BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037K05

Length=764
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU19120.1|  hypothetical protein MIMGU_mgv1a008446mg                402   8e-137   Erythranthe guttata [common monkey flower]
ref|XP_004134584.1|  PREDICTED: ferredoxin--NADP reductase, root ...    400   9e-136   Cucumis sativus [cucumbers]
gb|AII16855.1|  ferredoxin-NADP(+) reductase                            399   1e-135   Ocimum basilicum [basil]
ref|XP_008439552.1|  PREDICTED: ferredoxin--NADP reductase, root ...    399   2e-135   Cucumis melo [Oriental melon]
gb|KHN14331.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    397   5e-135   Glycine soja [wild soybean]
ref|XP_006597058.1|  PREDICTED: uncharacterized protein LOC100807...    398   6e-135   Glycine max [soybeans]
ref|NP_001239798.1|  uncharacterized protein LOC100807968               397   6e-135   Glycine max [soybeans]
ref|NP_001239859.1|  uncharacterized protein LOC100789291               397   1e-134   Glycine max [soybeans]
ref|XP_006586681.1|  PREDICTED: uncharacterized protein LOC100789...    397   1e-134   Glycine max [soybeans]
ref|XP_003594526.1|  Ferredoxin-NADP reductase                          397   1e-134   Medicago truncatula
ref|XP_009614066.1|  PREDICTED: ferredoxin--NADP reductase, root-...    396   2e-134   Nicotiana tomentosiformis
gb|KDP34933.1|  hypothetical protein JCGZ_09221                         395   4e-134   Jatropha curcas
emb|CDP17310.1|  unnamed protein product                                398   4e-134   Coffea canephora [robusta coffee]
ref|XP_009761528.1|  PREDICTED: ferredoxin--NADP reductase, root-...    395   4e-134   Nicotiana sylvestris
ref|XP_010051952.1|  PREDICTED: ferredoxin--NADP reductase, root ...    395   4e-134   Eucalyptus grandis [rose gum]
ref|NP_001058890.1|  Os07g0147900                                       395   4e-134   
gb|EAZ02773.1|  hypothetical protein OsI_24896                          395   9e-134   Oryza sativa Indica Group [Indian rice]
ref|XP_004231567.1|  PREDICTED: ferredoxin--NADP reductase, root-...    394   1e-133   Solanum lycopersicum
ref|XP_011096684.1|  PREDICTED: ferredoxin--NADP reductase, root-...    395   2e-133   Sesamum indicum [beniseed]
ref|XP_007147485.1|  hypothetical protein PHAVU_006G128400g             394   2e-133   Phaseolus vulgaris [French bean]
ref|XP_010098567.1|  Ferredoxin--NADP reductase, root isozyme           394   3e-133   
ref|XP_010529363.1|  PREDICTED: ferredoxin--NADP reductase, root ...    393   3e-133   Tarenaya hassleriana [spider flower]
ref|XP_002523191.1|  ferredoxin--NADP reductase, putative               393   4e-133   Ricinus communis
sp|O04397.1|FENR2_TOBAC  RecName: Full=Ferredoxin--NADP reductase...    393   4e-133   Nicotiana tabacum [American tobacco]
ref|XP_004293987.1|  PREDICTED: ferredoxin--NADP reductase, root ...    393   5e-133   Fragaria vesca subsp. vesca
ref|XP_004486455.1|  PREDICTED: ferredoxin--NADP reductase, root ...    392   5e-133   Cicer arietinum [garbanzo]
emb|CDY02299.1|  BnaA09g26030D                                          392   9e-133   
sp|Q41014.2|FENR2_PEA  RecName: Full=Ferredoxin--NADP reductase, ...    392   9e-133   Pisum sativum [garden pea]
ref|XP_006415461.1|  hypothetical protein EUTSA_v10007919mg             392   1e-132   Eutrema salsugineum [saltwater cress]
emb|CAA67796.1|  ferrodoxin NADP oxidoreductase                         392   1e-132   Pisum sativum [garden pea]
ref|XP_006344529.1|  PREDICTED: ferredoxin--NADP reductase, root-...    392   1e-132   Solanum tuberosum [potatoes]
emb|CDY09570.1|  BnaC05g23490D                                          392   1e-132   Brassica napus [oilseed rape]
ref|XP_006415462.1|  hypothetical protein EUTSA_v10007919mg             392   1e-132   Eutrema salsugineum [saltwater cress]
ref|XP_006468308.1|  PREDICTED: ferredoxin--NADP reductase, root ...    391   2e-132   Citrus sinensis [apfelsine]
ref|XP_006363650.1|  PREDICTED: ferredoxin--NADP reductase, root-...    391   2e-132   Solanum tuberosum [potatoes]
ref|XP_009397390.1|  PREDICTED: ferredoxin--NADP reductase, embry...    390   3e-132   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009115136.1|  PREDICTED: ferredoxin--NADP reductase, root ...    390   5e-132   Brassica rapa
ref|XP_006650686.1|  PREDICTED: ferredoxin--NADP reductase, root ...    389   2e-131   Oryza brachyantha
ref|XP_009397718.1|  PREDICTED: ferredoxin--NADP reductase, root ...    389   2e-131   Musa acuminata subsp. malaccensis [pisang utan]
gb|AGT15976.1|  ferredoxin--NADP reductase                              389   2e-131   Saccharum hybrid cultivar R570
ref|XP_008383404.1|  PREDICTED: ferredoxin--NADP reductase, root ...    388   3e-131   Malus domestica [apple tree]
ref|XP_009362229.1|  PREDICTED: ferredoxin--NADP reductase, root ...    388   4e-131   Pyrus x bretschneideri [bai li]
dbj|BAA02248.1|  ferredoxin-NADP+ reductase enzyme                      385   4e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004955449.1|  PREDICTED: ferredoxin--NADP reductase, embry...    388   5e-131   Setaria italica
ref|XP_006658277.1|  PREDICTED: ferredoxin--NADP reductase, embry...    387   5e-131   
ref|NP_001051476.1|  Os03g0784700                                       387   7e-131   
emb|CDY39167.1|  BnaC09g21770D                                          387   1e-130   Brassica napus [oilseed rape]
gb|ACG35047.1|  ferredoxin--NADP reductase, embryo isozyme              387   1e-130   Zea mays [maize]
ref|NP_001132762.1|  uncharacterized protein LOC100194249               387   1e-130   Zea mays [maize]
gb|EMT31879.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...    387   1e-130   
ref|NP_849734.1|  ferredoxin--NADP reductase, root isozyme 2            386   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564355.1|  ferredoxin--NADP reductase, root isozyme 2            386   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|NP_973942.1|  ferredoxin--NADP reductase, root isozyme 2            384   2e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247806.1|  PREDICTED: ferredoxin--NADP reductase, root ...    386   2e-130   Nelumbo nucifera [Indian lotus]
gb|EMS52999.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...    390   2e-130   Triticum urartu
ref|XP_002461452.1|  hypothetical protein SORBIDRAFT_02g002900          386   3e-130   Sorghum bicolor [broomcorn]
ref|XP_006305070.1|  hypothetical protein CARUB_v10009436mg             386   3e-130   Capsella rubella
ref|XP_008346149.1|  PREDICTED: ferredoxin--NADP reductase, root ...    385   3e-130   Malus domestica [apple tree]
gb|AAM65564.1|  ferrodoxin NADP oxidoreductase, putative                385   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114485.1|  PREDICTED: ferredoxin--NADP reductase, root ...    385   3e-130   Brassica rapa
emb|CDY46362.1|  BnaA09g19760D                                          385   4e-130   Brassica napus [oilseed rape]
ref|XP_002893629.1|  ATRFNR2                                            385   4e-130   
ref|XP_009344407.1|  PREDICTED: ferredoxin--NADP reductase, root ...    385   7e-130   Pyrus x bretschneideri [bai li]
ref|XP_010537869.1|  PREDICTED: ferredoxin--NADP reductase, root ...    384   8e-130   Tarenaya hassleriana [spider flower]
ref|XP_002263658.2|  PREDICTED: ferredoxin--NADP reductase, root ...    384   1e-129   Vitis vinifera
ref|XP_010478464.1|  PREDICTED: ferredoxin--NADP reductase, root ...    384   1e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010478465.1|  PREDICTED: ferredoxin--NADP reductase, root ...    384   1e-129   Camelina sativa [gold-of-pleasure]
ref|XP_003558196.1|  PREDICTED: ferredoxin--NADP reductase, root ...    383   3e-129   Brachypodium distachyon [annual false brome]
gb|EMS61290.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    384   3e-129   Triticum urartu
ref|XP_007211443.1|  hypothetical protein PRUPE_ppa007232mg             383   3e-129   Prunus persica
ref|XP_010907336.1|  PREDICTED: ferredoxin--NADP reductase, root ...    382   4e-129   Elaeis guineensis
pdb|1JB9|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...    380   4e-129   Zea mays [maize]
ref|XP_010907335.1|  PREDICTED: ferredoxin--NADP reductase, root ...    383   4e-129   Elaeis guineensis
gb|AAB40034.1|  ferredoxin-NADP reductase precursor                     380   5e-129   Zea mays [maize]
ref|XP_010460851.1|  PREDICTED: ferredoxin--NADP reductase, root ...    382   5e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010460850.1|  PREDICTED: ferredoxin--NADP reductase, root ...    383   5e-129   Camelina sativa [gold-of-pleasure]
pdb|3LVB|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...    380   6e-129   Zea mays [maize]
dbj|BAJ93902.1|  predicted protein                                      382   8e-129   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK32212.1|  hypothetical protein AALP_AA6G212100                    382   8e-129   Arabis alpina [alpine rockcress]
gb|EYU43232.1|  hypothetical protein MIMGU_mgv1a008184mg                382   1e-128   Erythranthe guttata [common monkey flower]
gb|AAM64825.1|  ferredoxin--NADP+ reductase-like protein                382   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567293.1|  ferredoxin--NADP reductase, root isozyme 1            381   1e-128   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396605.1|  hypothetical protein EUTSA_v10028734mg             381   1e-128   Eutrema salsugineum [saltwater cress]
emb|CAB81081.1|  ferredoxin--NADP+ reductase-like protein               380   2e-128   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190682.1|  ferredoxin--NADP reductase, root isozyme 1         380   2e-128   Arabidopsis thaliana [mouse-ear cress]
gb|ACG39703.1|  ferredoxin--NADP reductase, root isozyme                380   3e-128   Zea mays [maize]
ref|XP_008665551.1|  PREDICTED: ferredoxin--NADP reductase, root ...    380   3e-128   
ref|XP_002463784.1|  hypothetical protein SORBIDRAFT_01g006100          380   3e-128   Sorghum bicolor [broomcorn]
ref|XP_008225595.1|  PREDICTED: ferredoxin--NADP reductase, root ...    380   3e-128   Prunus mume [ume]
pdb|3LO8|A  Chain A, Crystal Structure Of The Oxidized Form Of Fe...    378   4e-128   Zea mays [maize]
gb|EMT16236.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    380   4e-128   
gb|KFK44861.1|  hypothetical protein AALP_AA1G312100                    380   5e-128   Arabis alpina [alpine rockcress]
gb|AAM96978.1|  ferredoxin--NADP+ reductase-like protein                380   5e-128   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44862.1|  hypothetical protein AALP_AA1G312100                    380   6e-128   Arabis alpina [alpine rockcress]
ref|XP_011085204.1|  PREDICTED: ferredoxin--NADP reductase, root-...    380   8e-128   Sesamum indicum [beniseed]
ref|XP_010691939.1|  PREDICTED: ferredoxin--NADP reductase, root ...    379   1e-127   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010431473.1|  PREDICTED: ferredoxin--NADP reductase, root ...    379   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_010431466.1|  PREDICTED: ferredoxin--NADP reductase, root ...    379   2e-127   Camelina sativa [gold-of-pleasure]
ref|XP_006287956.1|  hypothetical protein CARUB_v10001191mg             378   4e-127   Capsella rubella
ref|XP_006287955.1|  hypothetical protein CARUB_v10001191mg             377   4e-127   Capsella rubella
ref|XP_006844572.1|  hypothetical protein AMTR_s00016p00195680          377   8e-127   Amborella trichopoda
ref|XP_008650954.1|  PREDICTED: uncharacterized protein LOC100194...    376   2e-126   Zea mays [maize]
gb|KHG02797.1|  hypothetical protein F383_08810                         375   3e-126   Gossypium arboreum [tree cotton]
ref|XP_011016596.1|  PREDICTED: ferredoxin--NADP reductase, root ...    374   4e-126   Populus euphratica
ref|XP_011038878.1|  PREDICTED: ferredoxin--NADP reductase, root ...    375   6e-126   Populus euphratica
ref|XP_010422426.1|  PREDICTED: ferredoxin--NADP reductase, root ...    374   1e-125   Camelina sativa [gold-of-pleasure]
ref|XP_010422427.1|  PREDICTED: ferredoxin--NADP reductase, root ...    374   1e-125   Camelina sativa [gold-of-pleasure]
gb|KJB56289.1|  hypothetical protein B456_009G115100                    367   5e-124   Gossypium raimondii
gb|KJB56286.1|  hypothetical protein B456_009G115100                    369   8e-124   Gossypium raimondii
