTFYYVELTGFSVGGDIV-SIPPETFAVDQSGVGGVIVDSGTAITRLR  375

Query  487  RAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGADV-SLPAAN  311
              AY A+RDAF++   +L+P+   +LFDTC+DLS    V+VPTV  HF G    +LPA N
Sbjct  376  TQAYNAVRDAFKRMTQNLRPADGVALFDTCYDLSSLQSVRVPTVSFHFAGDKTWALPAKN  435

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YLIPVD+ G +CFAFA TTS LSIIGN+QQQG RV FDLA S +GF+ + C
Sbjct  436  YLIPVDSAGTYCFAFAPTTSSLSIIGNVQQQGTRVSFDLANSVVGFSPNKC  486



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PL+ + K+ TFYYV LTG S+GG  V  + PS+F +D +GNG
Sbjct  305  SSTLEF-NSAPPADSVTAPLVKSXKVGTFYYVGLTGFSVGGXPV-SVPPSLFAVDNSGNG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY A+RDAF++   DL  +S F+LFDTC++LS +T+V+VPTV  
Sbjct  363  GIIVDSGTAITRLQTQAYNALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSF  422

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   +SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF
Sbjct  423  QFSGGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSPLSIIGNVQQQGTRVSYDFANKRVGF  482

Query  172  AASGC  158
            + + C
Sbjct  483  SPNKC  487



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   197 bits (500),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 135/185 (73%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PL+ + K+ TFYYV LTG S+GG  V  + PS+F +D +GNG
Sbjct  305  SSTLEF-NSAPPADSVTAPLVKSXKVGTFYYVGLTGFSVGGXPV-SVPPSLFAVDNSGNG  362

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY A+RDAF++   DL  +S F+LFDTC++LS +T+V+VPTV  
Sbjct  363  GIIVDSGTAITRLQTQAYNALRDAFKRLTRDLPTASSFALFDTCYNLSSRTKVQVPTVSF  422

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   +SLPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV +D A  R+GF
Sbjct  423  QFSGGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSPLSIIGNVQQQGTRVSYDFANKRVGF  482

Query  172  AASGC  158
            + + C
Sbjct  483  SPNKC  487



>gb|KFK44545.1| hypothetical protein AALP_AA1G270600 [Arabis alpina]
Length=485

 Score =   197 bits (500),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 135/187 (72%), Gaps = 5/187 (3%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG  A+   AV  PLL N +LDTFYY+ LTGIS+GG  +  +  S F++D +G+G
Sbjct  301  ASTVEFG-GALPLDAVVAPLLRNHQLDTFYYLGLTGISVGGEML-DVPVSFFEMDESGSG  358

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y  +RDAF KG  DL+  +  ++FDTC+DLS KT ++VPTV L
Sbjct  359  GIIIDSGTAVTRLQTEVYNMLRDAFVKGTMDLERVNGVAMFDTCYDLSTKTTIEVPTVAL  418

Query  349  HFRGAD---VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRL  179
            HF G     ++LPA NY+IPVD+ G FCFAFA T S L+IIGN+QQQG RV FDLA S +
Sbjct  419  HFSGGGGGMLALPAKNYMIPVDSVGTFCFAFAPTASSLAIIGNVQQQGTRVGFDLANSLI  478

Query  178  GFAASGC  158
            GF+++ C
Sbjct  479  GFSSNKC  485



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 136/185 (74%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  PLL + +++TFYYV L G S+GG  V  + PSVF++D +GNG
Sbjct  312  SSTLEF-NSAPPSDSVTAPLLKDSRVETFYYVGLKGFSVGGQPV-SVPPSVFEVDESGNG  369

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT++TRL   AY ++RDAF++   DL  +S F+LFDTC+DLS ++ V+VPTV  
Sbjct  370  GIIVDSGTAITRLQTEAYNSLRDAFKRLTRDLPSASGFALFDTCYDLSSRSRVQVPTVSF  429

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G  +SLPA NYLIPVD+ G FCFAFA T+S  SIIGN+QQQG RV +DLA +R+GF
Sbjct  430  LFADGKSLSLPAKNYLIPVDSAGTFCFAFAPTSSSPSIIGNVQQQGTRVSYDLANNRVGF  489

Query  172  AASGC  158
            + + C
Sbjct  490  SPNKC  494



>ref|XP_010551288.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Tarenaya 
hassleriana]
Length=511

 Score =   197 bits (500),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 133/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS V  DS +  +AV  PLL NP++DTFYY+ + GIS+GG  +  +  S F++  +G G
Sbjct  328  SSSTVEFDSPLPPNAVVAPLLRNPQVDTFYYLGIAGISVGGEFL-PVPKSAFRMAESGIG  386

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGT+VTRL    Y ++RD+F KG +DL  +S  +LFDTC+DLSG T V+VPTV L
Sbjct  387  GVIIDSGTAVTRLQTETYNSLRDSFVKGTADLPTASGVALFDTCYDLSGNTTVEVPTVAL  446

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  + +LPA NYLIPVD+ G FC AFA TTS + IIGN+QQQG RV  DLA S +GF
Sbjct  447  HFTGGRMLALPAKNYLIPVDSAGTFCLAFAPTTSPMGIIGNVQQQGTRVTLDLANSAIGF  506

Query  172  AASGC  158
            +++ C
Sbjct  507  SSNQC  511



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 125/186 (67%), Gaps = 2/186 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            S ++ FG  +V   ++ TPLLTNP L TFYYV L  IS+GGA +  + P VF++D T G 
Sbjct  353  SGTLEFGPESVPLGSILTPLLTNPSLPTFYYVPLISISVGGALLDSVPPDVFRIDETSGR  412

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GG IVDSGT+VTRL    Y A+RDAF  G   L  +   S+FDTC+DLSG   V VPTVV
Sbjct  413  GGFIVDSGTAVTRLQTPVYDAVRDAFVAGTRQLPKAEGVSIFDTCYDLSGLPLVNVPTVV  472

Query  352  LHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF  GA + LPA NY+IP+D  G FCFAFA  TS LSI+GNIQQQG RV FD A S +G
Sbjct  473  FHFSNGASLILPAKNYMIPMDFMGTFCFAFAPATSDLSIMGNIQQQGIRVSFDTANSLVG  532

Query  175  FAASGC  158
            FA   C
Sbjct  533  FALRQC  538



>ref|XP_006484425.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=485

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  DS++  +AV  PLL N +LDTFYY+ LTGIS+GG  +  I+ + FK+D +GNG
Sbjct  302  STSTLEFDSSLPPNAVTAPLLRNHELDTFYYLGLTGISVGG-DLLPISETAFKIDESGNG  360

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  
Sbjct  361  GIIVDSGTAVTRLQTETYNALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSF  420

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA N+LIPVD+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF
Sbjct  421  HFPEGKVLPLPAKNFLIPVDSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLVGF  480

Query  172  AASGC  158
              + C
Sbjct  481  TPNKC  485



>ref|XP_006437718.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
 gb|ESR50958.1| hypothetical protein CICLE_v10031364mg [Citrus clementina]
Length=485

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 132/185 (71%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  DS++  +AV  PLL N +LDTFYY+ LTGIS+GG  +  I+ + FK+D +GNG
Sbjct  302  STSTLEFDSSLPPNAVTAPLLRNHELDTFYYLGLTGISVGG-DLLPISETAFKIDESGNG  360

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y A+RDAF +G   L P+   +LFDTC+D S ++ V+VPTV  
Sbjct  361  GIIVDSGTAVTRLQTETYNALRDAFVRGTRALSPTDGVALFDTCYDFSSRSSVEVPTVSF  420

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA N+LIPVD+ G FCFAFA T+S LSIIGN+QQQG RV F+L  S +GF
Sbjct  421  HFPEGKVLPLPAKNFLIPVDSNGTFCFAFAPTSSSLSIIGNVQQQGTRVSFNLRNSLVGF  480

Query  172  AASGC  158
              + C
Sbjct  481  TPNKC  485



>gb|KJB52970.1| hypothetical protein B456_008G285900 [Gossypium raimondii]
Length=492

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 133/185 (72%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +S +   +V  PL+ + K+DTFYYV LTG+S+GG  V+ + P  F+L+ +GNG
Sbjct  310  SSTLDF-NSGLPADSVVAPLIRSRKVDTFYYVGLTGLSVGGQPVQ-LPPGFFELEQSGNG  367

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVD GT++TRL   AY A+RDAF K + DL  +   +LFDTC+DLS +T V+VPTV  
Sbjct  368  GVIVDCGTAITRLQAEAYNALRDAFVKLSPDLPTTGGVALFDTCYDLSSRTSVRVPTVAF  427

Query  349  HFRGA-DVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   + LPA NYLIPVD+ G +C AFA TTS LSIIGN+QQQG RV FDLA +++GF
Sbjct  428  HFSGGMSLDLPAKNYLIPVDSSGTYCLAFAPTTSSLSIIGNVQQQGTRVSFDLANNKVGF  487

Query  172  AASGC  158
            +   C
Sbjct  488  SPHKC  492



>ref|XP_004238952.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=482

 Score =   195 bits (495),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 130/185 (70%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG  A+  +AV  P++ N KLDTFYYV+LTGIS+ G  +  +NPS FK+   G+G
Sbjct  300  TSTLEFG-GAIPPNAVTAPMIKNSKLDTFYYVDLTGISVAG-NMLSVNPSAFKIADNGDG  357

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL    Y  +RD F KG   L  ++  +LFDTC+DL     V+VPTV  
Sbjct  358  GVIVDSGTAVTRLKTDVYNTLRDEFVKGTRHLPSTNAVALFDTCYDLKSMKSVEVPTVSF  417

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G +++LPA NYLIPVD+   FCFAFA ++S LSIIGN+QQ+G RV FDL  S +GF
Sbjct  418  HFSNGNELALPAKNYLIPVDSSSTFCFAFAPSSSSLSIIGNVQQEGTRVSFDLVNSLIGF  477

Query  172  AASGC  158
            +++ C
Sbjct  478  SSNQC  482



>ref|XP_008799310.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=507

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 122/167 (73%), Gaps = 2/167 (1%)
 Frame = -3

Query  655  PLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAY  476
            PLL N KLDTFYYV L+GIS+GG ++  I PS F +D +G+GGVIVDSGT+VTRL   AY
Sbjct  342  PLLHNRKLDTFYYVGLSGISVGG-KMLSIPPSSFAMDESGSGGVIVDSGTAVTRLQAEAY  400

Query  475  VAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAANYLIP  299
             A+RDAFR+  S L  +   SLFDTC+DLS ++ V+VPTV  HF  G ++ LPA NYLIP
Sbjct  401  GALRDAFRRETSGLPSAEGMSLFDTCYDLSSRSSVEVPTVAFHFPEGRELRLPAKNYLIP  460

Query  298  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            VD  G +C AFA TT+ LSIIGN+QQQG RV FDL  S LGF  + C
Sbjct  461  VDGGGTYCLAFAPTTAPLSIIGNVQQQGTRVSFDLDKSVLGFTPNNC  507



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S ++  AV  PL  NP LDTF+Y+ LTG+S+GGA V  I  + F++   GNG
Sbjct  303  STSTLDFNSPITPDAVTAPLHRNPNLDTFFYLGLTGMSVGGA-VLPIPETSFQMSEDGNG  361

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y  +RDAF K   DL+ +   +LFDTC+DLS K+ V+VPTV  
Sbjct  362  GIIVDSGTAVTRLQTTVYNVLRDAFVKSTHDLQTARGVALFDTCYDLSSKSRVEVPTVSF  421

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYLIPVD+EG FCFAFA T S LSI+GN QQQG RV FDLA S +GF
Sbjct  422  HFANGNELPLPAKNYLIPVDSEGTFCFAFAPTDSTLSILGNAQQQGTRVGFDLANSLVGF  481

Query  172  AASGC  158
            + + C
Sbjct  482  SPNKC  486



>emb|CDM80984.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 130/185 (70%), Gaps = 4/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FGDS   + AV  PLL +P+ +TFYYV L+GIS+GG +   I  S F +D  G+G
Sbjct  322  SSTLQFGDS--EQPAVTAPLLRSPRTNTFYYVGLSGISVGG-QALSIPASAFAMDDAGSG  378

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY A+R+AF +G   L  +S  SLFDTC+DL+G++ V+VP V L
Sbjct  379  GVIVDSGTAVTRLQSGAYAALREAFVQGTQSLPRASGISLFDTCYDLAGRSSVQVPAVAL  438

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G ++ LPA NYLIPVD  G +C AFAGT+  +SIIGN+QQQG RV FD A + +GF
Sbjct  439  RFEGGGELKLPAKNYLIPVDGAGTYCLAFAGTSGAVSIIGNVQQQGVRVSFDTAKNTVGF  498

Query  172  AASGC  158
             A  C
Sbjct  499  TADKC  503



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 130/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S ++  AV  PL  NP LDTF+Y+ LTG+S+GGA V  I  + F++   GNG
Sbjct  303  STSTLDFNSPITPDAVTAPLHRNPNLDTFFYLGLTGMSVGGA-VLPIPETSFQMSEDGNG  361

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y  +RDAF K   DL+ +   +LFDTC+DLS K+ V+VPTV  
Sbjct  362  GIIVDSGTAVTRLQTTVYNVLRDAFVKSTHDLQTARGVALFDTCYDLSSKSRVEVPTVSF  421

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYLIPVD+EG FCFAFA T S LSI+GN QQQG RV FDLA S +GF
Sbjct  422  HFANGNELPLPAKNYLIPVDSEGTFCFAFAPTDSTLSILGNAQQQGTRVGFDLANSLVGF  481

Query  172  AASGC  158
            + + C
Sbjct  482  SPNKC  486



>ref|XP_009608744.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
tomentosiformis]
Length=488

 Score =   194 bits (494),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 128/185 (69%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG   +S  AV  PL+ N KLDTFYY+ELTG+S+ G  +  + PS FK+   G+G
Sbjct  306  TSTLEFG-GVISPDAVTAPLIRNSKLDTFYYLELTGLSVAG-NLLSVPPSAFKVSDNGDG  363

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGT+VTRL    Y  +RD F KG   L  ++  +LFDTC+DL     V+VPTV  
Sbjct  364  GVIIDSGTAVTRLQTDVYNTLRDEFVKGTRHLPSTNSVALFDTCYDLKSMKSVEVPTVSF  423

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV FDL  S +GF
Sbjct  424  HFSNGKELPLPAKNYLIPVDSSGTFCFAFAPTSSSLSIIGNVQQQGTRVSFDLKNSLIGF  483

Query  172  AASGC  158
            +++ C
Sbjct  484  SSNKC  488



>ref|XP_004512945.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=502

 Score =   194 bits (494),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  P+L N KLDTFYYV+LTG+S+GG  V  + P +F+ D +  G
Sbjct  320  SSTLEF-NSARPSDSVTAPMLKNQKLDTFYYVQLTGMSVGGEMV-NVPPEIFETDQSTGG  377

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGT+VTRL   AY ++RDAF++   +L+ +   ++FDTC+DLS    V+VPTV  
Sbjct  378  GVIIDSGTAVTRLQSQAYESVRDAFKRLTQNLRSAEGVAIFDTCYDLSSLRSVRVPTVSF  437

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF    V  LPA NYLIPVD++G FCFAFA T+S LSIIGN+QQQG RV FD+A S +GF
Sbjct  438  HFGNDRVWDLPAKNYLIPVDSDGTFCFAFAPTSSSLSIIGNVQQQGTRVSFDIANSLVGF  497

Query  172  AASGC  158
            + + C
Sbjct  498  SPNKC  502



>ref|XP_007046283.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
 gb|EOY02115.1| Eukaryotic aspartyl protease family protein [Theobroma cacao]
Length=489

 Score =   194 bits (493),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  DSA+  +AV  PLL N +LDTFYY+ LTGIS+GG  +  I  S F++D +GNG
Sbjct  306  SASTLEFDSALPPNAVKAPLLRNHQLDTFYYLGLTGISVGG-ELLPIPQSAFQMDESGNG  364

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G I+DSGT+VTRL    Y  +RDAF KG  +L  +   +LFDTC+DLS ++ V VPTV  
Sbjct  365  GTIIDSGTAVTRLQSDTYDILRDAFVKGTKNLPSTDSVALFDTCYDLSKRSSVDVPTVSF  424

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NYLIPVD+EG FCFAFA T+S LSIIGN+QQQG RV FDL  S + F
Sbjct  425  HFPEGQVLPLPAKNYLIPVDSEGTFCFAFAPTSSSLSIIGNVQQQGTRVGFDLGNSLVEF  484

Query  172  AASGC  158
                C
Sbjct  485  VPDKC  489



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 129/186 (69%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    V       PLL N K+DTFYYV L+G S+GG  V+ I  SVF++D +G G
Sbjct  315  SSSLDFNSVQVGAGDATAPLLRNSKIDTFYYVGLSGFSVGGQEVK-IPSSVFEVDASGTG  373

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT++TRL   AY ++RD+F K  S+LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  374  GVILDCGTAITRLKTEAYNSLRDSFVKLTSNLKKGTSSISLFDTCYDFSSLSTVKVPTVA  433

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G
Sbjct  434  FHFTGGKSLDLPAKNYLIPIDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIG  493

Query  175  FAASGC  158
             +A+ C
Sbjct  494  LSANKC  499



>ref|XP_002281973.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=491

 Score =   194 bits (493),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 134/185 (72%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +   +V  PLL N +LDTFYY+ +TGI +GG ++  I  S F++D +GNG
Sbjct  308  SASTLEFNSPIPSHSVTAPLLRNNQLDTFYYLGMTGIGVGG-QMLSIPRSSFEVDESGNG  366

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y ++RD+F +G   L  +S  +LFDTC+DLS ++ V+VPTV  
Sbjct  367  GIIVDSGTAVTRLQSDVYNSLRDSFVRGTQHLPSTSGVALFDTCYDLSSRSSVEVPTVSF  426

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  ++LPA NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV +DL+ S +GF
Sbjct  427  HFPDGKYLALPAKNYLIPVDSAGTFCFAFAPTTSALSIIGNVQQQGTRVSYDLSNSLVGF  486

Query  172  AASGC  158
            + +GC
Sbjct  487  SPNGC  491



>gb|EAY72467.1| hypothetical protein OsI_00323 [Oryza sativa Indica Group]
Length=500

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 131/185 (71%), Gaps = 4/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FGD+A   + V  PL+ +P+  TFYYV L+GIS+GG ++  I PS F +D TG G
Sbjct  319  SSTLQFGDAA--DAEVTAPLIRSPRTSTFYYVGLSGISVGG-QILSIPPSAFAMDGTGAG  375

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL  +AY A+RDAF +G   L  +S  SLFDTC+DLS +T V+VP V L
Sbjct  376  GVIVDSGTAVTRLQSSAYAALRDAFVRGTQSLPRTSGVSLFDTCYDLSDRTSVEVPAVSL  435

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G ++ LPA NYLIPVD  G +C AFA T + +SIIGN+QQQG RV FD A S +GF
Sbjct  436  RFAGGGELRLPAKNYLIPVDGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTAKSTVGF  495

Query  172  AASGC  158
             ++ C
Sbjct  496  TSNKC  500



>ref|XP_008243190.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=556

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +  +AV  PL  NP+LDTFYY+ LTG+S+GG  +  I  S F +D +GNG
Sbjct  373  SASTLEFNSPLHPNAVTAPLHRNPELDTFYYIGLTGLSVGG-ELLPIPESAFLIDDSGNG  431

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y A+RDAF KG  DL  +   +LFD C+DLS K  V+VPTV  
Sbjct  432  GIIIDSGTAVTRLQTDTYNALRDAFVKGTKDLTSTQGAALFDVCYDLSAKKSVEVPTVSF  491

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NYLIP+D+EG FCFAFA T S LSIIGN+QQQG RV FD+A S +GF
Sbjct  492  HFADGKVLPLPAKNYLIPIDSEGTFCFAFAPTPSSLSIIGNVQQQGTRVGFDIANSVVGF  551

Query  172  AASGC  158
                C
Sbjct  552  FPDQC  556



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 130/186 (70%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYY+ L+G S+GG +V  I+ S+F +D +G+G
Sbjct  317  SSSLDFNSVQLGSGDATAPLLRNQKIDTFYYLGLSGFSVGGQKVM-ISDSIFAVDASGSG  375

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF +  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  376  GVILDCGTAVTRLQTEAYNSLRDAFLRLTTNLKKGTSSISLFDTCYDFSSLSTVKVPTVT  435

Query  352  LHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G
Sbjct  436  FHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIG  495

Query  175  FAASGC  158
             +A+ C
Sbjct  496  LSANKC  501



>ref|XP_007225636.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
 gb|EMJ26835.1| hypothetical protein PRUPE_ppa003917mg [Prunus persica]
Length=540

 Score =   193 bits (491),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +  +AV  PL  NP+LDTFYY+ L G+S+GG  +  I  S F++D +GNG
Sbjct  357  SASTLEFNSPLHPNAVTAPLRRNPELDTFYYIGLAGLSVGG-ELLPIPESAFQIDDSGNG  415

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y A+RDAF KG  DL  +   +LFD C+DLS K  V+VPTV  
Sbjct  416  GIIIDSGTAVTRLQTDTYNALRDAFVKGTKDLTSTQGAALFDVCYDLSSKKSVEVPTVSF  475

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NYLIP+D+EG FCFAFA T S +SIIGN+QQQG RV FD+A S +GF
Sbjct  476  HFADGKVLPLPAKNYLIPIDSEGTFCFAFAPTPSSMSIIGNVQQQGTRVGFDIANSVVGF  535

Query  172  AASGC  158
              + C
Sbjct  536  FPNQC  540



>ref|XP_009380958.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=523

 Score =   193 bits (490),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = -3