gb|ACJ83525.1|  unknown                                                 362   1e-123   Medicago truncatula
ref|XP_002298889.2|  ferredoxin-NADP reductase family protein           368   2e-123   Populus trichocarpa [western balsam poplar]
gb|ACY70395.1|  heterotrophic ferredoxin NADP+ oxidoreductase           368   3e-123   Populus tremula x Populus tremuloides
ref|XP_007022877.1|  Root FNR 1 isoform 1                               366   2e-122   
ref|XP_007022878.1|  Ferredoxin--NADP reductase, root-type isozym...    363   2e-122   
gb|EPS58368.1|  hypothetical protein M569_16446                         362   8e-122   Genlisea aurea
ref|XP_002982108.1|  hypothetical protein SELMODRAFT_179376             358   7e-120   
ref|XP_002992209.1|  hypothetical protein SELMODRAFT_134886             358   1e-119   
ref|XP_001770917.1|  predicted protein                                  356   1e-118   
ref|XP_001774270.1|  predicted protein                                  350   1e-117   
ref|XP_002874840.1|  ATRFNR1                                            344   3e-114   
gb|KJB56288.1|  hypothetical protein B456_009G115100                    335   1e-110   Gossypium raimondii
ref|XP_006448908.1|  hypothetical protein CICLE_v100156272mg            317   2e-106   
ref|XP_008796785.1|  PREDICTED: ferredoxin--NADP reductase, embry...    299   2e-99    Phoenix dactylifera
gb|KJB56287.1|  hypothetical protein B456_009G115100                    305   4e-99    Gossypium raimondii
gb|KIZ06612.1|  ferredoxin--NADP+ reductase                             296   8e-96    Monoraphidium neglectum
gb|EJK72001.1|  hypothetical protein THAOC_06509                        295   2e-95    Thalassiosira oceanica
ref|XP_005644145.1|  ferredoxin-NADP+ reductase                         295   3e-95    Coccomyxa subellipsoidea C-169
ref|XP_005853875.1|  ferredoxin--NADP+ reductase                        296   6e-95    Nannochloropsis gaditana CCMP526
gb|EWM23857.1|  Ferredoxin reductase-type FAD-binding domain protein    297   7e-95    Nannochloropsis gaditana
ref|XP_002954986.1|  ferredoxin-NADP+ reductase                         291   1e-93    Volvox carteri f. nagariensis
emb|CAA55406.1|  ferredoxin NADP reductase                              287   2e-93    Chlamydomonas reinhardtii
ref|XP_001697352.1|  ferredoxin-nadp reductase                          290   2e-93    Chlamydomonas reinhardtii
gb|ABA55546.1|  chloroplast ferredoxin-dependent NADP oxireductase      291   3e-93    Karlodinium veneficum
ref|XP_002184856.1|  predicted protein                                  290   3e-93    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_003084170.1|  ferredoxin-NADP reductase (ISS)                    290   6e-93    Ostreococcus tauri
gb|ABD51927.1|  chloroplast ferredoxin NADP oxidoreductase              290   7e-93    Guillardia theta
ref|XP_005835894.1|  hypothetical protein GUITHDRAFT_162347             290   1e-92    Guillardia theta CCMP2712
sp|P53991.1|FENR_CHLRE  RecName: Full=Ferredoxin--NADP reductase,...    288   1e-92    Chlamydomonas reinhardtii
ref|XP_005790923.1|  hypothetical protein EMIHUDRAFT_361737             289   2e-92    Emiliania huxleyi CCMP1516
ref|XP_005770769.1|  hypothetical protein EMIHUDRAFT_432385             288   2e-92    Emiliania huxleyi CCMP1516
ref|XP_002290014.1|  ferredoxin--NADP+ reductase                        287   5e-92    Thalassiosira pseudonana CCMP1335
gb|AAP79145.1|  ferredoxin-NADP oxidoreductase                          286   2e-91    Bigelowiella natans
gb|ABF73016.1|  plastid ferredoxin NADPH reductase protein precursor    287   2e-91    Karenia brevis
ref|XP_002180511.1|  predicted protein                                  283   6e-91    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_001422240.1|  predicted protein                                  284   8e-91    Ostreococcus lucimarinus CCE9901
ref|XP_002180502.1|  predicted protein                                  282   2e-90    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007510909.1|  predicted protein                                  283   2e-90    Bathycoccus prasinos
ref|XP_002295321.1|  ferredoxin-nadp reductase                          282   3e-90    Thalassiosira pseudonana CCMP1335
gb|AAW79315.1|  chloroplast ferredoxin NADP(+) reductase                281   1e-89    Isochrysis galbana
gb|AFK49031.1|  unknown                                                 273   1e-89    Lotus japonicus
emb|CBJ31206.1|  hypothetical protein Esi_0238_0041                     281   3e-89    Ectocarpus siliculosus
ref|XP_009040433.1|  hypothetical protein AURANDRAFT_31888              279   5e-89    Aureococcus anophagefferens
ref|XP_009035092.1|  hypothetical protein AURANDRAFT_23206              276   9e-88    Aureococcus anophagefferens
ref|XP_003064407.1|  ferredoxin-NADP oxidoreductase                     276   3e-87    Micromonas pusilla CCMP1545
emb|CDY51794.1|  BnaC03g75370D                                          270   1e-86    Brassica napus [oilseed rape]
ref|XP_002500720.1|  ferredoxin-NADP oxidoreductase chloroplast p...    273   2e-86    Micromonas commoda
ref|XP_011400423.1|  Ferredoxin-NADP reductase, chloroplastic           268   3e-85    Auxenochlorella protothecoides
emb|CBN78345.1|  ferredoxin-NADP oxidoreductase                         272   3e-85    Ectocarpus siliculosus
ref|XP_002974410.1|  hypothetical protein SELMODRAFT_101002             267   8e-85    Selaginella moellendorffii
ref|XP_002985709.1|  hypothetical protein SELMODRAFT_122698             266   1e-84    Selaginella moellendorffii
ref|XP_005848997.1|  hypothetical protein CHLNCDRAFT_35035              254   3e-79    Chlorella variabilis
ref|XP_005789289.1|  hypothetical protein EMIHUDRAFT_42969              250   4e-78    Emiliania huxleyi CCMP1516
ref|XP_002977684.1|  hypothetical protein SELMODRAFT_107413             247   6e-77    Selaginella moellendorffii
ref|XP_002979592.1|  hypothetical protein SELMODRAFT_419219             247   6e-77    Selaginella moellendorffii
ref|XP_002291633.1|  predicted protein                                  239   5e-74    Thalassiosira pseudonana CCMP1335
gb|KDD75893.1|  hypothetical protein H632_c449p0                        239   9e-74    Helicosporidium sp. ATCC 50920
gb|EJK44714.1|  hypothetical protein THAOC_36724                        238   2e-72    Thalassiosira oceanica
ref|XP_009034033.1|  hypothetical protein AURANDRAFT_52453              237   1e-71    Aureococcus anophagefferens
ref|XP_002183949.1|  predicted protein                                  227   3e-69    Phaeodactylum tricornutum CCAP 1055/1
gb|ABF99221.1|  Ferredoxin-NADP reductase, root isozyme, chloropl...    225   1e-68    Oryza sativa Japonica Group [Japonica rice]
ref|WP_035831811.1|  ferredoxin-NADP reductase                          228   2e-68    
ref|WP_006170829.1|  ferredoxin--NADP reductase                         226   7e-68    Synechococcus sp. WH 5701
gb|ABO17805.1|  ferredoxin-NADP oxidoreductase (FNR)                    224   1e-67    Prochlorococcus marinus str. MIT 9301
ref|WP_036920327.1|  ferredoxin-NADP reductase                          224   1e-67    
ref|WP_008191760.1|  FAD/NAD-binding oxidoreductase                     223   1e-67    Moorea producens
ref|WP_043326144.1|  ferredoxin-NADP reductase                          225   1e-67    Cyanobium gracile
ref|WP_025930500.1|  ferredoxin-NADP reductase                          224   2e-67    
ref|WP_041484700.1|  ferredoxin-NADP reductase                          224   2e-67    Prochlorococcus marinus
gb|AFY27502.1|  Oxidoreductase NAD-binding domain/CpcD/allophycoc...    225   2e-67    Cyanobium gracile PCC 6307
ref|WP_036896868.1|  ferredoxin-NADP reductase                          224   3e-67    
ref|WP_032527499.1|  ferredoxin-NADP reductase                          224   3e-67    Prochlorococcus marinus
ref|XP_010910721.1|  PREDICTED: ferredoxin--NADP reductase, root ...    217   5e-67    Elaeis guineensis
ref|WP_002806441.1|  ferredoxin--NADP reductase                         224   6e-67    Prochlorococcus marinus
ref|WP_011825598.1|  ferredoxin--NADP reductase                         223   8e-67    
ref|WP_010317887.1|  ferredoxin--NADP reductase                         223   9e-67    Synechococcus sp. CB0205
ref|WP_032524602.1|  ferredoxin-NADP reductase                          223   1e-66    Prochlorococcus marinus
ref|WP_025965632.1|  ferredoxin-NADP reductase                          222   2e-66    
ref|XP_010536399.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    218   2e-66    Tarenaya hassleriana [spider flower]
gb|ABV50826.1|  ferredoxin-NADP oxidoreductase (FNR)                    221   3e-66    Prochlorococcus marinus str. MIT 9215
ref|WP_011376636.1|  ferredoxin--NADP reductase                         221   3e-66    Prochlorococcus marinus
ref|WP_025972231.1|  ferredoxin-NADP reductase                          221   3e-66    
ref|WP_032516697.1|  ferredoxin-NADP reductase                          222   4e-66    Prochlorococcus marinus
ref|WP_025933682.1|  ferredoxin-NADP reductase                          221   4e-66    
ref|WP_032515058.1|  ferredoxin-NADP reductase                          221   4e-66    Prochlorococcus marinus
ref|WP_025914731.1|  ferredoxin-NADP reductase                          221   4e-66    
ref|WP_025888618.1|  ferredoxin-NADP reductase                          221   4e-66    
ref|WP_025934437.1|  ferredoxin-NADP reductase                          219   4e-66    
ref|YP_002049405.1|  ferredoxin--NADP reductase (FNR)                   221   5e-66    Paulinella chromatophora
ref|WP_032522615.1|  ferredoxin-NADP reductase                          222   5e-66    Prochlorococcus marinus
ref|WP_011820472.1|  ferredoxin--NADP reductase                         221   5e-66    Prochlorococcus marinus
gb|KHN01599.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...    220   6e-66    Glycine soja [wild soybean]
ref|XP_010103488.1|  Ferredoxin--NADP reductase, embryo isozyme         218   6e-66    
ref|WP_041484386.1|  ferredoxin-NADP reductase                          221   6e-66    Prochlorococcus marinus
ref|WP_025962971.1|  ferredoxin-NADP reductase                          221   6e-66    
ref|XP_003547929.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    220   6e-66    Glycine max [soybeans]
ref|WP_025890941.1|  ferredoxin-NADP reductase                          221   6e-66    
ref|WP_025944110.1|  ferredoxin-NADP reductase                          221   7e-66    
ref|WP_032519107.1|  ferredoxin-NADP reductase                          220   8e-66    Prochlorococcus marinus
ref|WP_025975443.1|  ferredoxin-NADP reductase                          220   8e-66    
ref|WP_025900667.1|  ferredoxin-NADP reductase                          220   8e-66    
ref|WP_025925380.1|  MULTISPECIES: ferredoxin-NADP reductase            220   8e-66    
ref|WP_025958422.1|  ferredoxin-NADP reductase                          220   8e-66    
ref|WP_011132708.1|  ferredoxin--NADP reductase                         220   8e-66    Prochlorococcus marinus
ref|WP_025968699.1|  ferredoxin-NADP reductase                          220   8e-66    
ref|WP_019504594.1|  hypothetical protein                               221   8e-66    Pleurocapsa sp. PCC 7319
ref|WP_025956780.1|  ferredoxin-NADP reductase                          220   8e-66    
ref|WP_025891782.1|  MULTISPECIES: ferredoxin-NADP reductase            220   9e-66    Prochlorococcus sp. HOT208_60m_810B23
ref|WP_025881692.1|  ferredoxin-NADP reductase                          220   9e-66    
ref|WP_025941824.1|  MULTISPECIES: ferredoxin-NADP reductase            220   9e-66    
ref|WP_011125275.1|  MULTISPECIES: ferredoxin--NADP reductase           220   1e-65    Prochlorococcus
ref|WP_012195665.1|  ferredoxin--NADP reductase                         219   1e-65    Prochlorococcus marinus
ref|WP_006632795.1|  ferredoxin--NADP reductase                         221   1e-65    Microcoleus vaginatus
ref|WP_025923346.1|  ferredoxin-NADP reductase                          219   1e-65    
ref|WP_025973953.1|  ferredoxin-NADP reductase                          219   1e-65    
gb|ABM70465.1|  ferredoxin-NADP oxidoreductase (FNR)                    218   2e-65    Prochlorococcus marinus str. AS9601
ref|WP_012630377.1|  ferredoxin--NADP reductase                         220   2e-65    Cyanothece sp. PCC 7425
ref|WP_025893387.1|  ferredoxin-NADP reductase                          219   2e-65    
ref|WP_036533347.1|  ferredoxin-NADP reductase                          220   2e-65    Neosynechococcus sphagnicola
ref|WP_036902640.1|  ferredoxin-NADP reductase                          219   2e-65    Prochlorococcus sp. MIT 0601
ref|WP_025974310.1|  ferredoxin-NADP reductase                          219   2e-65    
ref|WP_025939411.1|  ferredoxin-NADP reductase                          219   2e-65    
ref|WP_032514193.1|  ferredoxin-NADP reductase                          220   2e-65    Prochlorococcus marinus
ref|WP_042850553.1|  ferredoxin-NADP reductase                          219   3e-65    Prochlorococcus sp. MIT 0604
ref|WP_025906619.1|  MULTISPECIES: ferredoxin-NADP reductase            219   3e-65    
ref|WP_006852296.1|  ferredoxin--NADP reductase                         219   3e-65    Synechococcus sp. WH 8016
ref|WP_025935188.1|  ferredoxin-NADP reductase                          219   3e-65    
ref|WP_025894678.1|  MULTISPECIES: ferredoxin-NADP reductase            219   3e-65    
ref|WP_041484539.1|  ferredoxin-NADP reductase                          219   4e-65    Prochlorococcus marinus
ref|WP_025939139.1|  ferredoxin-NADP reductase                          219   4e-65    
ref|XP_010536398.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    218   4e-65    Tarenaya hassleriana [spider flower]
ref|WP_025922412.1|  ferredoxin-NADP reductase                          218   4e-65    
ref|WP_025955871.1|  MULTISPECIES: ferredoxin-NADP reductase            218   4e-65    
ref|WP_011359557.1|  ferredoxin--NADP reductase                         219   4e-65    Synechococcus sp. CC9902
ref|WP_036911108.1|  MULTISPECIES: ferredoxin-NADP reductase            218   4e-65    Prochlorococcus
pdb|1GAQ|A  Chain A, Crystal Structure Of The Complex Between Fer...    216   5e-65    Zea mays [maize]
pdb|3W5U|A  Chain A, Cross-linked Complex Between Ferredoxin And ...    216   8e-65    Zea mays [maize]
ref|XP_006844481.1|  hypothetical protein AMTR_s00016p00108610          218   8e-65    Amborella trichopoda
ref|NP_001105568.1|  ferredoxin                                         217   8e-65    
ref|WP_025926660.1|  ferredoxin-NADP reductase                          218   8e-65    
ref|WP_015165197.1|  ferredoxin--NADP(+) reductase                      215   9e-65    Pseudanabaena sp. PCC 7367
ref|XP_006416443.1|  hypothetical protein EUTSA_v10007988mg             217   1e-64    Eutrema salsugineum [saltwater cress]
ref|WP_007098233.1|  ferredoxin--NADP reductase                         218   1e-64    Synechococcus sp. RS9916
ref|WP_025970824.1|  ferredoxin-NADP reductase                          211   1e-64    
pdb|3VO2|A  Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxi...    216   1e-64    Zea mays [maize]
ref|XP_010113341.1|  Ferredoxin--NADP reductase, leaf isozyme           217   1e-64    
gb|EMT15804.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...    217   1e-64    
ref|XP_002510546.1|  ferredoxin--NADP reductase, putative               217   1e-64    Ricinus communis
dbj|BAJ98295.1|  predicted protein                                      217   2e-64    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_025932047.1|  ferredoxin-NADP reductase                          217   2e-64    
dbj|BAH56837.1|  AT1G20020                                              213   2e-64    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002274366.2|  PREDICTED: ferredoxin--NADP reductase, leaf-...    217   2e-64    Vitis vinifera
ref|WP_011618938.1|  ferredoxin--NADP reductase                         217   2e-64    Synechococcus sp. CC9311
gb|EMT12632.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...    213   2e-64    
gb|KJB58054.1|  hypothetical protein B456_009G194200                    216   2e-64    Gossypium raimondii
ref|WP_007100218.1|  ferredoxin--NADP reductase                         216   3e-64    Synechococcus sp. RS9917
ref|WP_015179262.1|  Ferredoxin--NADP(+) reductase                      217   3e-64    Oscillatoria nigro-viridis
ref|XP_004952968.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    216   3e-64    Setaria italica
gb|ACF85815.1|  unknown                                                 216   4e-64    Zea mays [maize]
ref|WP_009790228.1|  ferredoxin--NADP reductase                         217   4e-64    Synechococcus sp. BL107
ref|WP_011130473.1|  ferredoxin--NADP reductase                         216   5e-64    Prochlorococcus marinus
emb|CAD30024.2|  ferredoxin-NADP(H) oxidoreductase                      215   5e-64    Triticum aestivum [Canadian hard winter wheat]
pdb|3VO1|A  Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxi...    214   7e-64    Zea mays [maize]
ref|XP_003557263.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    215   8e-64    Brachypodium distachyon [annual false brome]
gb|ABR26035.1|  ferredoxin-nadp reductase, leaf isozyme                 209   9e-64    Oryza sativa Indica Group [Indian rice]
gb|KDP36912.1|  hypothetical protein JCGZ_08203                         214   9e-64    Jatropha curcas
ref|XP_007156158.1|  hypothetical protein PHAVU_003G263200g             214   1e-63    Phaseolus vulgaris [French bean]
ref|XP_006655693.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    214   1e-63    Oryza brachyantha
ref|XP_003520228.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    214   2e-63    Glycine max [soybeans]
gb|KIY94893.1|  ferredoxin--NADP+ reductase                             208   2e-63    Monoraphidium neglectum
gb|EAY99350.1|  hypothetical protein OsI_21320                          214   2e-63    
ref|WP_006041729.1|  ferredoxin--NADP reductase                         214   2e-63    
ref|WP_022606197.1|  oxidoreductase NAD-binding domain/FAD bindin...    215   2e-63    
ref|WP_011935177.1|  ferredoxin--NADP reductase                         214   2e-63    
ref|NP_001077565.1|  ferredoxin--NADP reductase, leaf isozyme 2         213   2e-63    
ref|XP_009390794.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    213   2e-63    
ref|NP_173431.1|  ferredoxin--NADP reductase, leaf isozyme 2            214   3e-63    
ref|NP_001077566.1|  ferredoxin--NADP reductase, leaf isozyme 2         214   3e-63    
ref|XP_002890363.1|  ATLFNR2                                            214   3e-63    
ref|XP_010498430.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    214   3e-63    
ref|NP_001056570.1|  Os06g0107700                                       213   3e-63    
gb|ACG35645.1|  ferredoxin--NADP reductase, leaf isozyme                213   3e-63    
ref|XP_009103366.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    213   3e-63    
ref|XP_010477227.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    214   3e-63    
ref|XP_009413066.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    213   3e-63    
ref|WP_017303294.1|  hypothetical protein                               214   3e-63    
ref|XP_004233557.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    213   3e-63    
emb|CDY57601.1|  BnaAnng14750D                                          213   3e-63    
ref|WP_015146553.1|  oxidoreductase FAD-binding domain-containing...    214   4e-63    
ref|WP_007357258.1|  MULTISPECIES: ferredoxin--NADP reductase           214   4e-63    
ref|XP_006304543.1|  hypothetical protein CARUB_v10011511mg             213   4e-63    
ref|XP_010550469.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    213   4e-63    
gb|ACF83556.1|  unknown                                                 213   4e-63    
ref|NP_001104851.1|  ferredoxin                                         213   5e-63    
ref|WP_010303595.1|  ferredoxin--NADP reductase                         214   5e-63    
ref|WP_043369601.1|  ferredoxin-NADP reductase                          214   5e-63    
gb|EDY38180.1|  ferredoxin--NADP reductase                              214   5e-63    
gb|AFZ48005.1|  oxidoreductase FAD/NAD(P)-binding domain protein        210   6e-63    
gb|KCW56624.1|  hypothetical protein EUGRSUZ_I02340                     209   6e-63    
ref|XP_009382075.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    213   6e-63    
gb|KCW56625.1|  hypothetical protein EUGRSUZ_I02340                     209   6e-63    
ref|XP_009382076.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    213   7e-63    
ref|XP_010459681.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    213   7e-63    
ref|WP_017715708.1|  ferredoxin--NADP reductase                         214   7e-63    
ref|XP_003575004.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    212   8e-63    
ref|WP_011933463.1|  ferredoxin--NADP reductase                         213   8e-63    
ref|WP_024544655.1|  ferredoxin-NADP reductase                          213   8e-63    
ref|WP_006507842.1|  Oxidoreductase FAD-binding domain protein          213   9e-63    
emb|CAD30025.1|  ferredoxin-NADP(H) oxidoreductase                      212   1e-62    
ref|WP_015160797.1|  Oxidoreductase FAD-binding domain/CpcD/allop...    213   1e-62    
ref|NP_001149023.1|  ferredoxin--NADP reductase, leaf isozyme           212   1e-62    
ref|XP_008448550.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    212   1e-62    
ref|WP_028951585.1|  ferredoxin-NADP reductase                          213   1e-62    
ref|XP_002459129.1|  hypothetical protein SORBIDRAFT_03g046340          212   1e-62    
ref|XP_008448551.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    211   1e-62    
ref|WP_015133505.1|  ferredoxin--NADP(+) reductase                      213   1e-62    
ref|XP_006425452.1|  hypothetical protein CICLE_v10027108mg             211   2e-62    
emb|CDP01892.1|  unnamed protein product                                211   2e-62    
ref|WP_015171443.1|  oxidoreductase FAD/NAD(P)-binding domain-con...    213   2e-62    
gb|AHB88104.1|  ferredoxin--NADP+ reductase PetH                        212   2e-62    
ref|WP_011057053.1|  ferredoxin--NADP reductase                         212   2e-62    
ref|WP_030007560.1|  ferredoxin-NADP reductase                          213   2e-62    
ref|WP_012306481.1|  ferredoxin--NADP reductase                         212   2e-62    
pir||B42194  ferredoxin-NADP reductase (EC 1.18.1.2) - Synechococ...    212   2e-62 
ref|XP_006361933.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    211   2e-62    
ref|WP_041429054.1|  ferredoxin-NADP reductase                          212   2e-62    
ref|WP_038543910.1|  ferredoxin-NADP reductase                          212   2e-62    
gb|KFK44126.1|  hypothetical protein AALP_AA1G219100                    211   2e-62    
ref|WP_011364867.1|  ferredoxin--NADP reductase                         212   2e-62    
ref|WP_015229409.1|  FAD binding domain-containing protein              212   3e-62    
gb|ABK22336.1|  unknown                                                 211   3e-62    
ref|WP_036917951.1|  MULTISPECIES: ferredoxin-NADP reductase            211   4e-62    
ref|WP_010474531.1|  ferredoxin--NADP reductase                         210   4e-62    
ref|XP_004170232.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    210   4e-62    
ref|WP_038553815.1|  ferredoxin-NADP reductase                          211   4e-62    
ref|XP_004146142.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    210   5e-62    
ref|WP_015125673.1|  oxidoreductase FAD-binding domain-containing...    211   6e-62    
gb|AHF64355.1|  ferredoxin--NADP reductase (FNR)                        211   7e-62    
ref|XP_002992727.1|  hypothetical protein SELMODRAFT_25109              208   7e-62    
ref|XP_010268658.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    210   7e-62    
ref|XP_010029673.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    210   7e-62    
ref|XP_009110244.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    210   8e-62    
ref|XP_005706517.1|  ferredoxin--NADP+ reductase                        209   8e-62    
ref|WP_036477079.1|  ferredoxin-NADP reductase                          211   8e-62    
ref|WP_012595818.1|  MULTISPECIES: ferredoxin--NADP reductase           211   9e-62    
sp|Q00598.1|FENR_CYAPA  RecName: Full=Ferredoxin--NADP reductase,...    209   1e-61    
dbj|BAD07827.1|  putative ferredoxin-NADP(H) oxidoreductase             209   1e-61    
dbj|BAH20393.1|  AT5G66190                                              206   1e-61    
ref|WP_015203026.1|  ferredoxin--NADP(+) reductase                      211   2e-61    