Query  664  VFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTR  485
            V  PLL N +L+TFYYV +TGIS+GG  +  I PS F +D +G GGVIVDSGT+VTRL  
Sbjct  355  VTAPLLRNRRLETFYYVGVTGISVGG-EMLSIPPSAFAVDESGAGGVIVDSGTAVTRLQE  413

Query  484  AAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAANY  308
             AY A+RDAFR G + L  +S  SLFDTC+DLS +T V+VPTV  HF G  ++ LPA NY
Sbjct  414  GAYSALRDAFRAGTASLPSASGVSLFDTCYDLSSRTSVEVPTVGFHFPGGRELRLPAKNY  473

Query  307  LIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            LIPVD  G +C AFA T++ LSIIGN+QQQG RV FDL  + +GF  + C
Sbjct  474  LIPVDGAGTYCLAFAPTSAPLSIIGNVQQQGTRVSFDLENASVGFTPNKC  523



>ref|XP_010527532.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=484

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S++  + V  PLL N + DTFYY+ LTGIS+GG  +  I  S F++  TG G
Sbjct  302  ASTLEFG-SSLPPNTVVAPLLRNHQFDTFYYLGLTGISVGGGLLP-IPESAFQMTETGTG  359

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y ++RD+F KG  DL   S  +LFDTC+DLSGKT+V+VPTV L
Sbjct  360  GIIIDSGTAVTRLQTEIYNSLRDSFVKGTPDLPTVSGVALFDTCYDLSGKTKVEVPTVAL  419

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G  +  LPA N LIPVD++G FC AFA T S L+IIGN+QQQG RV FDLA S + F
Sbjct  420  HFPGGRMLPLPAKNCLIPVDSKGTFCLAFAPTASSLAIIGNVQQQGTRVTFDLANSVIAF  479

Query  172  AASGC  158
            +++ C
Sbjct  480  SSNKC  484



>ref|XP_006843768.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
 gb|ERN05443.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
Length=496

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 126/185 (68%), Gaps = 4/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FG        V  PL+ N +++TFYY+ L+GI +GG+ V  I PS F++D  G+G
Sbjct  315  SSTLQFGGDPAG--TVTAPLMHNRRMNTFYYIGLSGIGVGGS-VLSIPPSSFQMDEGGDG  371

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G IVDSGT++TRL   AY  +RDAF KGA  L  +S  SLFDTC+DLSG+  V VPTV L
Sbjct  372  GTIVDSGTAITRLQSQAYTTLRDAFVKGAQALPRTSGVSLFDTCYDLSGRASVDVPTVSL  431

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NYL+PVD+ G FCFAFA T S LSIIGN+QQQG RV FD A S + F
Sbjct  432  HFPEGQALVLPAKNYLVPVDSTGTFCFAFAPTNSQLSIIGNVQQQGTRVAFDTANSVVSF  491

Query  172  AASGC  158
              + C
Sbjct  492  TPNKC  496



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   192 bits (488),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 130/185 (70%), Gaps = 4/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FGDS   + AV  PL+ +P+ +TFYYV L+GIS+GG  +  I  S F +D  G+G
Sbjct  319  SSTLQFGDS--EQPAVTAPLIRSPRTNTFYYVALSGISVGGEAL-SIPSSAFAMDDAGSG  375

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL   AY A+R+AF +G   L  +S  SLFDTC+DL+G++ V+VP V L
Sbjct  376  GVIVDSGTAVTRLQSGAYGALREAFVQGTQSLPRASGVSLFDTCYDLAGRSSVQVPAVAL  435

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G ++ LPA NYLIPVD  G +C AFAGT+  +SIIGN+QQQG RV FD A + +GF
Sbjct  436  WFEGGGELKLPAKNYLIPVDAAGTYCLAFAGTSGPVSIIGNVQQQGVRVSFDTAKNTVGF  495

Query  172  AASGC  158
             A  C
Sbjct  496  TADKC  500



>ref|NP_001041979.1| Os01g0140100 [Oryza sativa Japonica Group]
 dbj|BAB21205.1| putative aspartic proteinase nepenthesin I [Oryza sativa Japonica 
Group]
 dbj|BAF03893.1| Os01g0140100 [Oryza sativa Japonica Group]
 gb|EAZ10476.1| hypothetical protein OsJ_00309 [Oryza sativa Japonica Group]
 dbj|BAG91200.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 130/185 (70%), Gaps = 4/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ FGD+A   + V  PL+ +P+  TFYYV L+G+S+GG ++  I PS F +D TG G
Sbjct  323  SSTLQFGDAA--DAEVTAPLIRSPRTSTFYYVGLSGLSVGG-QILSIPPSAFAMDSTGAG  379

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL  +AY A+RDAF +G   L  +S  SLFDTC+DLS +T V+VP V L
Sbjct  380  GVIVDSGTAVTRLQSSAYAALRDAFVRGTQSLPRTSGVSLFDTCYDLSDRTSVEVPAVSL  439

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G ++ LPA NYLIPVD  G +C AFA T + +SIIGN+QQQG RV FD A S +GF
Sbjct  440  RFAGGGELRLPAKNYLIPVDGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTAKSTVGF  499

Query  172  AASGC  158
              + C
Sbjct  500  TTNKC  504



>ref|XP_010533981.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=502

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 132/186 (71%), Gaps = 4/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F +SA   S V  PLL N K+DTFYYV LTG S+GG  V  I PSVF +  +GNG
Sbjct  319  SSSLDF-NSARLGSEVTAPLLHNHKIDTFYYVGLTGFSVGGHPV-AIPPSVFAVGDSGNG  376

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVIVD GT+VTRL   AY ++RDAF +  ++LK  SS  SLFDTC+D S  + V+VPTV 
Sbjct  377  GVIVDCGTAVTRLQTQAYNSLRDAFARLTANLKSASSSISLFDTCYDFSSLSTVRVPTVA  436

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            LHF G   + LPA NYLIPVD+ G FCFAFA T++ LSIIGN+QQQG R+ FDLA + +G
Sbjct  437  LHFAGGKSLELPAKNYLIPVDSAGIFCFAFAPTSTPLSIIGNVQQQGTRIRFDLANNLVG  496

Query  175  FAASGC  158
            F  + C
Sbjct  497  FLPNKC  502



>ref|XP_004968151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   192 bits (488),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            +S++ FGD A     V  PLL +P+  TFYYV +TGIS+GG +   I  S F +D T G+
Sbjct  333  ASTLQFGDGAAEADTVTAPLLRSPRTSTFYYVAMTGISVGG-QALSIPTSAFAMDATSGS  391

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GGVIVDSGT+VTRL  AAY A+RDAF +G   L  SS  SLFDTC+DLSG+T V+VP V 
Sbjct  392  GGVIVDSGTAVTRLQSAAYAALRDAFVRGTPSLPRSSGVSLFDTCYDLSGRTSVEVPAVS  451

Query  352  LHFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            L F  G  + LPA NYLIPVD  G +C AFA T + +SIIGN+QQQG RV FD A   +G
Sbjct  452  LRFEGGGSLRLPAKNYLIPVDGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTAKGAVG  511

Query  175  FAASGC  158
            F  + C
Sbjct  512  FTPNKC  517



>ref|XP_009800603.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Nicotiana 
sylvestris]
Length=488

 Score =   191 bits (486),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 128/185 (69%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG   +S  A+  PL+ N KLDTFYY++LTG+S+ G  +  + PS FK+   G+G
Sbjct  306  TSTLEFG-GVISPDAITAPLIRNSKLDTFYYLDLTGLSVAG-NLLSVPPSAFKVSNNGDG  363

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+DSGT+VTRL    Y  +RD F KG   L  ++  +LFDTC+DL     V+VPTV  
Sbjct  364  GVIIDSGTAVTRLQTDVYNTLRDEFVKGTRHLPSTNGVALFDTCYDLKSMKSVEVPTVSF  423

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYLIPVD+ G FCFAFA T+S LSIIGN+QQQG RV FDL  S +GF
Sbjct  424  HFSNGKELPLPAKNYLIPVDSSGTFCFAFAPTSSSLSIIGNVQQQGTRVSFDLKNSLIGF  483

Query  172  AASGC  158
            +++ C
Sbjct  484  SSNKC  488



>ref|XP_006362549.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=482

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 129/185 (70%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG  A   +AV  P++ N KLDTFYYV+LTGIS+ G  +  +NPS F++   G+G
Sbjct  300  TSTLEFG-GATPPNAVTAPIIKNSKLDTFYYVDLTGISVAG-NMLSVNPSDFEIADNGDG  357

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL    Y  +RD F KG   L  ++  +LFDTC+DL     V+VPTV  
Sbjct  358  GVIVDSGTAVTRLKTDVYNTLRDEFVKGTRHLPSTNGVALFDTCYDLKSMKSVEVPTVSF  417

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G +++LPA NYLIPVD+   FCFAFA ++S LSIIGN+QQQG RV FDL  S +GF
Sbjct  418  HFSNGNELALPAKNYLIPVDSSSTFCFAFAPSSSSLSIIGNVQQQGTRVSFDLVNSLIGF  477

Query  172  AASGC  158
            +++ C
Sbjct  478  SSNQC  482



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +S  AV  PL  NP LDTF+Y+ LTG+S+GG  V  I  + F++   GNG
Sbjct  303  STSTLDFNSPISPDAVTAPLHRNPNLDTFFYLGLTGMSVGGT-VLPIPETSFQMSEDGNG  361

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y  +RD+F K   DL+ +   +LFDTC+DLS K+ V+VPTV  
Sbjct  362  GIIVDSGTAVTRLQTTVYNVLRDSFVKSTHDLQSARGVALFDTCYDLSSKSSVEVPTVSF  421

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYLIPVD+EG FCFAFA T S LSI+GN QQQG RV FDL+ S +GF
Sbjct  422  HFANGNELPLPAKNYLIPVDSEGTFCFAFAPTDSTLSILGNAQQQGTRVGFDLSNSLVGF  481

Query  172  AASGC  158
            + + C
Sbjct  482  SPNKC  486



>ref|XP_011008360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=484

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 129/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +  +AV  PLL N  LDTFYYV LTG+S+GG  V  I  S F++D +G+G
Sbjct  301  SASTLEFNSTLPPNAVAAPLLRNHNLDTFYYVGLTGLSVGGELV-SIPESAFQIDESGDG  359

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT++TRL    Y ++RDAF K   DL  ++  +LFDTC++LS K  V+VPTV  
Sbjct  360  GVIVDSGTAITRLQTDVYNSLRDAFVKRTRDLPSTNGIALFDTCYNLSSKGNVEVPTVSF  419

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYL+P+D+EG FCFAFA T S LSIIGN+QQQG RV +DL    +GF
Sbjct  420  HFPDGKELPLPAKNYLVPLDSEGTFCFAFAPTASSLSIIGNVQQQGTRVSYDLVNHLVGF  479