ref|XP_008354645.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    206   2e-61    
gb|KGN55659.1|  hypothetical protein Csa_3G002780                       210   2e-61    
ref|WP_038653537.1|  ferredoxin-NADP reductase                          209   2e-61    
ref|WP_012162552.1|  ferredoxin--NADP reductase                         208   2e-61    
ref|NP_001078805.1|  ferredoxin-NADP(+)-oxidoreductase 1                206   2e-61    
ref|XP_002993724.1|  hypothetical protein SELMODRAFT_272335             209   2e-61    
ref|WP_036946982.1|  ferredoxin-NADP reductase                          207   2e-61    
gb|KDP46763.1|  hypothetical protein JCGZ_06551                         209   2e-61    
ref|XP_010484677.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    208   3e-61    
ref|XP_010444826.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    208   3e-61    
ref|XP_003537636.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    208   3e-61    
ref|WP_044304925.1|  ferredoxin-NADP reductase                          209   3e-61    
ref|WP_015192030.1|  Ferredoxin--NADP(+) reductase                      209   4e-61    
gb|EAY84091.1|  hypothetical protein OsI_05475                          208   4e-61    
ref|WP_040932423.1|  ferredoxin-NADP reductase                          206   4e-61    
ref|XP_007046687.1|  Ferredoxin-NADP(+)-oxidoreductase 2                208   5e-61    
ref|XP_004951191.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    207   6e-61    
ref|XP_002865083.1|  ferredoxin-NADP+ reductase                         207   6e-61    
ref|XP_004232495.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    207   7e-61    
emb|CCH68057.1|  Ferredoxin-NADP(+) reductase                           209   8e-61    
ref|XP_008394226.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    207   8e-61    
ref|WP_002772196.1|  ferredoxin--NADP reductase                         208   8e-61    
ref|XP_009363490.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    207   8e-61    
pdb|1SM4|A  Chain A, Crystal Structure Analysis Of The Ferredoxin...    205   9e-61    
ref|WP_043691984.1|  ferredoxin-NADP reductase                          207   9e-61    
ref|XP_004287805.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    207   1e-60    
ref|XP_006280674.1|  hypothetical protein CARUB_v10026639mg             207   1e-60    
dbj|BAE98556.1|  ferredoxin-NADP+ reductase                             207   1e-60    
ref|NP_201420.1|  ferredoxin-NADP(+)-oxidoreductase 1                   207   1e-60    
ref|XP_008241828.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    207   1e-60    
sp|O04977.1|FENR1_TOBAC  RecName: Full=Ferredoxin--NADP reductase...    207   1e-60    
ref|WP_040937819.1|  ferredoxin-NADP reductase                          205   1e-60    
ref|XP_009379399.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    207   1e-60    
ref|XP_009794242.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    206   1e-60    
ref|XP_006340740.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    206   1e-60    
ref|XP_007202096.1|  hypothetical protein PRUPE_ppa007547mg             206   1e-60    
ref|XP_008788385.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    206   1e-60    
ref|XP_011043184.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    206   1e-60    
ref|WP_015224643.1|  oxidoreductase FAD/NAD(P)-binding domain-con...    207   2e-60    
emb|CAB71293.1|  chloroplast ferredoxin-NADP+ oxidoreductase prec...    206   2e-60    
ref|XP_010465822.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    206   2e-60    
ref|XP_009588213.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    206   2e-60    
ref|XP_008361344.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    206   2e-60    
ref|WP_036906601.1|  ferredoxin-NADP reductase                          207   2e-60    
ref|WP_011127616.1|  ferredoxin--NADP reductase                         207   2e-60    
ref|XP_010920179.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    206   2e-60    
gb|ERT04099.1|  ferredoxin--NADP reductase                              204   3e-60    
gb|KJB43314.1|  hypothetical protein B456_007G193800                    206   3e-60    
ref|WP_006518023.1|  FAD-binding protein                                207   3e-60    
gb|KJB43315.1|  hypothetical protein B456_007G193800                    205   3e-60    
ref|WP_040944897.1|  ferredoxin-NADP reductase                          204   4e-60    
ref|XP_006383096.1|  Chain A family protein                             205   6e-60    
gb|AFO59573.1|  ferredoxin-NADP reductase                               205   6e-60    
gb|EYU30800.1|  hypothetical protein MIMGU_mgv1a008865mg                204   7e-60    
emb|CDX81408.1|  BnaC09g08190D                                          205   7e-60    
emb|CDY18592.1|  BnaA09g08030D                                          204   8e-60    
ref|XP_009112283.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    204   8e-60    
ref|XP_007157909.1|  hypothetical protein PHAVU_002G108000g             204   8e-60    
ref|WP_015185886.1|  sulfite reductase subunit alpha                    206   9e-60    
ref|WP_011294764.1|  ferredoxin--NADP reductase                         205   9e-60    
ref|WP_009782586.1|  ferredoxin--NADP reductase                         205   1e-59    
ref|WP_025782058.1|  hypothetical protein                               198   1e-59    
pdb|1FNB|A  Chain A, Refined Crystal Structure Of Spinach Ferredo...    203   1e-59    
gb|AAA34029.1|  ferredoxin-NADP oxidoreductase                          204   1e-59    
ref|WP_002734368.1|  ferredoxin--NADP reductase                         205   1e-59    
ref|WP_002776183.1|  ferredoxin--NADP reductase                         205   1e-59    
ref|WP_015189196.1|  Ferredoxin--NADP(+) reductase                      206   1e-59    
ref|WP_008202728.1|  ferredoxin--NADP reductase                         205   1e-59    
ref|XP_002437683.1|  hypothetical protein SORBIDRAFT_10g000720          204   2e-59    
ref|WP_011824088.1|  ferredoxin--NADP reductase                         204   2e-59    
ref|WP_004158734.1|  ferredoxin--NADP reductase                         205   2e-59    
ref|WP_044106149.1|  ferredoxin--NADP reductase                         202   2e-59    
ref|XP_011010543.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    204   2e-59    
ref|XP_002265774.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    203   2e-59    
ref|XP_010679926.1|  PREDICTED: ferredoxin--NADP reductase, chlor...    204   2e-59    
ref|WP_040484716.1|  ferredoxin-NADP reductase                          204   2e-59    
sp|P41343.1|FENR_MESCR  RecName: Full=Ferredoxin--NADP reductase,...    203   2e-59    
emb|CAN59785.1|  hypothetical protein VITISV_042164                     203   2e-59    
ref|XP_004512139.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    203   2e-59    
gb|AFK41176.1|  unknown                                                 203   2e-59    
ref|XP_003612185.1|  Ferredoxin-NADP reductase                          203   2e-59    
ref|XP_011099850.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    203   2e-59    
ref|WP_017293489.1|  hypothetical protein                               204   2e-59    
ref|XP_006393807.1|  hypothetical protein EUTSA_v10004465mg             203   2e-59    
dbj|GAL95184.1|  ferredoxin-NADP(+) reductase                           204   3e-59    
pdb|1FRN|A  Chain A, The Involvement Of Ser96 In The Catalytic Me...    201   3e-59    
sp|P00455.1|FENR_SPIOL  RecName: Full=Ferredoxin--NADP reductase,...    203   4e-59    
ref|WP_017651922.1|  ferredoxin--NADP reductase                         205   4e-59    
ref|WP_035158113.1|  ferredoxin-NADP reductase                          204   4e-59    
ref|XP_006380593.1|  Chain A family protein                             202   4e-59    
ref|WP_002762614.1|  ferredoxin--NADP reductase                         203   5e-59    
dbj|BAG69182.1|  ferredoxin-NADP+ oxidoreductase                        204   5e-59    
ref|WP_016951277.1|  ferredoxin--NADP reductase                         204   5e-59    
ref|WP_041922881.1|  ferredoxin-NADP reductase                          203   5e-59    
gb|AFZ54666.1|  Ferredoxin--NADP(+) reductase                           203   7e-59    
pdb|1BX1|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    201   8e-59    
ref|WP_002795570.1|  ferredoxin--NADP reductase                         203   8e-59    
emb|CDY57760.1|  BnaC02g45020D                                          211   8e-59    
ref|WP_002802650.1|  ferredoxin--NADP reductase                         203   8e-59    
ref|WP_019493254.1|  ferredoxin--NADP reductase                         203   9e-59    
ref|WP_002787377.1|  ferredoxin--NADP reductase                         202   1e-58    
ref|WP_018399210.1|  hypothetical protein                               202   1e-58    
ref|WP_002782614.1|  Ferredoxin--NADP reductase                         202   1e-58    
gb|ADM64306.2|  ferredoxin-NADP+ reductase                              199   1e-58    
ref|WP_002791386.1|  ferredoxin--NADP reductase                         202   1e-58    
gb|KFK28280.1|  hypothetical protein AALP_AA8G495900                    201   1e-58    
dbj|BAG69177.1|  ferredoxin-NADP+ oxidoreductase                        204   1e-58    
ref|WP_015153058.1|  oxidoreductase FAD/NAD(P)-binding domain-con...    202   2e-58    
pdb|1FRQ|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    200   2e-58    
ref|WP_002742462.1|  ferredoxin--NADP reductase                         202   2e-58    
ref|WP_009556308.1|  FAD-binding protein                                202   2e-58    
pdb|1QG0|A  Chain A, Wild-type Pea Fnr                                  199   2e-58    
pdb|3MHP|A  Chain A, Fnr-Recruitment To The Thylakoid                   199   2e-58    
gb|AEZ00858.1|  putative ferredoxin NADP+ reductase protein             196   3e-58    
ref|WP_009631217.1|  sulfite reductase, alpha subunit (flavoprotein)    202   3e-58    
sp|P10933.1|FENR1_PEA  RecName: Full=Ferredoxin--NADP reductase, ...    200   3e-58    
ref|XP_004952967.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    201   4e-58    
pdb|1BX0|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    199   4e-58    
ref|WP_015145548.1|  oxidoreductase NAD-binding domain-containing...    201   4e-58    
emb|CAB52472.1|  ferredoxin-NADP+ reductase                             200   4e-58    
gb|KIJ82541.1|  ferredoxin-NADP reductase                               202   4e-58    
gb|ACJ05622.1|  ferredoxin:NADP+ oxidoreductase                         201   5e-58    
gb|ACJ05621.2|  ferredoxin:NADP+ oxidoreductase                         201   5e-58    
sp|P41346.1|FENR_VICFA  RecName: Full=Ferredoxin--NADP reductase,...    200   5e-58    
pdb|4AF6|A  Chain A, Pea Fnr L268v Mutant                               198   6e-58    
pdb|1QGA|A  Chain A, Pea Fnr Y308w Mutant In Complex With Nadp+         198   7e-58    
ref|WP_039713239.1|  ferredoxin-NADP reductase                          201   8e-58    
ref|WP_017322256.1|  ferredoxin--NADP reductase                         201   8e-58    
ref|WP_016923929.1|  hypothetical protein                               197   9e-58    
ref|WP_026733813.1|  ferredoxin-NADP reductase                          201   1e-57    
gb|ELS32478.1|  Ferredoxin--NADP(+) reductase                           197   1e-57    
dbj|BAG70314.1|  ferredoxin-NADP+ oxidoreductase                        201   1e-57    
ref|WP_041041729.1|  ferredoxin-NADP reductase                          201   1e-57    
ref|WP_040688390.1|  ferredoxin-NADP reductase                          197   1e-57    
dbj|BAD97809.1|  ferredoxin-NADP+ oxidoreductase                        201   1e-57    
ref|WP_015208880.1|  sulfite reductase, alpha subunit (flavoprotein)    202   1e-57    
gb|AAW79314.1|  chloroplast ferredoxin-NADP{+) reductase                200   1e-57    
gb|KIE10321.1|  ferredoxin-NADP reductase                               200   1e-57    
pdb|1QFY|A  Chain A, Pea Fnr Y308s Mutant In Complex With Nadp+         197   2e-57    
dbj|BAG70317.1|  ferredoxin-NADP+ oxidoreductase                        200   2e-57    
ref|WP_044137750.1|  ferredoxin-NADP reductase                          199   3e-57    
gb|ABG52720.1|  oxidoreductase FAD/NAD(P)-binding                       199   3e-57    