Query  172  AASGC  158
              + C
Sbjct  480  VPNRC  484



>ref|XP_002275164.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=496

 Score =   191 bits (485),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 132/185 (71%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +V  P+  N K+DTFYYV +TG+S+GG ++  I PS+F++D +G G
Sbjct  314  SSTLEF-NSAKPSDSVTAPIFKNSKVDTFYYVGITGMSVGGEKL-AIPPSIFEVDGSGKG  371

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVD GT+VTRL   AY A+RD F K   DL  +S F+LFDTC++LS +T V+VPTV  
Sbjct  372  GIIVDCGTAVTRLQTQAYNALRDTFVKLTKDLPSTSGFALFDTCYNLSSRTSVRVPTVAF  431

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   + LP +NYLIPVD+ G FC AFA TT+ LSIIGN+QQQG RV +DLA S++ F
Sbjct  432  LFDGGKSLPLPPSNYLIPVDSAGTFCLAFAPTTASLSIIGNVQQQGTRVTYDLANSQVSF  491

Query  172  AASGC  158
            ++  C
Sbjct  492  SSRKC  496



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 129/186 (69%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYY+ L+G S+GG +V  I+ S+F +D +G+G
Sbjct  318  SSSLDFNSVQLGSGDATAPLLRNQKIDTFYYLGLSGFSVGGQKVM-ISDSIFAVDASGSG  376

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF +  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  377  GVILDCGTAVTRLQTEAYNSLRDAFLRLTTNLKKGTSSISLFDTCYDFSSLSTVKVPTVT  436

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G
Sbjct  437  FHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIG  496

Query  175  FAASGC  158
             + + C
Sbjct  497  LSPNKC  502



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 128/186 (69%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYY+ L+G S+GG +V  I+ S+F +D +G+G
Sbjct  317  SSSLDFNSVQLGSGDATAPLLRNQKIDTFYYLGLSGFSVGGQKVM-ISDSIFAVDASGSG  375

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF +  + LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  376  GVILDCGTAVTRLQTEAYNSLRDAFLRLTTKLKKGTSSISLFDTCYDFSSLSTVKVPTVT  435

Query  352  LHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DL  +R+G
Sbjct  436  FHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLTNNRIG  495

Query  175  FAASGC  158
             +A+ C
Sbjct  496  LSANKC  501



>ref|XP_009409187.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 123/171 (72%), Gaps = 2/171 (1%)
 Frame = -3

Query  667  AVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLT  488
            AV  PLL N +L TF+YV LTGIS+GG ++  I PS F +D +G GGVIVDSGT+VTRL 
Sbjct  353  AVTAPLLRNRRLATFHYVGLTGISVGG-QMLSIPPSAFAMDESGAGGVIVDSGTAVTRLQ  411

Query  487  RAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGA-DVSLPAAN  311
               Y A+RDAFR G + L  +S +SLFDTC+DLS +T V+VPTV  HF  + ++ LPA N
Sbjct  412  GPTYTALRDAFRAGTASLPSASAWSLFDTCYDLSSRTSVEVPTVGFHFPSSKELRLPAKN  471

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YL+PVD  G +C AFA T++ LSIIGN+QQQ  RV FDL  + +GF+ + C
Sbjct  472  YLVPVDDAGTYCLAFAPTSASLSIIGNVQQQEIRVSFDLDNAVVGFSPNKC  522



>ref|XP_001784204.1| predicted protein [Physcomitrella patens]
 gb|EDQ51002.1| predicted protein, partial [Physcomitrella patens]
Length=367

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/188 (48%), Positives = 125/188 (66%), Gaps = 6/188 (3%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAV----FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT  539
            S++VFGD+A+  +A     F P L NP++ T+YYV++TGIS+GG  +  I  SVF+LD  
Sbjct  181  STLVFGDAAIPHTATGSVKFIPQLRNPRVATYYYVQITGISVGGNLLTNIPASVFQLDSH  240

Query  538  GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPT  359
            GNGG I DSGT++TRL   AY A+RDAFR     L  +++F +FDTC+D +G   + VPT
Sbjct  241  GNGGTIFDSGTTITRLEARAYTAVRDAFRAATMHLTSAADFKIFDTCYDFTGMNSISVPT  300

Query  358  VVLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSR  182
            V  HF+G  D+ LP +NY++PV     FCFAFA +  G S+IGN+QQQ FRV++D    +
Sbjct  301  VTFHFQGDVDMRLPPSNYIVPVSNNNIFCFAFAASM-GPSVIGNVQQQSFRVIYDNVHKQ  359

Query  181  LGFAASGC  158
            +G     C
Sbjct  360  IGLLPDQC  367



>ref|NP_001168599.1| uncharacterized protein LOC100382383 [Zea mays]
 gb|ACN28804.1| unknown [Zea mays]
Length=326

 Score =   186 bits (471),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            +S++ FGD A     V  PL+ +P+  TFYYV L+GIS+GG  +  I  S F +D T G+
Sbjct  142  ASTLQFGDGAAEAGTVTAPLVRSPRTSTFYYVALSGISVGGQPLS-IPASAFAMDATSGS  200

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GGVIVDSGT+VTRL  AAY A+RDAF +GA  L  +S  SLFDTC+DLS +T V+VP V 
Sbjct  201  GGVIVDSGTAVTRLQSAAYAALRDAFVQGAPSLPRTSGVSLFDTCYDLSDRTSVEVPAVS  260

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            L F G   + LPA NYLIPVD  G +C AFA T + +SIIGN+QQQG RV FD A   +G
Sbjct  261  LRFEGGGALRLPAKNYLIPVDGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTARGAVG  320

Query  175  FAASGC  158
            F  + C
Sbjct  321  FTPNKC  326



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 128/186 (69%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYYV L+G S+GG +V  I  S+F++  +G G
Sbjct  317  SSSLDFNSVQLGSGDATAPLLRNQKIDTFYYVGLSGFSVGGQKVT-IPDSIFEVSTSGTG  375

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF +  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  376  GVILDCGTAVTRLQTEAYNSLRDAFIRLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVA  435

Query  352  LHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA +R+G
Sbjct  436  FHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNRIG  495

Query  175  FAASGC  158
             +A+ C
Sbjct  496  LSANKC  501



>ref|XP_011072934.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Sesamum 
indicum]
Length=510

 Score =   190 bits (482),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 127/185 (69%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  ++A    +V   LL NP + TF YV+LTGIS+GG R   I  S+  +   G G
Sbjct  327  SSSTLDFNTARPADSVLATLLRNPLIKTFRYVDLTGISVGG-RALPIPSSLLAIGSDGKG  385

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGTSVTRL    Y  +RDAF+    +L P+S  SLFDTC++LSG++ V+VPTV  
Sbjct  386  GVIVDSGTSVTRLQTEVYSLVRDAFKNMTQNLPPASRLSLFDTCYNLSGRSRVQVPTVSF  445

Query  349  HFRGA-DVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G   +SLP  NYLIPVD EGKFCFAFAGT+  +SI+GN+QQQG RV FDLA + +GF
Sbjct  446  QFSGGRTLSLPPTNYLIPVDDEGKFCFAFAGTSGPMSIMGNVQQQGTRVSFDLANNYIGF  505

Query  172  AASGC  158
            + + C
Sbjct  506  SPNKC  510



>gb|KJB50738.1| hypothetical protein B456_008G185200 [Gossypium raimondii]
Length=495

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  DS+   + +  PL+ N +LDTFYY+ L GIS+GG  +  I  S F++D +GNG
Sbjct  312  SASTLEFDSSFPPNTITAPLIRNHQLDTFYYLGLIGISVGG-ELLPIPESAFQMDESGNG  370

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y  +RDAF KG  +L  +   +LFDTC++LS K+ V VPT+  
Sbjct  371  GIIIDSGTAVTRLQSDTYNVLRDAFAKGTKNLPSADSVALFDTCYNLSTKSSVDVPTLSF  430

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NY+IPVD+ G FCFAFA T+S LSIIGN+QQQG RV FDL  SR+GF
Sbjct  431  HFPEGKVLPLPAKNYMIPVDSVGTFCFAFAPTSSSLSIIGNVQQQGTRVGFDLGNSRVGF  490

Query  172  AASGC  158
              + C
Sbjct  491  VPNKC  495



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score =   190 bits (482),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 96/185 (52%), Positives = 128/185 (69%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG  A   S V  PL+ +P+ +TFYYV L GIS+GG  +  I P+ F +D  G+G
Sbjct  347  ASTLQFG--ASDSSTVTAPLMRSPRSNTFYYVALNGISVGGETLSDIPPAAFAMDEQGSG  404

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVIVDSGT+VTRL  +AY A+RDAF +G   L  +S  SLFDTC+DL+G++ V+VP V L
Sbjct  405  GVIVDSGTAVTRLQSSAYSALRDAFVRGTQALPRASGVSLFDTCYDLAGRSSVQVPAVSL  464

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G ++ LPA NYLIPVD  G +C AFA T   +SI+GN+QQQG RV FD A + +GF
Sbjct  465  RFEGGGELKLPAKNYLIPVDGAGTYCLAFAATGGAVSIVGNVQQQGIRVSFDTAKNTVGF  524

Query  172  AASGC  158
            + + C
Sbjct  525  SPNKC  529



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score =   189 bits (480),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 128/186 (69%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYYV L+G S+GG +V  I  S+F++D +G G
Sbjct  318  SSSLDFNSVQIGAGDATAPLLRNSKMDTFYYVGLSGFSVGGQQV-SIPSSLFEVDASGAG  376

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K  +D K  +S  SLFDTC+D S  + VKVPTV 
Sbjct  377  GVILDCGTAVTRLQTQAYNSLRDAFVKLTTDFKKGTSPISLFDTCYDFSSLSTVKVPTVT  436

Query  352  LHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   ++LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +G
Sbjct  437  FHFTGGKSLNLPAKNYLIPIDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNLIG  496

Query  175  FAASGC  158
             +A+ C
Sbjct  497  LSANKC  502



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score =   189 bits (480),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F            PLL N K+DTFYYV L+G S+GG +V  I  SVF +D +G G
Sbjct  315  SSSLDFNSVQAGTGDATAPLLRNSKIDTFYYVGLSGFSVGGQQV-SIPSSVFAVDASGAG  373

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  374  GVILDCGTAVTRLQTQAYNSLRDAFVKLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVA  433

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +G
Sbjct  434  FHFTGGKSIDLPAKNYLIPVDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNLIG  493

Query  175  FAASGC  158
             +A+ C
Sbjct  494  LSANQC  499



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F            PLL N K+DTFYYV L+G S+GG +V  I  SVF +D +G G
Sbjct  317  SSSLDFNSVQAGTGDATAPLLRNSKIDTFYYVGLSGFSVGGQQV-SIPSSVFAVDASGAG  375

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  376  GVILDCGTAVTRLQTQAYNSLRDAFVKLTANLKKGTSSISLFDTCYDFSSLSTVKVPTVA  435

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +G
Sbjct  436  FHFTGGKSIDLPAKNYLIPVDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANNLIG  495