>gb|EYU19120.1| hypothetical protein MIMGU_mgv1a008446mg [Erythranthe guttata]
Length=373

 Score =   402 bits (1033),  Expect = 8e-137, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDKVQ+ GPSGK+MLLPEDNPNATHIMI
Sbjct  169  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKVQLAGPSGKVMLLPEDNPNATHIMI  228

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+VPTFKF GLAWLFLGVANTDSLLYD+EF+KYLQD+PDNFR
Sbjct  229  ATGTGVAPFRGYLRRMFMEAVPTFKFGGLAWLFLGVANTDSLLYDEEFSKYLQDYPDNFR  288

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +DR LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  289  FDRALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKKVA  348

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  349  EQRGESWDEKLSQLKKNKQWHVEVY  373



>ref|XP_004134584.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004172626.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--NADP reductase, root 
isozyme, chloroplastic-like [Cucumis sativus]
 gb|KGN49459.1| hypothetical protein Csa_6G525450 [Cucumis sativus]
Length=378

 Score =   400 bits (1027),  Expect = 9e-136, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C N+LC+S PGDKV ITGPSGKIMLLPEDNPNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKNGICSNYLCNSKPGDKVLITGPSGKIMLLPEDNPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVANTDSLLYDDEF+KYL+D+PDNFR
Sbjct  234  ATGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSLLYDDEFSKYLKDYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDRALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG  WE KLSQLKKNKQWHVEVY
Sbjct  354  EQRGEKWEEKLSQLKKNKQWHVEVY  378



>gb|AII16855.1| ferredoxin-NADP(+) reductase, partial [Ocimum basilicum]
Length=372

 Score =   399 bits (1026),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK GVC NFLCDS PGDKVQITGPSGKIMLLPED+P ATHIMI
Sbjct  168  CVRRAVYYDPETGKEDPSKKGVCSNFLCDSKPGDKVQITGPSGKIMLLPEDDPKATHIMI  227

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VPTFKFNGLAWLFLGVAN DSLLYDDEF+KYLQD+PDNFR
Sbjct  228  ATGTGVAPFRGYLRRMFMEDVPTFKFNGLAWLFLGVANKDSLLYDDEFSKYLQDYPDNFR  287

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +DR LSREQKN+NGGKMYVQDKIEEYSDE+FKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  288  FDRALSREQKNRNGGKMYVQDKIEEYSDEVFKLLDNGAHIYFCGLKGMMPGIQDTLKKVA  347

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +WE KLSQLKKNKQWHVEVY
Sbjct  348  EQRGENWEEKLSQLKKNKQWHVEVY  372



>ref|XP_008439552.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Cucumis melo]
Length=379

 Score =   399 bits (1025),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C N+LC+S PGDKV ITGPSGKIMLLPEDNPNATHIMI
Sbjct  175  CVRRAVYYDPETGKEDPSKNGICSNYLCNSKPGDKVLITGPSGKIMLLPEDNPNATHIMI  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVANTDSLLYDDEF+KYL+D+PDNFR
Sbjct  235  ATGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSLLYDDEFSKYLKDYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  295  YDRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG  WE KLSQLKKNKQWHVEVY
Sbjct  355  EQRGEKWEEKLSQLKKNKQWHVEVY  379



>gb|KHN14331.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=369

 Score =   397 bits (1021),  Expect = 5e-135, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLC+S PGDK+QITGPSGKIMLLPED+PNATHIMI
Sbjct  165  CVRRAVYYDPETGKEDPSKNGICSNFLCNSKPGDKIQITGPSGKIMLLPEDDPNATHIMI  224

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFMESVP +KF GLAWLFLGVANTDSLLYDDEF+KYL+D+PDNFR
Sbjct  225  ATGTGVAPFRGYLRRMFMESVPAYKFGGLAWLFLGVANTDSLLYDDEFSKYLKDYPDNFR  284

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            Y+R LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  285  YNRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKKVA  344

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  345  EQRGESWEEKLSQLKKNKQWHVEVY  369



>ref|XP_006597058.1| PREDICTED: uncharacterized protein LOC100807968 isoform X1 [Glycine 
max]
Length=378

 Score =   398 bits (1022),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLC+S PGDK+QITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKNGICSNFLCNSKPGDKIQITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFMESVP +KF GLAWLFLGVANTDSLLYDDEF+KYL+D+PDNFR
Sbjct  234  ATGTGVAPFRGYLRRMFMESVPAYKFGGLAWLFLGVANTDSLLYDDEFSKYLKDYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            Y+R LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YNRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWEEKLSQLKKNKQWHVEVY  378



>ref|NP_001239798.1| uncharacterized protein LOC100807968 [Glycine max]
 gb|ACU22765.1| unknown [Glycine max]
Length=377

 Score =   397 bits (1021),  Expect = 6e-135, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLC+S PGDK+QITGPSGKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKNGICSNFLCNSKPGDKIQITGPSGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFMESVP +KF GLAWLFLGVANTDSLLYDDEF+KYL+D+PDNFR
Sbjct  233  ATGTGVAPFRGYLRRMFMESVPAYKFGGLAWLFLGVANTDSLLYDDEFSKYLKDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            Y+R LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  293  YNRALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKKVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  353  EQRGESWEEKLSQLKKNKQWHVEVY  377



>ref|NP_001239859.1| uncharacterized protein LOC100789291 [Glycine max]
 gb|ACU18286.1| unknown [Glycine max]
 gb|KHN23002.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=377

 Score =   397 bits (1019),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLC+S PGDK+QITGPSGKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKNGICSNFLCNSKPGDKIQITGPSGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMF+ESVPT+KF GLAWLFLGVANTDSLLYD+EF+KYL D+ DNFR
Sbjct  233  ATGTGVAPFRGYLRRMFLESVPTYKFGGLAWLFLGVANTDSLLYDEEFSKYLNDYSDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  293  YDRALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKKVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  353  EQRGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_006586681.1| PREDICTED: uncharacterized protein LOC100789291 isoform X1 [Glycine 
max]
Length=378

 Score =   397 bits (1019),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLC+S PGDK+QITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKNGICSNFLCNSKPGDKIQITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMF+ESVPT+KF GLAWLFLGVANTDSLLYD+EF+KYL D+ DNFR
Sbjct  234  ATGTGVAPFRGYLRRMFLESVPTYKFGGLAWLFLGVANTDSLLYDEEFSKYLNDYSDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDRALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWEEKLSQLKKNKQWHVEVY  378



>ref|XP_003594526.1| Ferredoxin-NADP reductase [Medicago truncatula]
 gb|AES64777.1| ferredoxin reductase-like NAD(P) binding domain protein [Medicago 
truncatula]
 gb|AFK47886.1| unknown [Medicago truncatula]
Length=378

 Score =   397 bits (1019),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 184/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK++ITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIKITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVAN+DSLLYDDEF KYL+D+P+NFR
Sbjct  234  ATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANSDSLLYDDEFTKYLKDYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSRE+KN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  294  YDRALSREEKNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQETLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SWE KLSQLKKNKQWHVEVY
Sbjct  354  ENRGESWEEKLSQLKKNKQWHVEVY  378



>ref|XP_009614066.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana tomentosiformis]
Length=375

 Score =   396 bits (1018),  Expect = 2e-134, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 191/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDKV+ITGPSGKIMLLPE+NPNATHIMI
Sbjct  172  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKVKITGPSGKIMLLPEENPNATHIMI  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFMESVPT KFNGLAWLFLGVANTDSLLYDDEF KYL D+P NFR
Sbjct  232  GTGTGVAPFRGYLRRMFMESVPT-KFNGLAWLFLGVANTDSLLYDDEFTKYLNDYPGNFR  290

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  291  YDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  350

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SWE KLSQLKKNKQWHVEVY
Sbjct  351  ERRGESWEQKLSQLKKNKQWHVEVY  375



>gb|KDP34933.1| hypothetical protein JCGZ_09221 [Jatropha curcas]
Length=379

 Score =   395 bits (1016),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SKNGVC NFLC+S PGDKVQITGP+GKIMLLPEDNPNATHIMI
Sbjct  175  CVRRALYYDPETGKEDPSKNGVCSNFLCNSKPGDKVQITGPAGKIMLLPEDNPNATHIMI  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME V  +KF GLAWLFLGVANTDSLLYDDEF KYLQD+PDNFR
Sbjct  235  ATGTGVAPFRGYLRRMFMEDVSKYKFGGLAWLFLGVANTDSLLYDDEFTKYLQDYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  295  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDCGAHIYFCGLKGMMPGIQDTLKRVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  355  EQRGESWEQKLSQLKKNKQWHVEVY  379



>emb|CDP17310.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   398 bits (1022),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDP+TGKED SK GVC NFLCDS PGDKV+ITGPSGKIMLLPEDNP ATHIMI
Sbjct  238  CVRRAVYYDPDTGKEDPSKQGVCSNFLCDSKPGDKVKITGPSGKIMLLPEDNPKATHIMI  297

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+R YLRRMFMESVPTFKF GLAWLFLGVANTDSLLYDDEF++YL+D+PDNFR
Sbjct  298  ATGTGVAPYRAYLRRMFMESVPTFKFGGLAWLFLGVANTDSLLYDDEFSQYLRDYPDNFR  357

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  358  YDRALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDTGAHIYFCGLKGMMPGIQDTLKRVA  417

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  418  EQRGESWDEKLSQLKKNKQWHVEVY  442



>ref|XP_009761528.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana sylvestris]
Length=375

 Score =   395 bits (1015),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 188/205 (92%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDKV+ITGPSGKIMLLPEDNPNA HIMI
Sbjct  172  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKVKITGPSGKIMLLPEDNPNAKHIMI  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFMESVPT KFNGLAWLFLGVANTDSLLYDDEF KYL D+P NFR
Sbjct  232  GTGTGVAPFRGYLRRMFMESVPT-KFNGLAWLFLGVANTDSLLYDDEFTKYLNDYPGNFR  290

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  291  YDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  350

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SWE KLSQLKKNKQWHVEVY
Sbjct  351  EARGESWEQKLSQLKKNKQWHVEVY  375



>ref|XP_010051952.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75780.1| hypothetical protein EUGRSUZ_D00177 [Eucalyptus grandis]
Length=377

 Score =   395 bits (1016),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK+GVC NFLC++ PGDKV+ITGPSGKIMLLPEDNPNATHIMI
Sbjct  173  CVRRALYYDPETGKEDPSKSGVCSNFLCNAKPGDKVKITGPSGKIMLLPEDNPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFRGYLRRMFMESVPT+KF GLAWLFLGVAN+DSLLYDDEF+KYL+D+PDNFR
Sbjct  233  ATGTGIAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANSDSLLYDDEFSKYLRDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQ NK GGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDTALSREQNNKKGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
             ERG SWE KLSQLKKNKQWHVEVY
Sbjct  353  VERGESWEEKLSQLKKNKQWHVEVY  377



>ref|NP_001058890.1| Os07g0147900 [Oryza sativa Japonica Group]
 sp|O23877.1|FENR3_ORYSJ RecName: Full=Ferredoxin--NADP reductase, embryo isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA13417.1| precursor ferredoxin-NADP+ oxidoreductase [Oryza sativa (japonica 
cultivar-group)]
 dbj|BAC83340.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplast precursor 
(FNR) [Oryza sativa Japonica Group]
 dbj|BAF20804.1| Os07g0147900 [Oryza sativa Japonica Group]
 gb|EAZ38695.1| hypothetical protein OsJ_23093 [Oryza sativa Japonica Group]
Length=378

 Score =   395 bits (1016),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED +K G+C NFLCDS PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPTKKGICSNFLCDSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP+FKF GLAWLFLGVANTDSLLYD+EF  YLQ +PDNFR
Sbjct  234  ATGTGVAPYRGYLRRMFMEDVPSFKFGGLAWLFLGVANTDSLLYDEEFTNYLQQYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWEQKLSQLKKNKQWHVEVY  378



>gb|EAZ02773.1| hypothetical protein OsI_24896 [Oryza sativa Indica Group]
Length=379

 Score =   395 bits (1014),  Expect = 9e-134, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED +K G+C NFLCDS PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  175  CVRRAVYYDPETGKEDPTKKGICSNFLCDSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP+FKF GLAWLFLGVANTDSLLYD+EF  YLQ +PDNFR
Sbjct  235  ATGTGVAPYRGYLRRMFMEDVPSFKFGGLAWLFLGVANTDSLLYDEEFTNYLQQYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  295  YDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKRVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  355  EQRGESWEQKLSQLKKNKQWHVEVY  379



>ref|XP_004231567.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Solanum lycopersicum]
Length=374

 Score =   394 bits (1012),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 191/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC++ PGDKV+ITGPSGKIMLLPE+NPNATHIMI
Sbjct  171  CVRRAVYYDPETGKEDPSKNGVCSNFLCNAKPGDKVKITGPSGKIMLLPENNPNATHIMI  230

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFMESVP  KFNGLAWLFLGVANTDSLLYDDEF KYL D+P NFR
Sbjct  231  GTGTGVAPFRGYLRRMFMESVP-MKFNGLAWLFLGVANTDSLLYDDEFTKYLNDYPGNFR  289

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  290  YDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  349

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLSQLKKNKQWHVEVY
Sbjct  350  EERGESWEQKLSQLKKNKQWHVEVY  374



>ref|XP_011096684.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=401

 Score =   395 bits (1014),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDKVQITGPSGKIMLLPEDNPNATHIMI
Sbjct  197  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKVQITGPSGKIMLLPEDNPNATHIMI  256

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVAN DSLLYD+EF+KYL++ PDNFR
Sbjct  257  ATGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANGDSLLYDEEFSKYLRENPDNFR  316