Query  175  FAASGC  158
             +A+ C
Sbjct  496  LSANQC  501



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 124/186 (67%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYYV L+G S+GG +V  I  SVF++D  G G
Sbjct  319  SSSLDFNSVQIGDGDATAPLLLNKKIDTFYYVGLSGFSVGGEKVE-IPSSVFEVDAAGAG  377

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY A+RDAF K A D K  +S  SLFDTC+D S  + V VPTV 
Sbjct  378  GVILDCGTAVTRLQTEAYNALRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPTVA  437

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ ++L  + +G
Sbjct  438  FHFTGGKSIDLPAKNYLIPIDDAGTFCFAFAPTSSELSIIGNVQQQGTRITYNLENNLIG  497

Query  175  FAASGC  158
             +A+ C
Sbjct  498  LSANKC  503



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    V       P+L+N K+DTFYYV  TG S+GG +V  I  S F +D +G G
Sbjct  307  SSSLDFNSVQVGAGDATAPILSNSKIDTFYYVGFTGFSVGGQQV-SIPSSAFAVDASGTG  365

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  366  GVILDCGTAVTRLQTQAYNSLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVA  425

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   ++LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G
Sbjct  426  FHFTGGKTLNLPAKNYLIPIDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANHLIG  485

Query  175  FAASGC  158
             +A+ C
Sbjct  486  LSANKC  491



>ref|XP_009762361.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
sylvestris]
Length=483

 Score =   188 bits (477),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 129/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +V  PLL N +  TF+YV LTGIS+GG ++  I  SVF++D +GNG
Sbjct  300  SSSTLDFNSARPGDSVIAPLLRNSRRSTFFYVGLTGISVGG-QMLSIPASVFQVDGSGNG  358

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL   AY A+RD+F K   +L  + +F+LFDTC+DLS  T+V VPTV L
Sbjct  359  GIIVDSGTAVTRLQTTAYNALRDSFVKFTQNLPSAGQFALFDTCYDLSSMTKVSVPTVAL  418

Query  349  HFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   +SL   NYLI VD+ GKFC AFA T   LSIIGNIQQQG RV +DLA + +GF
Sbjct  419  HFTGDKTLSLHPKNYLIAVDSSGKFCLAFAPTEGSLSIIGNIQQQGTRVSYDLASNLVGF  478

Query  172  AASGC  158
            +   C
Sbjct  479  SPDKC  483



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score =   188 bits (478),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 124/186 (67%), Gaps = 2/186 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    V       P+L N K+DTFYYV  TG S+GG +   I  S F +D +G G
Sbjct  307  SSSLDFNSVQVGAGDATAPILRNSKIDTFYYVGFTGFSVGGQQQVSIPSSAFAVDASGTG  366

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  367  GVILDCGTAVTRLQTQAYNSLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVA  426

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   ++LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G
Sbjct  427  FHFTGGKTLNLPAKNYLIPIDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANHLIG  486

Query  175  FAASGC  158
             +A+ C
Sbjct  487  LSANKC  492



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = -3

Query  688  DSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSG  509
            +SA    +V  PLL + K+DTFYYV LTG+S+GG ++  I P++F++D +G GG+IVDSG
Sbjct  315  NSAAPSDSVNAPLLKSGKVDTFYYVGLTGMSVGG-QLLSIPPNLFQMDDSGYGGIIVDSG  373

Query  508  TSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-  332
            T++TRL   AY  +RDAF      LK ++ F+LFDTC+DLS ++ V +PTV   F G   
Sbjct  374  TAITRLQTQAYNTLRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKS  433

Query  331  VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            + LP  NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  434  LQLPPKNYLIPVDSVGTFCFAFAPTTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  491



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score =   187 bits (476),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = -3

Query  688  DSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSG  509
            +SA    +V  PLL + K+DTFYYV LTG+S+GG ++  I P++F++D +G GG+IVDSG
Sbjct  315  NSAAPSDSVNAPLLKSGKVDTFYYVGLTGMSVGG-QLLSIPPNLFQMDDSGYGGIIVDSG  373

Query  508  TSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-  332
            T++TRL   AY  +RDAF      LK ++ F+LFDTC+DLS ++ V +PTV   F G   
Sbjct  374  TAITRLQTQAYNTLRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKS  433

Query  331  VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            + LP  NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  434  LQLPPKNYLIPVDSVGTFCFAFAPTTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  491



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 123/186 (66%), Gaps = 2/186 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            S  + FG  +V   ++FTPL  NP L TFYY+ +T IS+GGA +  I P VF++D T G+
Sbjct  313  SGPLQFGPKSVPVGSIFTPLEKNPHLPTFYYLSVTAISVGGALLDSIPPEVFRIDETSGH  372

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GG I+DSGT VTRL  +AY A+RDAF  G   L  +   S+FDTC+DLSG   V VPTV 
Sbjct  373  GGFIIDSGTVVTRLVTSAYDAVRDAFVAGTGQLPRTDAVSIFDTCYDLSGLQFVSVPTVG  432

Query  352  LHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF  GA + LPA NYLIP+DT G FCFAFA   S +SI+GN QQQ  RV FD A S +G
Sbjct  433  FHFSNGASLILPAKNYLIPMDTVGTFCFAFAPAASSVSIMGNTQQQHIRVSFDSANSLVG  492

Query  175  FAASGC  158
            FA   C
Sbjct  493  FAFDQC  498



>ref|XP_010105777.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXC06062.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   186 bits (473),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 129/186 (69%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  D+A   +AV  PL  NP+L+TFYYV + G+ +GG  +  I  S F++D  GNG
Sbjct  310  SASTLEFDAAFPPNAVTAPLKGNPELETFYYVGMEGLGVGG-ELLPIPTSFFQVDANGNG  368

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSE-FSLFDTCFDLSGKTEVKVPTVV  353
            G+IVDSGT+VTRL    Y A+RDAF KG   L+ +    +LFDTC+DLS +T V+VPTV 
Sbjct  369  GIIVDSGTAVTRLQTDVYNALRDAFVKGTRHLQSTDGGVALFDTCYDLSSQTRVEVPTVS  428

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   +SLPA N+LIP+D+ G FCFAFA T+S LSIIGN+QQQG RV FDL  S +G
Sbjct  429  FHFAGGKFLSLPAENFLIPIDSNGTFCFAFAPTSSPLSIIGNVQQQGTRVGFDLVNSLIG  488

Query  175  FAASGC  158
            F  + C
Sbjct  489  FTPNDC  494



>ref|XP_009356391.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=491

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 129/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +S +AV  PL  NP+LDTF+YV LTG+S+GG  +  I  S F++D +GNG
Sbjct  308  SASTLDFNSPLSPNAVTAPLRRNPQLDTFHYVGLTGLSVGG-ELLPIPESAFQIDESGNG  366

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y  +RDAF KG  DL  +   +L D C+DLS K  V+VPT+  
Sbjct  367  GIIIDSGTAVTRLQTDTYNVLRDAFMKGTKDLPFTKGAALCDACYDLSSKRSVEVPTLSF  426

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA N+LIPVD++G FCFAFA T S LSIIGN+QQQG RV FDL  S +GF
Sbjct  427  HFADGKVLPLPAKNFLIPVDSDGTFCFAFAPTPSALSIIGNVQQQGARVGFDLVNSVVGF  486

Query  172  AASGC  158
            + + C
Sbjct  487  SRNQC  491



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   186 bits (473),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYYV L+G S+GG +V  +  ++F +D +G+G
Sbjct  316  SSSLDFNSVQLGSGDATAPLLRNQKIDTFYYVGLSGFSVGGQKVM-MPDAIFDVDASGSG  374

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  375  GVILDCGTAVTRLQTQAYNSLRDAFLKLTTNLKKGTSSISLFDTCYDFSSLSSVKVPTVA  434

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G
Sbjct  435  FHFTGGKSLDLPAKNYLIPVDDNGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANKIIG  494

Query  175  FAASGC  158
             + + C
Sbjct  495  LSGNKC  500



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score =   186 bits (473),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 100/187 (53%), Positives = 126/187 (67%), Gaps = 4/187 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLD-PTGN  533
            SSS+ F    +S      PLL N K+DTFYYV L+G S+GG +V  I  SVF++D  TG+
Sbjct  314  SSSLDFNSVQISDGDATAPLLRNKKIDTFYYVGLSGFSVGGEKVE-IPSSVFEVDDATGD  372

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTV  356
            GGVI+D GT+VTRL   AY ++RDAF K A D K  +S  SLFDTC+D S  + V VP V
Sbjct  373  GGVILDCGTAVTRLQTEAYNSLRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPAV  432

Query  355  VLHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRL  179
               F G   + LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA + +
Sbjct  433  AFQFTGGKSIDLPAKNYLIPIDDAGTFCFAFAPTSSELSIIGNVQQQGTRITYDLANNLI  492

Query  178  GFAASGC  158
            G +A+ C
Sbjct  493  GLSANQC  499



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = -3

Query  688  DSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSG  509
            +SA    +V  PLL + ++DTFYYV LTG+S+GG ++  I P++F++D +G GG+IVDSG
Sbjct  313  NSAAPTDSVNAPLLKSGRVDTFYYVGLTGMSVGG-QLLSIPPNLFQMDDSGYGGIIVDSG  371

Query  508  TSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-  332
            T++TRL   AY  +RDAF      LK ++ F+LFDTC+DLS ++ V +PTV   F G   
Sbjct  372  TAITRLQTQAYNTLRDAFVSRTPYLKKTNGFALFDTCYDLSSQSRVTIPTVSFEFAGGKS  431

Query  331  VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            + LP  NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV +DLA S +GF+   C
Sbjct  432  LQLPPKNYLIPVDSVGTFCFAFAPTTSSLSIIGNVQQQGTRVHYDLANSVVGFSPHKC  489



>tpg|DAA53545.1| TPA: hypothetical protein ZEAMMB73_483039 [Zea mays]
Length=506

 Score =   186 bits (473),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 101/186 (54%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            +S++ FGD A     V  PL+ +P+  TFYYV L+GIS+GG  +  I  S F +D T G+
Sbjct  322  ASTLQFGDGAAEAGTVTAPLVRSPRTSTFYYVALSGISVGGQPL-SIPASAFAMDATSGS  380

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GGVIVDSGT+VTRL  AAY A+RDAF +GA  L  +S  SLFDTC+DLS +T V+VP V 
Sbjct  381  GGVIVDSGTAVTRLQSAAYAALRDAFVQGAPSLPRTSGVSLFDTCYDLSDRTSVEVPAVS  440

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
            L F G   + LPA NYLIPVD  G +C AFA T + +SIIGN+QQQG RV FD A   +G
Sbjct  441  LRFEGGGALRLPAKNYLIPVDGAGTYCLAFAPTNAAVSIIGNVQQQGTRVSFDTARGAVG  500

Query  175  FAASGC  158
            F  + C
Sbjct  501  FTPNKC  506



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = -3

Query  670  SAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTR  494
            S +  PLL NP LDTFYYVELTGIS+GG ++  I PS F +D  TG GGVIVDSGTSVTR
Sbjct  351  STLTAPLLRNPLLDTFYYVELTGISVGG-KMLPIPPSAFAIDESTGAGGVIVDSGTSVTR  409

Query  493  LTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPA  317
            L  AAY  +RD F+     L P+     FDTC++LS +  V VP+V  HF  G  + LPA
Sbjct  410  LQEAAYATLRDDFQVQMEALPPAERMIPFDTCYNLSSRASVTVPSVAFHFPEGKALLLPA  469

Query  316  ANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
             NYLIPV+ EG +C AFA +    SIIGN+QQQG RV+FDL   R+GF    C
Sbjct  470  KNYLIPVNDEGTYCLAFAPSPVAFSIIGNVQQQGTRVIFDLVNDRVGFTPDVC  522



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 125/186 (67%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    V       P+L N K+DTFYYV  +G S+GG +V  I  S F +D +G G
Sbjct  307  SSSLDFNSVQVGAGDATAPILRNSKIDTFYYVGFSGFSVGGQQV-SIPSSAFAVDASGTG  365

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K  ++LK  +S  SLFDTC+D S  + VKVPTV 
Sbjct  366  GVILDCGTAVTRLQTQAYNSLRDAFVKLTANLKRGTSSISLFDTCYDFSSLSTVKVPTVA  425

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   ++LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ +DLA   +G
Sbjct  426  FHFTGGKTLNLPAKNYLIPIDDAGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLANHLIG  485

Query  175  FAASGC  158
             +A+ C
Sbjct  486  LSANKC  491



>ref|XP_004298296.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Fragaria 
vesca subsp. vesca]
Length=481

 Score =   184 bits (468),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  ++A+  +AV  PL  N +L+TFYYV LTGIS+GG  ++ I  + F++D +GNG
Sbjct  298  STSTLEFNTALPHNAVTAPLRRNSQLNTFYYVGLTGISVGGDMLK-IPANAFEIDESGNG  356

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y A+R AF      L+ +S  +LFD C+DLS    V VP +  
Sbjct  357  GIIIDSGTAVTRLQTETYDALRSAFVNMTKGLESTSGVALFDACYDLSKIESVDVPALSF  416

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G ++ LPA NYLIPVD++G FCFAFA T+  LSIIGN+QQQG RV FD+A S +GF
Sbjct  417  HFEDGKELPLPAKNYLIPVDSQGTFCFAFAPTSGALSIIGNVQQQGTRVSFDIANSVVGF  476

Query  172  AASGC  158
            +A  C
Sbjct  477  SADQC  481



>ref|XP_010549135.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=496

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 123/171 (72%), Gaps = 3/171 (2%)
 Frame = -3

Query  664  VFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTR  485
            V  PLL N ++DTFYYV L G S+GG R   I PSVF +D +G+GGVIVD GT+VTRL  
Sbjct  327  VTAPLLRNRQIDTFYYVGLPGFSVGG-RPVAIPPSVFAVDESGSGGVIVDCGTAVTRLQT  385

Query  484  AAYVAMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAAN  311
             AY ++RD+F +  + L+  +S  SLFDTC+D S  + V+VPTV LHF G   + LPA N
Sbjct  386  QAYNSLRDSFARLTTHLRSATSTISLFDTCYDFSSLSTVRVPTVALHFAGGKSLDLPAKN  445

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YLIPVD+ G FCFAFA T++ LSIIGN+QQQG RV FDLA + +GF+ + C
Sbjct  446  YLIPVDSAGTFCFAFAPTSTSLSIIGNVQQQGTRVSFDLANNLVGFSPNKC  496



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score =   185 bits (469),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/187 (53%), Positives = 125/187 (67%), Gaps = 4/187 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLD-PTGN  533
            SSS+ F    +S      PLL N K+DTFYYV L+G S+GG +V  I  SVF++D  TG+
Sbjct  314  SSSLDFNSVQISDGDATAPLLRNKKIDTFYYVGLSGFSVGGEKVE-IPSSVFEVDDATGD  372

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTV  356
            GGVI+D GT+VTRL   AY ++RDAF K A D K  +S  SLFDTC+D S  + V VP V
Sbjct  373  GGVILDCGTAVTRLQTEAYNSLRDAFVKLAKDFKNATSSISLFDTCYDFSSMSSVNVPAV  432

Query  355  VLHFRG-ADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRL  179
               F G   + LPA NYLIP+D  G FCFAFA T+S LSIIGN+QQQG R+ +DL  + +
Sbjct  433  AFQFTGGKSIDLPAKNYLIPIDDAGTFCFAFAPTSSELSIIGNVQQQGTRITYDLENNLI  492

Query  178  GFAASGC  158
            G +A+ C
Sbjct  493  GLSANQC  499



>ref|XP_009616228.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Nicotiana 
tomentosiformis]
Length=485

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 125/185 (68%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +V  PLL N +  TF+YV LTGIS+GG ++  I  SVF++D +GNG
Sbjct  302  SSSTLDFNSARPGDSVIAPLLRNSRRSTFFYVGLTGISVGG-QMLSIPASVFQVDGSGNG  360

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL   AY A+RD+F K   +L  +  FSLFDTC+DLS    V VPTV  
Sbjct  361  GIIVDSGTAVTRLQTTAYNALRDSFVKLTQNLPTAGRFSLFDTCYDLSSMKRVSVPTVAF  420

Query  349  HFR-GADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF     +SL   NYLIPVD+ GKFC AFA T   LSIIGNIQQQG RV +DLA + +GF
Sbjct  421  HFSDDKTLSLHPKNYLIPVDSSGKFCLAFAPTEGSLSIIGNIQQQGTRVSYDLANNLVGF  480

Query  172  AASGC  158
            +   C
Sbjct  481  SPDKC  485



>ref|XP_009103072.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=487

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 136/184 (74%), Gaps = 3/184 (2%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S++ FG S +S  AV  PLL N +LDTFYY+ LTGIS+GG  ++ I  S F++D +G GG
Sbjct  306  STVEFG-SDISPDAVVAPLLRNHQLDTFYYLGLTGISVGGEMLQ-IPSSSFEVDESGGGG  363

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            +I+DSGT+VTRL    Y ++RDAF KG +DL+ ++  ++FDTC++L+ KT ++VPTV  H
Sbjct  364  IIIDSGTAVTRLQTGIYNSLRDAFVKGTTDLEKAAGVAMFDTCYNLAAKTTIEVPTVAFH  423

Query  346  FRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFA  170
            F G ++ +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF+
Sbjct  424  FPGGNMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGFS  483

Query  169  ASGC  158
             + C
Sbjct  484  TNKC  487



>ref|XP_010551158.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Tarenaya 
hassleriana]
Length=495

 Score =   184 bits (468),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 98/171 (57%), Positives = 121/171 (71%), Gaps = 3/171 (2%)
 Frame = -3

Query  664  VFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTR  485
            V  PLL N K+DTFYY+ LTG S+GG  V  I PSVF +D +G GG IVD G +VTRL  
Sbjct  326  VTAPLLRNHKIDTFYYLGLTGFSVGGRSV-AIPPSVFAVDESGRGGGIVDCGPAVTRLQT  384

Query  484  AAYVAMRDAFRKGASDLK-PSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGADVSLPAAN  311
             AY ++RDAF +  + LK  ++  SLFDTC+D S  + VKVPTV LHF  G  + LPA N
Sbjct  385  QAYNSLRDAFARLTTHLKSATTSISLFDTCYDFSSLSTVKVPTVALHFGDGKYLDLPAKN  444

Query  310  YLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            YLIPVD+ G FCFAFA T++ LSI+GN+QQQG RV FDLA + +GFA + C
Sbjct  445  YLIPVDSAGTFCFAFAPTSTPLSIVGNVQQQGTRVSFDLANNLVGFATNKC  495



>ref|XP_003520035.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   184 bits (466),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -3

Query  688  DSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSG  509
            +S + R+ V  PL  NP+LDTFYY+ L GIS+GG  +  I  S+F++D  G GG+I+DSG
Sbjct  308  NSPLPRNVVTAPLRRNPELDTFYYLGLKGISVGGEAL-PIPESIFEVDAIGGGGIIIDSG  366

Query  508  TSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGAD  332
            T+VTRL    Y A+RDAF KGA  +  ++  SLFDTC+DLS +  V+VPTV  HF  G +
Sbjct  367  TAVTRLRSEVYDALRDAFVKGAKGIPKANGVSLFDTCYDLSSRESVQVPTVSFHFPEGRE  426

Query  331  VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            + LPA NYLIPVD+ G FCFAFA TTS LSI+GN+QQQG RV FD+A S +GF+A  C
Sbjct  427  LPLPARNYLIPVDSVGTFCFAFAPTTSSLSIMGNVQQQGTRVGFDIANSLVGFSADSC  484



>ref|XP_010044282.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1 [Eucalyptus grandis]
Length=495

 Score =   184 bits (467),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 127/185 (69%), Gaps = 3/185 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            +S++ FG S +  +AV  PL+ NP+LDTF Y+ LTGIS+GG  +R +    F+LDP G G
Sbjct  313  ASTLEFG-SPLPPNAVAAPLIRNPQLDTFLYLGLTGISVGGDPLR-LPEGAFQLDPHGGG  370

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL    Y AMRDAF +G   L  +  F+LFDTC+DLS K  V+VPTV L
Sbjct  371  GIIVDSGTAVTRLRAEVYGAMRDAFARGTRGLPAAEGFALFDTCYDLSSKGSVEVPTVGL  430

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F  G  V +   NY+IPV + G FCFAFA T+S LSI+GN+QQQG RV FDL  S +GF
Sbjct  431  RFGDGRXVGVAGQNYMIPVHSNGTFCFAFAPTSSALSILGNVQQQGTRVGFDLKRSLIGF  490

Query  172  AASGC  158
              + C
Sbjct  491  VPNKC  495



>ref|XP_009336599.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=488

 Score =   184 bits (466),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 129/185 (70%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +  +AV  PL  N +LDTFYY+ LTG+S+GG+ +  I  S F++D +GNG
Sbjct  305  SASTLDFNSPLRPNAVTAPLRRNSQLDTFYYLGLTGLSVGGSLLP-IPESAFQIDGSGNG  363

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y  +RDAF KG  DL  +   +LFD C+DLS +  V+VPTV  
Sbjct  364  GIIIDSGTAVTRLQTDTYNVLRDAFMKGTKDLPFTKGPALFDACYDLSSRKRVEVPTVSF  423

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA N+LIPVD++G FCFAFA T S LSIIGN+QQQG RV FDL  S +GF
Sbjct  424  HFADGKVLPLPAKNFLIPVDSDGTFCFAFAPTPSSLSIIGNVQQQGTRVGFDLVNSVVGF  483

Query  172  AASGC  158
            + + C
Sbjct  484  SLNQC  488



>ref|XP_002961719.1| hypothetical protein SELMODRAFT_64161, partial [Selaginella moellendorffii]
 gb|EFJ36979.1| hypothetical protein SELMODRAFT_64161, partial [Selaginella moellendorffii]
Length=357