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN++GGKMYVQDKIEEYSDEIF+LLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  317  YDRALSREQKNRSGGKMYVQDKIEEYSDEIFRLLDGGAHIYFCGLKGMMPGIQDTLKKVA  376

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  377  EQRGESWDEKLSQLKKNKQWHVEVY  401



>ref|XP_007147485.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
 gb|ESW19479.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
Length=377

 Score =   394 bits (1011),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLC+S PGDK++ITGPSGKIMLLPE++PNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKNGICSNFLCNSKPGDKIKITGPSGKIMLLPEEDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFMESVPT+KF GLAWLFLGVAN+DSLLYDDEF+KYL+D+P+NFR
Sbjct  233  ATGTGVAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANSDSLLYDDEFSKYLKDYPNNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +DR LSREQKNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL+GMMPGIQDTLKRVA
Sbjct  293  FDRALSREQKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLRGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  353  EQRGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_010098567.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
 gb|EXB75227.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
Length=393

 Score =   394 bits (1012),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYD ETGKED SK+GVC N+LCDS PGDKV+ITGPSGKIMLLPEDNPNATHIMI
Sbjct  189  CVRRAVYYDRETGKEDPSKSGVCSNYLCDSKPGDKVKITGPSGKIMLLPEDNPNATHIMI  248

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVANTDSLLYDDEF KYL+D+PDNFR
Sbjct  249  ATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSLLYDDEFTKYLKDYPDNFR  308

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD+GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  309  YDRALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDDGAHIYFCGLKGMMPGIQETLKRVA  368

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            ++RG SWE KL+QLKKNKQWHVEVY
Sbjct  369  DQRGESWEEKLAQLKKNKQWHVEVY  393



>ref|XP_010529363.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=377

 Score =   393 bits (1010),  Expect = 3e-133, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK GVC NFLC++ PGDKVQITGPSGK+MLLPE+NPNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKAGVCSNFLCNAKPGDKVQITGPSGKVMLLPEENPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+VP F+FNGLAWLFLGVAN+DSLLYD+EF  YL D+PDNFR
Sbjct  233  ATGTGVAPFRGYLRRMFMENVPNFRFNGLAWLFLGVANSDSLLYDEEFTNYLNDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQ+NK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDKALSREQQNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLSQLKKNKQWHVEVY
Sbjct  353  EERGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_002523191.1| ferredoxin--NADP reductase, putative [Ricinus communis]
 gb|EEF39222.1| ferredoxin--NADP reductase, putative [Ricinus communis]
Length=378

 Score =   393 bits (1009),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK G+C NFLC+S PGDKVQITGPSGKIMLLPE +PNATHIMI
Sbjct  174  CVRRALYYDPETGKEDPSKMGICSNFLCNSKPGDKVQITGPSGKIMLLPESDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VPTFKF GLAWLFLGVANTDSLLYDDEF KYL+D+PD+FR
Sbjct  234  ATGTGVAPFRGYLRRMFMEDVPTFKFGGLAWLFLGVANTDSLLYDDEFTKYLEDYPDHFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWDQKLSQLKKNKQWHVEVY  378



>sp|O04397.1|FENR2_TOBAC RecName: Full=Ferredoxin--NADP reductase, root-type isozyme, 
chloroplastic; Short=FNR; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA20365.1| ferredoxin-NADP oxidoreductase [Nicotiana tabacum]
Length=375

 Score =   393 bits (1009),  Expect = 4e-133, Method: Compositional matrix adjust.
 Identities = 187/205 (91%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDKV+ITGPSGKIMLLPE+ PNATHIMI
Sbjct  172  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKVKITGPSGKIMLLPEEIPNATHIMI  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFMESVPT KFNGLAWLFLGVANTDSLLYDDEF KYL D+P NFR
Sbjct  232  GTGTGVAPFRGYLRRMFMESVPT-KFNGLAWLFLGVANTDSLLYDDEFTKYLNDYPGNFR  290

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  291  YDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  350

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SWE KLSQLKKNKQWHVEVY
Sbjct  351  ERRGESWEQKLSQLKKNKQWHVEVY  375



>ref|XP_004293987.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=380

 Score =   393 bits (1009),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC N+LC+S PGDK++ITGP+GKIMLLPEDNPNATHIMI
Sbjct  176  CVRRAVYYDPETGKEDPSKNGVCSNYLCNSKPGDKIKITGPAGKIMLLPEDNPNATHIMI  235

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VPTFKF GLAWLFLGVANTDSLLYD+EF+KYL+D+PDNFR
Sbjct  236  ATGTGVAPYRGYLRRMFMEAVPTFKFGGLAWLFLGVANTDSLLYDEEFSKYLKDYPDNFR  295

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSRE KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  296  YDIALSREHKNKRGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQETLKRVA  355

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLSQLKKNKQWHVEVY
Sbjct  356  EERGESWEEKLSQLKKNKQWHVEVY  380



>ref|XP_004486455.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cicer arietinum]
Length=377

 Score =   392 bits (1008),  Expect = 5e-133, Method: Compositional matrix adjust.
 Identities = 183/205 (89%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQVTGPSGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVAN+DSLLYDDEF KYL D+P+NFR
Sbjct  233  ATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANSDSLLYDDEFTKYLNDYPNNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQ+NKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ TLKRVA
Sbjct  293  YDRALSREQQNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQGTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLS LKKNKQWHVEVY
Sbjct  353  EERGESWEEKLSLLKKNKQWHVEVY  377



>emb|CDY02299.1| BnaA09g26030D [Brassica napus]
Length=382

 Score =   392 bits (1007),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE++PNATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPENDPNATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRR+FME+VP +KF GLAWLFLGVANTDSLLYDDEF+KYL+D PDNFR
Sbjct  238  ATGTGVAPYRGYLRRLFMENVPNYKFGGLAWLFLGVANTDSLLYDDEFSKYLKDHPDNFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDAKLSQLRKNKQWHVEVY  382



>sp|Q41014.2|FENR2_PEA RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Pisum sativum]
Length=377

 Score =   392 bits (1007),  Expect = 9e-133, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDP TGKED SKNGVC NFLCDS PGDK++I GPSGKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPVTGKEDPSKNGVCSNFLCDSKPGDKIKIAGPSGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PDNFR
Sbjct  233  ATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANVDSLLYDDEFTKYLKDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            Y+R LSRE+KNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  293  YNRALSREEKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLRGMMPGIQETLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  353  EKRGESWEEKLSQLKKNKQWHVEVY  377



>ref|XP_006415461.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33814.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=381

 Score =   392 bits (1007),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLCDS PGDK+QITGPSGK+MLLPE++PNATHIMI
Sbjct  177  CVRRAVYYDPETGKEDPSKNGICSNFLCDSKPGDKIQITGPSGKVMLLPENDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF GLAWLFLGVANTDSLLYDDEF+KYL+D P+NFR
Sbjct  237  ATGTGVAPYRGYLRRMFMENVPNFKFGGLAWLFLGVANTDSLLYDDEFSKYLKDHPENFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  297  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  357  EERGESWDLKLSQLRKNKQWHVEVY  381



>emb|CAA67796.1| ferrodoxin NADP oxidoreductase [Pisum sativum]
Length=378

 Score =   392 bits (1007),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDP TGKED SKNGVC NFLCDS PGDK++I GPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPVTGKEDPSKNGVCSNFLCDSKPGDKIKIAGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVPTFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PDNFR
Sbjct  234  ATGTGVAPYRGYLRRMFMESVPTFKFGGLAWLFLGVANVDSLLYDDEFTKYLKDYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            Y+R LSRE+KNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  294  YNRALSREEKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLRGMMPGIQETLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  354  EKRGESWEEKLSQLKKNKQWHVEVY  378



>ref|XP_006344529.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   392 bits (1006),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC++ PGDKV+ITGPSGKIMLLPEDN NATHIMI
Sbjct  171  CVRRAVYYDPETGKEDPSKNGVCSNFLCNAKPGDKVKITGPSGKIMLLPEDNLNATHIMI  230

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFMESVP  KFNGLAWLFLGVANTDSLLYDDEF KYL D+P NFR
Sbjct  231  GTGTGVAPFRGYLRRMFMESVP-IKFNGLAWLFLGVANTDSLLYDDEFTKYLSDYPGNFR  289

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  290  YDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  349

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLSQLKKNKQWHVEVY
Sbjct  350  EERGESWEQKLSQLKKNKQWHVEVY  374



>emb|CDY09570.1| BnaC05g23490D [Brassica napus]
Length=382

 Score =   392 bits (1007),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE++PNATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPENDPNATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRR+FME+VP +KF GLAWLFLGVANTDSLLYDDEF+KYL+D PDNFR
Sbjct  238  ATGTGVAPYRGYLRRLFMENVPNYKFGGLAWLFLGVANTDSLLYDDEFSKYLKDHPDNFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDAKLSQLRKNKQWHVEVY  382



>ref|XP_006415462.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33815.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=382

 Score =   392 bits (1007),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNG+C NFLCDS PGDK+QITGPSGK+MLLPE++PNATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGICSNFLCDSKPGDKIQITGPSGKVMLLPENDPNATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF GLAWLFLGVANTDSLLYDDEF+KYL+D P+NFR
Sbjct  238  ATGTGVAPYRGYLRRMFMENVPNFKFGGLAWLFLGVANTDSLLYDDEFSKYLKDHPENFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_006468308.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Citrus sinensis]
 gb|KDO75263.1| hypothetical protein CISIN_1g017070mg [Citrus sinensis]
Length=378

 Score =   391 bits (1005),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPE+GKED SK+G+C NFLC+S PGDKV ITGPSGKIMLLPEDNPNATHIMI
Sbjct  174  CVRRAVYYDPESGKEDPSKSGICSNFLCNSKPGDKVLITGPSGKIMLLPEDNPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFRGYLRRMFMESVPT+KF GLAWLFLGVAN DSLLYDDEF KYLQD+PDNFR
Sbjct  234  ATGTGIAPFRGYLRRMFMESVPTYKFGGLAWLFLGVANPDSLLYDDEFTKYLQDYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK GGKMYVQDKIEEYSDEIFK LD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  294  YDKALSREQKNKKGGKMYVQDKIEEYSDEIFKRLDGGAHIYFCGLKGMMPGIQETLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWDQKLSQLKKNKQWHVEVY  378



>ref|XP_006363650.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   391 bits (1004),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 185/205 (90%), Positives = 190/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC++  GDKV+ITGPSGKIMLLPE+NPNATHIMI
Sbjct  171  CVRRAVYYDPETGKEDPSKNGVCSNFLCNAKSGDKVKITGPSGKIMLLPENNPNATHIMI  230

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFMESVP  KFNGLAWLFLGVANTDSLLYDDEF KYL D+P NFR
Sbjct  231  GTGTGVAPFRGYLRRMFMESVP-MKFNGLAWLFLGVANTDSLLYDDEFTKYLNDYPGNFR  289

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN  GGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  290  YDRALSREQKNNKGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  349

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLSQLKKNKQWHVEVY
Sbjct  350  EERGESWEQKLSQLKKNKQWHVEVY  374



>ref|XP_009397390.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   390 bits (1003),  Expect = 3e-132, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYD ETGKED SKNGVC NFLCDS PGDK+ +TGPSGKIMLLPE++PNATHIMI
Sbjct  175  CVRRAVYYDAETGKEDPSKNGVCSNFLCDSKPGDKILLTGPSGKIMLLPEEDPNATHIMI  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+V T+KF GLAWLFLGVAN+DSLLYDDEF  YL+D+PDNFR
Sbjct  235  ATGTGVAPFRGYLRRMFMEAVATYKFGGLAWLFLGVANSDSLLYDDEFTGYLKDYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  295  YDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKRVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+TKLSQLKKNKQWHVEVY
Sbjct  355  EERGESWDTKLSQLKKNKQWHVEVY  379



>ref|XP_009115136.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
[Brassica rapa]
Length=382

 Score =   390 bits (1002),  Expect = 5e-132, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 194/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE++PNATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPENDPNATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRR+FME+VP +KF GLAWLFLGVANTDSLLYDDEF+KYL+D PD+FR
Sbjct  238  ATGTGVAPYRGYLRRLFMENVPNYKFGGLAWLFLGVANTDSLLYDDEFSKYLKDHPDHFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDAKLSQLRKNKQWHVEVY  382



>ref|XP_006650686.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=378

 Score =   389 bits (999),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDKVQ+TGPSGKIMLLPE++PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKVQVTGPSGKIMLLPEEDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP +KF GLAWLFLGVANTDSLLYD+EF  YL+ +PDNFR
Sbjct  234  ATGTGVAPYRGYLRRMFMEDVPKYKFGGLAWLFLGVANTDSLLYDEEFTSYLKQYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWEQKLSQLKKNKQWHVEVY  378