 Score =   180 bits (457),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 91/185 (49%), Positives = 122/185 (66%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS ++FG +A+  +A FTPLL NP+++TFYY  LTGIS+GG  +  I P+ F L   G G
Sbjct  174  SSPLIFGRTAIPFAARFTPLLKNPRINTFYYAVLTGISVGGTPLP-IPPAQFALTGNGTG  232

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G I+DSGTSVTR+   AY  +RDA+R  + +L P+    L DTCF+  G   V++P++VL
Sbjct  233  GAILDSGTSVTRVVPPAYAVLRDAYRAASRNLPPAPGVYLLDTCFNFQGLPTVQIPSLVL  292

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G D+ LP  N LIPVD  G FC AFA ++  +S+IGN+QQQ FR+ FDL  S +  
Sbjct  293  HFDNGVDMVLPGGNILIPVDRSGTFCLAFAPSSMPISVIGNVQQQTFRIGFDLQRSLIAI  352

Query  172  AASGC  158
            A   C
Sbjct  353  APREC  357



>ref|XP_008389306.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
 ref|XP_008367019.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=488

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 128/185 (69%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            S+S +  +S +  +AV  PL  N +LDTFYY+ +TG+S+GG  +  I  S F++D +GNG
Sbjct  305  SASTLDFNSPLRPNAVTAPLRRNSQLDTFYYLGVTGLSVGGXLLP-IPESAFQIDGSGNG  363

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+I+DSGT+VTRL    Y  +RDAF KG  DL  +   +LFD C+DLS +  V+VPTV  
Sbjct  364  GIIIDSGTAVTRLQTDTYNVLRDAFMKGTKDLPVTKGAALFDACYDLSSRKSVEVPTVSF  423

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA N+LIPVD++G FCFAFA T S LSIIGN+QQQG RV FDL  S +GF
Sbjct  424  HFADGKVLPLPAKNFLIPVDSDGTFCFAFAPTPSSLSIIGNVQQQGTRVGFDLVNSVVGF  483

Query  172  AASGC  158
            + + C
Sbjct  484  SPNQC  488



>ref|XP_002964789.1| hypothetical protein SELMODRAFT_82470 [Selaginella moellendorffii]
 gb|EFJ33627.1| hypothetical protein SELMODRAFT_82470 [Selaginella moellendorffii]
Length=390

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 122/185 (66%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS ++FG +A+  +A FTPLL NP++DTFYY  LTGIS+GG  +  I P+ F L   G G
Sbjct  207  SSPLIFGRTAIPFAARFTPLLKNPRIDTFYYAILTGISVGGTAL-PIPPAQFALTGNGTG  265

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G I+DSGTSVTR+  AAY  +RDA+R  + +L P+    L DTCF+  G   V++P++VL
Sbjct  266  GAILDSGTSVTRVVPAAYAVLRDAYRAASRNLPPAPGVYLLDTCFNFQGLPTVQIPSLVL  325

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF    D+ LP  N LIPVD  G FC AFA ++  +S+IGN+QQQ FR+ FDL  S +  
Sbjct  326  HFDNDVDMVLPGGNILIPVDRSGTFCLAFAPSSMPISVIGNVQQQTFRIGFDLQRSLIAI  385

Query  172  AASGC  158
            A   C
Sbjct  386  APREC  390



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYYV L+G S+GG +V  +  ++F +D +G+G
Sbjct  316  SSSLDFNSVQLGGGDATAPLLRNKKIDTFYYVGLSGFSVGGEKVV-LPDAIFDVDASGSG  374

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K   +LK  SS  SLFDTC+D S  + VKVPTV 
Sbjct  375  GVILDCGTAVTRLQTQAYNSLRDAFLKLTVNLKKGSSSISLFDTCYDFSSLSTVKVPTVA  434

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DL+ + +G
Sbjct  435  FHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLSKNVIG  494

Query  175  FAASGC  158
             + + C
Sbjct  495  LSGNKC  500



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 127/185 (69%), Gaps = 15/185 (8%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +S V   +V  PL+ + K++TFYY+ LTG S+GG  V  I+P +F+++ +G G
Sbjct  312  SSTLDF-NSGVPADSVIAPLMKSRKVNTFYYIGLTGFSVGGQAVN-ISPGLFEINESGEG  369

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            GVI+D GT++TRL   AY A+RDA              +LFDTC+DLS K+ VKVPTV  
Sbjct  370  GVIIDCGTAITRLQTQAYNALRDA------------GVALFDTCYDLSSKSSVKVPTVSF  417

Query  349  HF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF  G  + LPA NYLIPVD+ G FCFAFA T+S +SIIGN+QQQG RV FDLA +R+G 
Sbjct  418  HFGEGKSLDLPAKNYLIPVDSSGTFCFAFAPTSSSMSIIGNVQQQGTRVSFDLANNRVGL  477

Query  172  AASGC  158
            ++  C
Sbjct  478  SSHKC  482



>ref|XP_002468182.1| hypothetical protein SORBIDRAFT_01g041210 [Sorghum bicolor]
 gb|EER95180.1| hypothetical protein SORBIDRAFT_01g041210 [Sorghum bicolor]
Length=490

 Score =   182 bits (463),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 106/192 (55%), Positives = 127/192 (66%), Gaps = 9/192 (5%)
 Frame = -3

Query  709  SSSIVFGDSAVSRS--AVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-T  539
            SS++ FG  AV  S    FTP + N  + TFYYV LTGIS+GG RV G+     +LDP T
Sbjct  300  SSTLTFGAGAVDTSPPVSFTPTVLNLNMPTFYYVRLTGISVGGVRVPGVTERDLQLDPYT  359

Query  538  GNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSS---EFSLFDTCFDLSGKTEVK  368
            G GGVIVDSGT+VTRL R AY A RDAFR  A DL   S       FDTC+ + G+   K
Sbjct  360  GRGGVIVDSGTAVTRLARPAYTAFRDAFRAVAVDLGQVSIGGPSGFFDTCYTVGGRGMKK  419

Query  367  VPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAGT-TSGLSIIGNIQQQGFRVVFDL  194
            VPTV +HF G+ +V L   NYLIPVD+ G  CFAFA T    +SIIGNIQQQGFR+V+D+
Sbjct  420  VPTVSMHFAGSVEVKLQPKNYLIPVDSMGTVCFAFAATGDHSVSIIGNIQQQGFRIVYDI  479

Query  193  AGSRLGFAASGC  158
             G R+GFA + C
Sbjct  480  GG-RVGFAPNSC  490



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 126/186 (68%), Gaps = 3/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS+ F    +       PLL N K+DTFYYV L+G S+GG +V  +  ++F +D +G+G
Sbjct  316  SSSLDFNSVQLGGGDATAPLLRNKKIDTFYYVGLSGFSVGGEKVV-LPDAIFDVDASGSG  374

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKP-SSEFSLFDTCFDLSGKTEVKVPTVV  353
            GVI+D GT+VTRL   AY ++RDAF K   +LK  SS  SLFDTC+D S  + VKVPTV 
Sbjct  375  GVILDCGTAVTRLQTQAYNSLRDAFLKLTVNLKKGSSSISLFDTCYDFSSLSTVKVPTVA  434

Query  352  LHFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF G   + LPA NYLIPVD  G FCFAFA T+S LSIIGN+QQQG R+ +DL+ + +G
Sbjct  435  FHFTGGKSLDLPAKNYLIPVDDSGTFCFAFAPTSSSLSIIGNVQQQGTRITYDLSKNVIG  494

Query  175  FAASGC  158
             + + C
Sbjct  495  LSGNKC  500



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 125/174 (72%), Gaps = 6/174 (3%)
 Frame = -3

Query  661  FTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-TGNGGVIVDSGTSVTRLTR  485
            FTP++ NP++ TFYYV + G S+GGARVRG++    +LDP TG GGVI+DSGTSVTRL R
Sbjct  344  FTPMVRNPRMSTFYYVRVAGFSVGGARVRGVSERDLRLDPATGRGGVILDSGTSVTRLAR  403

Query  484  AAYVAMRDAFRKGASD---LKPSSE-FSLFDTCFDLSGKTEVKVPTVVLHFRG-ADVSLP  320
              Y A+RDAFR  A+    L+PS   FSLFDTC+DL  +  VKVPT+ +H  G A V+LP
Sbjct  404  PVYAAVRDAFRAAAAAAGGLRPSPGGFSLFDTCYDLGRRRVVKVPTLSVHLAGGAAVALP  463

Query  319  AANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
              NYLIPVDT G FCFA AGT  G+SI+GNIQQQGFRVVFD    R+G     C
Sbjct  464  PENYLIPVDTRGTFCFALAGTDGGVSILGNIQQQGFRVVFDGDAQRVGLVPKSC  517



>emb|CDY03848.1| BnaC07g10730D [Brassica napus]
Length=485

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 135/184 (73%), Gaps = 3/184 (2%)
 Frame = -3

Query  706  SSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGG  527
            S++ FG S +S  AV  PLL N +LDTFYY+ LTGIS+GG  ++ I  S F++D +G GG
Sbjct  304  STVEFG-SDISPDAVVAPLLRNHQLDTFYYLGLTGISVGGEMLQ-IPSSSFEVDESGGGG  361

Query  526  VIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLH  347
            +I+DSGT+VTRL    Y ++RD+F KG +DL+ ++  ++FDTC++L+ KT ++VPTV  H
Sbjct  362  IIIDSGTAVTRLQTGIYDSLRDSFVKGTTDLEKAAGVAMFDTCYNLAAKTTIEVPTVAFH  421

Query  346  FRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFA  170
            F G ++ +LPA NY+IPVD+ G FC AFA T S L+IIGN+QQQG RV FDLA S +GF 
Sbjct  422  FPGGNMLALPAKNYMIPVDSVGTFCLAFAPTASSLAIIGNVQQQGTRVGFDLANSLIGFL  481

Query  169  ASGC  158
             + C
Sbjct  482  TNKC  485



>ref|XP_004235788.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=486

 Score =   182 bits (461),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 124/185 (67%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +V  PLL N +  TF+YV LTGIS+GG ++  I  SVF++D +G+G
Sbjct  303  SSSTLDFNSARPGDSVIAPLLRNSRRSTFFYVGLTGISVGG-QMLSIPASVFQVDRSGSG  361

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL   AY  +RD+FRK    L  + +F+LFDTC+DLS      VPT+  
Sbjct  362  GIIVDSGTAVTRLKNTAYNTLRDSFRKYTQHLPSAGQFALFDTCYDLSSMKRASVPTLSF  421

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   + L   NYLIPVD+ GKFC AFA T   LSIIGNIQQQG RV +DLA + +GF
Sbjct  422  HFSGGKALPLHPKNYLIPVDSSGKFCLAFAPTDGSLSIIGNIQQQGTRVSYDLANNLVGF  481