>ref|XP_009397718.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   389 bits (998),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SKNG C NFLC+S PGDK+Q+TGPSGKIMLLPE +PNATHIMI
Sbjct  175  CVRRAIYYDPETGKEDPSKNGTCSNFLCNSKPGDKIQLTGPSGKIMLLPEGDPNATHIMI  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+V T+KF GLAWLFLGVANTDSLLYD EF+ YL+D+PDNFR
Sbjct  235  ATGTGVAPFRGYLRRMFMEAVTTYKFGGLAWLFLGVANTDSLLYDAEFSSYLKDYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  295  YDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKRVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  355  EQRGESWDAKLSQLKKNKQWHVEVY  379



>gb|AGT15976.1| ferredoxin--NADP reductase [Saccharum hybrid cultivar R570]
Length=377

 Score =   389 bits (998),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETG+ED SK G+C NFLCDS PGDKVQITGPSGKIMLLPED+P  THIMI
Sbjct  173  CVRRAVYYDPETGEEDPSKKGICSNFLCDSKPGDKVQITGPSGKIMLLPEDDPKVTHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSLLYD+EF  YLQ +PDNFR
Sbjct  233  ATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSLLYDEEFTNYLQQYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  353  EQRGESWDQKLSQLKKNKQWHVEVY  377



>ref|XP_008383404.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Malus domestica]
Length=379

 Score =   388 bits (997),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK++ITGP+GKIMLLPEDNPNATHIMI
Sbjct  175  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIKITGPAGKIMLLPEDNPNATHIMI  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSLLYD+EF KYL+D+PDNFR
Sbjct  235  ATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSLLYDEEFTKYLKDYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            Y+  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  295  YNIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQETLKRVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
             ERG SWE KLSQLKKNKQWHVEVY
Sbjct  355  VERGESWEEKLSQLKKNKQWHVEVY  379



>ref|XP_009362229.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Pyrus x bretschneideri]
Length=377

 Score =   388 bits (996),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK++ITGP+GKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIKITGPAGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSLLYD+EF KYL+D+PDNFR
Sbjct  233  ATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSLLYDEEFTKYLKDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  293  YDIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQETLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
             ERG SWE KLSQLKKNKQWHVEVY
Sbjct  353  VERGESWEEKLSQLKKNKQWHVEVY  377



>dbj|BAA02248.1| ferredoxin-NADP+ reductase enzyme [Oryza sativa Japonica Group]
Length=317

 Score =   385 bits (990),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDKV++TGPSGKIMLLPE++PNATHIMI
Sbjct  113  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKVKVTGPSGKIMLLPEEDPNATHIMI  172

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVANTDSLLYD+EF  YL+ +PDNFR
Sbjct  173  ATGTGVAPFRGYLRRMFMEDVPKYRFGGLAWLFLGVANTDSLLYDEEFTSYLKQYPDNFR  232

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKN GKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  233  YDKALSREQKNKNAGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  292

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  293  EQRGESWEQKLSQLKKNKQWHVEVY  317



>ref|XP_004955449.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Setaria italica]
Length=380

 Score =   388 bits (996),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK G+C NFLCDS PGDKVQITGPSGKI+LLPED+PNATHIMI
Sbjct  176  CVRRAVYYDPETGKEDPSKKGICSNFLCDSKPGDKVQITGPSGKILLLPEDDPNATHIMI  235

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP +KF GLAWLFLGVAN+DSLLYD+EF  YLQ +PDNFR
Sbjct  236  ATGTGVAPYRGYLRRMFMEDVPAYKFGGLAWLFLGVANSDSLLYDEEFTTYLQQYPDNFR  295

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  296  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKRVA  355

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  356  EQRGESWDQKLSQLKKNKQWHVEVY  380



>ref|XP_006658277.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=368

 Score =   387 bits (994),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 181/205 (88%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK G+C N+LCDS PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  164  CVRRAVYYDPETGKEDPSKKGICSNYLCDSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  223

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVANTDSLLYD+EF  YLQ +P+NFR
Sbjct  224  ATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANTDSLLYDEEFTNYLQQYPNNFR  283

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQ NKNGGKMYVQDKIEEYSDEIFKLLD  AHIYFCGLKGMMPGIQDTLKRVA
Sbjct  284  YDKALSREQNNKNGGKMYVQDKIEEYSDEIFKLLDGSAHIYFCGLKGMMPGIQDTLKRVA  343

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  344  EQRGESWEQKLSQLKKNKQWHVEVY  368



>ref|NP_001051476.1| Os03g0784700 [Oryza sativa Japonica Group]
 sp|P41345.1|FENR2_ORYSJ RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAK72892.1|AC091123_11 ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA04232.1| ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA07479.1| root ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 gb|ABF99220.1| Ferredoxin-NADP reductase, root isozyme, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13390.1| Os03g0784700 [Oryza sativa Japonica Group]
 gb|EAY92083.1| hypothetical protein OsI_13788 [Oryza sativa Indica Group]
 gb|EAZ28818.1| hypothetical protein OsJ_12850 [Oryza sativa Japonica Group]
 dbj|BAG96344.1| unnamed protein product [Oryza sativa Japonica Group]
 prf||2113196A ferredoxin-NADP oxidoreductase
Length=378

 Score =   387 bits (994),  Expect = 7e-131, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDKV++TGPSGKIMLLPE++PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKVKVTGPSGKIMLLPEEDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVANTDSLLYD+EF  YL+ +PDNFR
Sbjct  234  ATGTGVAPFRGYLRRMFMEDVPKYRFGGLAWLFLGVANTDSLLYDEEFTSYLKQYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKN GKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDKALSREQKNKNAGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SWE KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWEQKLSQLKKNKQWHVEVY  378



>emb|CDY39167.1| BnaC09g21770D [Brassica napus]
Length=378

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA YYDPETGKED SK GVC NFLC++ PGDKVQITGPSGK+MLLPE++P ATHIMI
Sbjct  174  CVRRAQYYDPETGKEDPSKAGVCSNFLCNAKPGDKVQITGPSGKVMLLPEEDPKATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VPTFKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P+NFR
Sbjct  234  ATGTGVAPFRGYLRRMFMEDVPTFKFDGLAWLFLGVANSDSLLYDEEFSSYLKDYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLSQL+KNKQWHVEVY
Sbjct  354  EERGESWEQKLSQLRKNKQWHVEVY  378



>gb|ACG35047.1| ferredoxin--NADP reductase, embryo isozyme [Zea mays]
Length=381

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETG+ED SK GVC NFLC S PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  177  CVRRAVYYDPETGEEDPSKRGVCSNFLCGSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSLLYD+EF  YLQ +PDNFR
Sbjct  237  ATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSLLYDEEFTNYLQQYPDNFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  297  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDGGAHIYFCGLKGMMPGIQDTLKKVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  357  EQRGESWDQKLSQLKKNKQWHVEVY  381



>ref|NP_001132762.1| uncharacterized protein LOC100194249 [Zea mays]
 gb|ACF81748.1| unknown [Zea mays]
 tpg|DAA59536.1| TPA: ferredoxin--NADP reductase [Zea mays]
Length=381

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETG+ED SK GVC NFLC S PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  177  CVRRAVYYDPETGEEDPSKRGVCSNFLCGSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSLLYD+EF  YLQ +PDNFR
Sbjct  237  ATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSLLYDEEFTNYLQQYPDNFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  297  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDGGAHIYFCGLKGMMPGIQDTLKKVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  357  EQRGESWDQKLSQLKKNKQWHVEVY  381



>gb|EMT31879.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Aegilops 
tauschii]
Length=378

 Score =   387 bits (993),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK G+C NFLCDS PGDK+QITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKKGICSNFLCDSKPGDKIQITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFME V +FKF GLAWLFLGVANTDSLLYD+EF  YLQ +P+NFR
Sbjct  234  GTGTGVAPFRGYLRRMFMEDVSSFKFGGLAWLFLGVANTDSLLYDEEFTNYLQQYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW  KLSQLKKNKQWHVEVY
Sbjct  354  EQRGESWHQKLSQLKKNKQWHVEVY  378



>ref|NP_849734.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 sp|Q9S9P8.1|FNRR2_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 2, chloroplastic; 
AltName: Full=Root FNR 2; Short=AtRFNR2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF19753.1|AC009917_12 Strong similarity to gi|3913653 Ferredoxin-NADP Reductase, Embryo 
Isozyme Precurser from Oryza sativa, containing an Oxidoreductase 
FAD/NAD-binding PF|00175 domain. ESTs gb|N38303, 
gb|T21235, gb|AA721819, gb|T44416, gb|AI995147, gb|H76681, gb|N65405, 
gb|F14270 come from this gene [Arabidopsis thaliana]
 gb|AAL11588.1|AF424594_1 At1g30510/F26G16_5 [Arabidopsis thaliana]
 gb|AAM98159.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
 gb|AAP37827.1| At1g30510 [Arabidopsis thaliana]
 gb|AEE31237.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=382

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +PNATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPESDPNATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSLLYD+EF KYL+D PDNFR
Sbjct  238  ATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSLLYDEEFTKYLKDHPDNFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDLKLSQLRKNKQWHVEVY  382



>ref|NP_564355.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31236.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=381

 Score =   386 bits (992),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +PNATHIMI
Sbjct  177  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPESDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSLLYD+EF KYL+D PDNFR
Sbjct  237  ATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSLLYDEEFTKYLKDHPDNFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  297  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  357  EERGESWDLKLSQLRKNKQWHVEVY  381



>ref|NP_973942.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31235.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=317

 Score =   384 bits (985),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +PNATHIMI
Sbjct  113  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPESDPNATHIMI  172

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSLLYD+EF KYL+D PDNFR
Sbjct  173  ATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSLLYDEEFTKYLKDHPDNFR  232

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  233  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  292

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  293  EERGESWDLKLSQLRKNKQWHVEVY  317



>ref|XP_010247806.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Nelumbo nucifera]
Length=377

 Score =   386 bits (991),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK GVC NFLC+S PGDK++ITGPSGKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKAGVCSNFLCNSKPGDKIRITGPSGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMES+P FKF GLAWLFLGVANTDSLLYDDEF  YLQD+PD+FR
Sbjct  233  ATGTGVAPYRGYLRRMFMESIPNFKFGGLAWLFLGVANTDSLLYDDEFRMYLQDYPDHFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  293  YDLALSREQKNKRGGKMYVQDKIEEYSDEIFKLLDKGAHIYFCGLKGMMPGIQETLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG  WE KL QLKKNKQWHVEVY
Sbjct  353  EERGEIWEEKLPQLKKNKQWHVEVY  377



>gb|EMS52999.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Triticum 
urartu]
Length=488

 Score =   390 bits (1001),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 179/205 (87%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK G+C NFLCDS PGDK+QITGPSGKIMLLPED+PNATHIMI
Sbjct  284  CVRRAVYYDPETGKEDPSKKGICSNFLCDSKPGDKIQITGPSGKIMLLPEDDPNATHIMI  343

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRGYLRRMFME VP+FKF GLAWLFLGVANTDSLLYD+EF  YLQ +P+NFR
Sbjct  344  GTGTGVAPFRGYLRRMFMEDVPSFKFGGLAWLFLGVANTDSLLYDEEFTNYLQQYPENFR  403

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQD+IEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  404  YDKALSREQKNKSGGKMYVQDRIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQDTLKRVA  463

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  464  EQRGESWDQKLSQLKKNKQWHVEVY  488



>ref|XP_002461452.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
 gb|EER97973.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
Length=381

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETG+ED SK G+C NFLCDS PGDKVQITGPSGKIMLLPED+P ATHIMI
Sbjct  177  CVRRAVYYDPETGEEDPSKKGICSNFLCDSKPGDKVQITGPSGKIMLLPEDDPKATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSLLYD+EF  YLQ +P NFR
Sbjct  237  ATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSLLYDEEFTNYLQQYPYNFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  297  YDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKRVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  357  EQRGESWDQKLSQLKKNKQWHVEVY  381



>ref|XP_006305070.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
 gb|EOA37968.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
Length=382

 Score =   386 bits (991),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +PNATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPEKDPNATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F GLAWLFLGVANTDSLLYD+EF KYL+D P+NFR
Sbjct  238  ATGTGVAPYRGYLRRMFMENVPNKTFGGLAWLFLGVANTDSLLYDEEFTKYLKDHPENFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_008346149.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Malus domestica]
Length=377

 Score =   385 bits (990),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK++ITGP+GKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIKITGPAGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVAN DSLLYD+EF KYL+D+PDNFR
Sbjct  233  ATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANIDSLLYDEEFTKYLKDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  293  YDIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQETLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
             ERG SWE KLSQLKKNKQWHVEVY
Sbjct  353  VERGESWEEKLSQLKKNKQWHVEVY  377



>gb|AAM65564.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
Length=381

 Score =   385 bits (990),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +PNATHIMI
Sbjct  177  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPESDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSLLYD+EF KYL+D PDNFR
Sbjct  237  ATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSLLYDEEFTKYLKDHPDNFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDK+EEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  297  FDKALSREEKNKKGGKMYVQDKVEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  357  EERGESWDLKLSQLRKNKQWHVEVY  381