Query  172  AASGC  158
            +   C
Sbjct  482  SPDKC  486



>ref|XP_010695864.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Beta vulgaris 
subsp. vulgaris]
Length=484

 Score =   181 bits (460),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = -3

Query  655  PLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSGTSVTRLTRAAY  476
            PLL+NP  +TFYY+ L GIS+GG  +  +  + F++D  G+GGVI+D+GT+VTRL    Y
Sbjct  319  PLLSNPTAETFYYLGLIGISVGGTELT-VPTTAFQIDKDGSGGVIIDTGTAVTRLETRVY  377

Query  475  VAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHFRGAD-VSLPAANYLIP  299
              +RD FRKG + L  + E ++FDTC+DL GK  V+VPT+  HF G   ++LPA NY+IP
Sbjct  378  ELLRDEFRKGTTHLPTTDEVAIFDTCYDLRGKESVEVPTLEFHFAGGKTLALPAKNYVIP  437

Query  298  VDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            VDTEG FC AFA TT+ +SIIGN+QQ+G RV F+L  S + F  + C
Sbjct  438  VDTEGTFCLAFAPTTASMSIIGNVQQEGIRVGFNLVYSLVTFEPNQC  484



>emb|CDP20730.1| unnamed protein product [Coffea canephora]
Length=494

 Score =   181 bits (460),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 129/186 (69%), Gaps = 4/186 (2%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +VF  ++ NPKLD FYY+++ GI++GG  +  I  SVF++D  G G
Sbjct  311  SSSTLDFNSAPPGDSVFASMVRNPKLDLFYYLDMVGINVGGETL-SIPASVFQVDGNGRG  369

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSG-KTEVKVPTVV  353
            GVIVDSGT+VTRL   AY A+RDAF+K ASDL  SS FSLFDTC+D S     V+VPTV 
Sbjct  370  GVIVDSGTAVTRLNTQAYNALRDAFKKYASDLPSSSGFSLFDTCYDFSSVGGSVRVPTVS  429

Query  352  LHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
              F  G  + L  +NYL+PVD  GKFC AFA T+S LSIIGN+QQQG RV FDLA  + G
Sbjct  430  FLFASGKRLLLKPSNYLVPVDGRGKFCLAFAPTSS-LSIIGNVQQQGTRVSFDLANRQFG  488

Query  175  FAASGC  158
            F+ + C
Sbjct  489  FSPNKC  494



>gb|ABR17396.1| unknown [Picea sitchensis]
Length=350

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 94/186 (51%), Positives = 120/186 (65%), Gaps = 2/186 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPT-GN  533
            S ++ FG  +V   ++FTPL+ NP L TFYY+ +  IS+GG  +  +    F++D T G 
Sbjct  164  SGTLEFGPESVPIGSIFTPLVANPFLPTFYYLSMVAISVGGVILDSVPSEAFRIDETTGR  223

Query  532  GGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVV  353
            GG+I+DSGT+VTRL  +AY A+RDAF  G   L  +   S+FDTC+DLS    V +P V 
Sbjct  224  GGIIIDSGTAVTRLQTSAYDALRDAFIAGTQHLPRADGISIFDTCYDLSALQSVSIPAVG  283

Query  352  LHF-RGADVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLG  176
             HF  GA   LPA N LIP+D+ G FCFAFA   S LSI+GNIQQQG RV FD A S +G
Sbjct  284  FHFSNGAGFILPAKNCLIPMDSMGTFCFAFAPADSNLSIMGNIQQQGIRVSFDSANSLVG  343

Query  175  FAASGC  158
            FA   C
Sbjct  344  FAIDQC  349



>ref|XP_006354732.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=491

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 124/185 (67%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +VF PLL N + DTF+YV L GIS+GG  ++ +  S+F++D  G G
Sbjct  308  SSSTLEFNSAGPSDSVFAPLLRNSRRDTFFYVGLEGISVGGEMLQ-VPLSIFQIDDNGRG  366

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL  +AY A+RD F K A +L  + EF LFDTCFDLS  +   VPTV  
Sbjct  367  GIIVDSGTAVTRLQSSAYNALRDTFVKYAQNLPSAGEFELFDTCFDLSSMSTANVPTVAF  426

Query  349  HFRGA-DVSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   + L A N ++P+D+ GK+C AFA T   +SIIGN+QQQG RV +DL  + +GF
Sbjct  427  HFSGGRTLPLHAQNTVVPIDSSGKYCLAFAPTDESMSIIGNVQQQGTRVSYDLTNNLVGF  486

Query  172  AASGC  158
            +   C
Sbjct  487  SLDKC  491



>ref|XP_010092769.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB52179.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=494

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 125/185 (68%), Gaps = 7/185 (4%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SS++ F +SA    +VF  +L N K  TFY+VELTG+S+GG  +   +PS      +G G
Sbjct  316  SSALEF-NSASPSDSVFAQILKNGKTKTFYFVELTGMSVGGVTI-SFSPS----QGSGEG  369

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G IVDSGT+VTRL    Y  +RD F++G  DL  ++  +LFDTC+DLS +T V+VPTV  
Sbjct  370  GYIVDSGTAVTRLRTQIYEPLRDEFKRGTQDLPAANGVALFDTCYDLSSRTSVRVPTVSF  429

Query  349  HFRGADV-SLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
             F G     LPA NYLIPVD  G FCFAFA TTS LSI+GN+QQQG RV +DLA SR+GF
Sbjct  430  LFAGGKAWHLPAKNYLIPVDNSGTFCFAFAPTTSSLSIVGNVQQQGTRVSYDLANSRVGF  489

Query  172  AASGC  158
            + + C
Sbjct  490  SPNKC  494



>ref|XP_004241622.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=495

 Score =   181 bits (459),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 125/185 (68%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +VF PLL N + DTF+Y+ L GIS+    ++ +  S+F++D  G G
Sbjct  312  SSSTLEFNSAGPSDSVFAPLLRNSRRDTFFYIGLEGISVDDEMLQ-VPASIFQVDDNGRG  370

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL  +AY A+RD F K A +L  + EF LFDTCFDLS  + V VPT+ L
Sbjct  371  GIIVDSGTAVTRLQSSAYSALRDTFVKYAQNLPSAGEFELFDTCFDLSSMSTVNVPTMAL  430

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   + L A N ++PVD+ GK+C AFA T   +SIIGN+QQQG RV +DL+ + +GF
Sbjct  431  HFSGGQTLPLQAQNTVVPVDSSGKYCLAFAPTDESMSIIGNVQQQGIRVSYDLSNNLVGF  490

Query  172  AASGC  158
            +   C
Sbjct  491  SLDKC  495



>ref|XP_006341626.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=486

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 97/185 (52%), Positives = 124/185 (67%), Gaps = 2/185 (1%)
 Frame = -3

Query  709  SSSIVFGDSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNG  530
            SSS +  +SA    +V  PLL N +  TF+YV LTGIS+GG ++  I  SVF++D +G+G
Sbjct  303  SSSTLDFNSARPGDSVIAPLLRNSRRSTFFYVGLTGISVGG-QMLSIPASVFQVDGSGSG  361

Query  529  GVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVL  350
            G+IVDSGT+VTRL   AY  +RD+F K    L  + +F+LFDTC+DLS  T   VPT+  
Sbjct  362  GIIVDSGTAVTRLKSTAYNTLRDSFVKYTQHLPSAGKFALFDTCYDLSSMTRASVPTLAF  421

Query  349  HFRGAD-VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGF  173
            HF G   + L   NYLIPVD+ GKFC AFA T   LSIIGNIQQQG RV +DLA + +GF
Sbjct  422  HFSGGKTLPLHPKNYLIPVDSSGKFCLAFAPTDGSLSIIGNIQQQGTRVSYDLANNLVGF  481

Query  172  AASGC  158
            +   C
Sbjct  482  SPDKC  486



>ref|XP_002442590.1| hypothetical protein SORBIDRAFT_08g022570 [Sorghum bicolor]
 gb|EES16428.1| hypothetical protein SORBIDRAFT_08g022570 [Sorghum bicolor]
Length=494

 Score =   179 bits (455),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 109/193 (56%), Positives = 131/193 (68%), Gaps = 8/193 (4%)
 Frame = -3

Query  712  PSSSIVFGDSAVSRS--AVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDP-  542
            PSS++ FG  AV  S  A FTP + N  + TFYYV L G+S+GG RV G+     +LDP 
Sbjct  302  PSSTLTFGAGAVDTSPPASFTPTVLNQNMPTFYYVRLIGVSVGGVRVPGVTERDLQLDPY  361

Query  541  TGNGGVIVDSGTSVTRLTRAAYVAMRDAFRKGASDLKPSS---EFSLFDTCFDLSGKTEV  371
            TG GGVI+DSGT+VTRL R AYVA RDAFR  A+ L   S      LFDTC+ + G+  V
Sbjct  362  TGRGGVILDSGTTVTRLARPAYVAFRDAFRAAATSLGQVSTGGPSGLFDTCYTVGGRAGV  421

Query  370  KVPTVVLHFRGA-DVSLPAANYLIPVDTEGKFCFAFAGT-TSGLSIIGNIQQQGFRVVFD  197
            KVP V +HF G  +VSL   NYLIPVD+ G  CFAFAGT    +S+IGNI QQGFRVV+D
Sbjct  422  KVPAVSMHFAGGVEVSLQPKNYLIPVDSRGTVCFAFAGTGDRSVSVIGNILQQGFRVVYD  481

Query  196  LAGSRLGFAASGC  158
            LAG R+GFA + C
Sbjct  482  LAGQRVGFAPNNC  494



>ref|XP_003517994.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 126/178 (71%), Gaps = 2/178 (1%)
 Frame = -3

Query  688  DSAVSRSAVFTPLLTNPKLDTFYYVELTGISIGGARVRGINPSVFKLDPTGNGGVIVDSG  509
            +S + R+A   PL+ NP+LDTFYY+ L GIS+GG  +  I  S F++D  G GG+I+DSG
Sbjct  308  NSPLPRNAATAPLMRNPELDTFYYLGLKGISVGGEAL-PIPESSFEVDAIGGGGIIIDSG  366

Query  508  TSVTRLTRAAYVAMRDAFRKGASDLKPSSEFSLFDTCFDLSGKTEVKVPTVVLHF-RGAD  332
            T+VTRL    Y A+RDAF KGA  +  ++  SLFDTC+DLS +  V++PTV   F  G +
Sbjct  367  TAVTRLRSEVYDALRDAFVKGAKGIPKANGVSLFDTCYDLSSRESVEIPTVSFRFPEGRE  426

Query  331  VSLPAANYLIPVDTEGKFCFAFAGTTSGLSIIGNIQQQGFRVVFDLAGSRLGFAASGC  158
            + LPA NYLIPVD+ G FCFAFA TTS LSIIGN+QQQG RV FD+A S +GF+   C
Sbjct  427  LPLPARNYLIPVDSVGTFCFAFAPTTSSLSIIGNVQQQGTRVGFDIANSLVGFSVDSC  484



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1260188911410