>ref|XP_009114485.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Brassica rapa]
Length=378

 Score =   385 bits (990),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA YYDPETGKED SK GVC NFLC++ PGDKVQITGPSGK+MLLPE++P ATHIMI
Sbjct  174  CVRRAQYYDPETGKEDPSKAGVCSNFLCNAKPGDKVQITGPSGKVMLLPEEDPKATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VPTFKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P+NFR
Sbjct  234  ATGTGVAPFRGYLRRMFMEDVPTFKFDGLAWLFLGVANSDSLLYDEEFSSYLKDYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  354  EERGESWEQKLTQLRKNKQWHVEVY  378



>emb|CDY46362.1| BnaA09g19760D [Brassica napus]
Length=378

 Score =   385 bits (990),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA YYDPETGKED SK GVC NFLC++ PGDKVQITGPSGK+MLLPE++P ATHIMI
Sbjct  174  CVRRAQYYDPETGKEDPSKAGVCSNFLCNAKPGDKVQITGPSGKVMLLPEEDPKATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VPTFKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P+NFR
Sbjct  234  ATGTGVAPFRGYLRRMFMEDVPTFKFDGLAWLFLGVANSDSLLYDEEFSSYLKDYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  354  EERGESWEQKLTQLRKNKQWHVEVY  378



>ref|XP_002893629.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69888.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   385 bits (990),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +PNATHIMI
Sbjct  177  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPESDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F+GLAWLFLGVANTDSLLYDDEF KYL+D P+NFR
Sbjct  237  ATGTGVAPYRGYLRRMFMENVPNKTFSGLAWLFLGVANTDSLLYDDEFTKYLKDHPENFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  297  FDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  357  EERGESWDLKLSQLRKNKQWHVEVY  381



>ref|XP_009344407.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=379

 Score =   385 bits (988),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK++ITG +GKIMLLPEDNPNATHIMI
Sbjct  175  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIKITGGAGKIMLLPEDNPNATHIMI  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSLLYD+EF KYL+D+PDNFR
Sbjct  235  ATGTGIAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSLLYDEEFTKYLKDYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  295  YDIALSREQKNQRGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQETLKRVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
             ERG SWE KLSQLKKNKQWHVEVY
Sbjct  355  VERGESWEEKLSQLKKNKQWHVEVY  379



>ref|XP_010537869.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=378

 Score =   384 bits (987),  Expect = 8e-130, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK+GVC NFLC++ PGD+V+ITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKDGVCSNFLCNAKPGDEVKITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP F+FNGLAWLFLGVAN+DSLLYD+EF  Y +++PDNFR
Sbjct  234  ATGTGVAPYRGYLRRMFMEDVPNFRFNGLAWLFLGVANSDSLLYDEEFTNYRKNYPDNFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQ+NK GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREQQNKKGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KLSQLKKNKQWHVEVY
Sbjct  354  EERGESWEQKLSQLKKNKQWHVEVY  378



>ref|XP_002263658.2| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Vitis vinifera]
 emb|CBI31015.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   384 bits (986),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDP TGKED SKNGVC N+LCDS PGDK++ITGPSGKIMLLPED+PNATHIMI
Sbjct  173  CVRRAVYYDPVTGKEDPSKNGVCSNYLCDSKPGDKIKITGPSGKIMLLPEDDPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP+F+F GLAWLFLGVANTDSLLYD+EF KYL+D+PD FR
Sbjct  233  ATGTGVAPYRGYLRRMFMEDVPSFRFGGLAWLFLGVANTDSLLYDNEFTKYLKDYPDQFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  293  YDKALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQETLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            ++RG +WE KL+QLKKNKQWHVEVY
Sbjct  353  DQRGENWEEKLAQLKKNKQWHVEVY  377



>ref|XP_010478464.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=383

 Score =   384 bits (987),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +P ATHIMI
Sbjct  179  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPEKDPKATHIMI  238

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F GLAWLFLGVANTDSLLYDDEF KYL+D P+NFR
Sbjct  239  ATGTGVAPYRGYLRRMFMENVPNRTFGGLAWLFLGVANTDSLLYDDEFTKYLKDHPENFR  298

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  299  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  358

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  359  EERGESWDLKLSQLRKNKQWHVEVY  383



>ref|XP_010478465.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=382

 Score =   384 bits (986),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 189/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +P ATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPEKDPKATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP   F GLAWLFLGVANTDSLLYDDEF KYL+D P+NFR
Sbjct  238  ATGTGVAPYRGYLRRMFMENVPNRTFGGLAWLFLGVANTDSLLYDDEFTKYLKDHPENFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_003558196.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Brachypodium distachyon]
Length=380

 Score =   383 bits (984),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDP+TGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPED+PNATHIMI
Sbjct  176  CVRRAVYYDPQTGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEDDPNATHIMI  235

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  236  ATGTGVAPYRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  295

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLK+VA
Sbjct  296  FDKALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQETLKKVA  355

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  356  EQRGESWDQKLSQLKKNKQWHVEVY  380



>gb|EMS61290.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Triticum 
urartu]
Length=419

 Score =   384 bits (987),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE +PNATHIMI
Sbjct  215  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQMTGPSGKIMLLPESDPNATHIMI  274

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP F+F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  275  ATGTGVAPYRGYLRRMFMEDVPNFRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  334

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  335  FDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  394

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  395  EQRGESWDQKLSQLKKNKQWHVEVY  419



>ref|XP_007211443.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
 gb|EMJ12642.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
Length=377

 Score =   383 bits (983),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 178/205 (87%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK++ITGP+GKIMLLPEDNPNATHIMI
Sbjct  173  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIKITGPAGKIMLLPEDNPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSLLYD+EF KYL+D+PDNFR
Sbjct  233  ATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSLLYDEEFTKYLKDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSRE KN  GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  293  YDIALSREHKNNRGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLRGMMPGIQETLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            + RG +WE KLSQLKKNKQWHVEVY
Sbjct  353  DGRGENWEEKLSQLKKNKQWHVEVY  377



>ref|XP_010907336.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=360

 Score =   382 bits (981),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETG+ED SK GVC NFLCDS PGDK+++TGPSGK+MLLPED+PNATHIM+
Sbjct  156  CVRRAVYYDPETGEEDPSKMGVCSNFLCDSKPGDKIRLTGPSGKVMLLPEDDPNATHIMM  215

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFR YLRRMFME VPT+KF GLAWLFLGVANTDSLLYDDEFA YL+D+PDNFR
Sbjct  216  ATGTGVAPFRAYLRRMFMEDVPTYKFGGLAWLFLGVANTDSLLYDDEFAGYLRDYPDNFR  275

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK GGKMYVQDKIEEYSDEIF+LLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  276  YDKALSREQKNKRGGKMYVQDKIEEYSDEIFRLLDEGAHIYFCGLKGMMPGIQDTLKRVA  335

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQL+K KQWHVEVY
Sbjct  336  EQRGENWDEKLSQLRKKKQWHVEVY  360



>pdb|1JB9|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms
Length=316

 Score =   380 bits (977),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE++PNATHIMI
Sbjct  112  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEEDPNATHIMI  171

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  172  ATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  231

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  232  YDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  291

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SW+ KL+QLKKNKQWHVEVY
Sbjct  292  ERRGESWDQKLAQLKKNKQWHVEVY  316



>ref|XP_010907335.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=379

 Score =   383 bits (983),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETG+ED SK GVC NFLCDS PGDK+++TGPSGK+MLLPED+PNATHIM+
Sbjct  175  CVRRAVYYDPETGEEDPSKMGVCSNFLCDSKPGDKIRLTGPSGKVMLLPEDDPNATHIMM  234

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFR YLRRMFME VPT+KF GLAWLFLGVANTDSLLYDDEFA YL+D+PDNFR
Sbjct  235  ATGTGVAPFRAYLRRMFMEDVPTYKFGGLAWLFLGVANTDSLLYDDEFAGYLRDYPDNFR  294

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK GGKMYVQDKIEEYSDEIF+LLDEGAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  295  YDKALSREQKNKRGGKMYVQDKIEEYSDEIFRLLDEGAHIYFCGLKGMMPGIQDTLKRVA  354

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQL+K KQWHVEVY
Sbjct  355  EQRGENWDEKLSQLRKKKQWHVEVY  379



>gb|AAB40034.1| ferredoxin-NADP reductase precursor [Zea mays]
Length=327

 Score =   380 bits (977),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE++PNATHIMI
Sbjct  123  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEEDPNATHIMI  182

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  183  ATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  242

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  243  YDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  302

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SW+ KL+QLKKNKQWHVEVY
Sbjct  303  ERRGESWDQKLAQLKKNKQWHVEVY  327



>ref|XP_010460851.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=382

 Score =   382 bits (982),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +P ATHIMI
Sbjct  178  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPEKDPKATHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP   F GLAWLFLGVANTDSLLYDDEF KYL+D P++FR
Sbjct  238  ATGTGVAPYRGYLRRMFMEDVPNRTFGGLAWLFLGVANTDSLLYDDEFTKYLKDHPEHFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  298  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  358  EERGESWDLKLSQLRKNKQWHVEVY  382



>ref|XP_010460850.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=383

 Score =   383 bits (983),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 188/205 (92%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE +P ATHIMI
Sbjct  179  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPEKDPKATHIMI  238

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP   F GLAWLFLGVANTDSLLYDDEF KYL+D P++FR
Sbjct  239  ATGTGVAPYRGYLRRMFMEDVPNRTFGGLAWLFLGVANTDSLLYDDEFTKYLKDHPEHFR  298

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  299  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  358

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SW+ KLSQL+KNKQWHVEVY
Sbjct  359  EERGESWDLKLSQLRKNKQWHVEVY  383



>pdb|3LVB|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms - Test Set Withheld
Length=311

 Score =   380 bits (975),  Expect = 6e-129, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE++PNATHIMI
Sbjct  107  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEEDPNATHIMI  166

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  167  ATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  226

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  227  YDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  286

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SW+ KL+QLKKNKQWHVEVY
Sbjct  287  ERRGESWDQKLAQLKKNKQWHVEVY  311



>dbj|BAJ93902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   382 bits (981),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE +PNATHIMI
Sbjct  172  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPESDPNATHIMI  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  232  ATGTGVAPYRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  291

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  292  FDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  351

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  352  EQRGESWDQKLSQLKKNKQWHVEVY  376



>gb|KFK32212.1| hypothetical protein AALP_AA6G212100 [Arabis alpina]
Length=377

 Score =   382 bits (981),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETG+ED SK GVC NFLC++ PGDKV+ITGPSGKIMLLPED P ATHIMI
Sbjct  173  CVRRALYYDPETGEEDPSKAGVCSNFLCNAKPGDKVKITGPSGKIMLLPEDAPKATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+VP FKF+GL+WLFLGVAN+DSLLYD+EFA YL+D+PDNFR
Sbjct  233  ATGTGVAPFRGYLRRMFMENVPNFKFDGLSWLFLGVANSDSLLYDEEFAGYLKDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KN+ GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDKALSREEKNQKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  353  EERGESWEQKLTQLRKNKQWHVEVY  377



>gb|EYU43232.1| hypothetical protein MIMGU_mgv1a008184mg [Erythranthe guttata]
Length=382

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK GVC NFLCDS PG KVQITGPSGKIMLLPE+NPN THIMI
Sbjct  178  CVRRAVYYDPETGKEDASKKGVCSNFLCDSKPGGKVQITGPSGKIMLLPEENPNGTHIMI  237

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMF E++PTFKFNGLAWLFLGVAN DSLLYD+EF++YL+++PDNFR
Sbjct  238  ATGTGVAPYRGYLRRMFTENIPTFKFNGLAWLFLGVANKDSLLYDEEFSEYLRNYPDNFR  297

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +DR LSREQ+N+NGGKMYVQD+IEEYSDEIF+LLD GAHIYFCGLKGMMPGIQDTLKRV+
Sbjct  298  FDRALSREQRNRNGGKMYVQDRIEEYSDEIFELLDSGAHIYFCGLKGMMPGIQDTLKRVS  357

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG  W+ KL+QLKKNKQWHVEVY
Sbjct  358  ETRGEKWDEKLTQLKKNKQWHVEVY  382



>gb|AAM64825.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score =   382 bits (980),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+P ATHIMI
Sbjct  174  CVRRAIYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDPKATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EFA Y +D+P+NFR
Sbjct  234  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFAGYRKDYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  354  EERGESWEQKLTQLRKNKQWHVEVY  378



>ref|NP_567293.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
 sp|Q9M0V6.2|FNRR1_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 1, chloroplastic; 
AltName: Full=Root FNR 1; Short=AtRFNR1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL61946.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AAM47928.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AEE82512.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
Length=378

 Score =   381 bits (979),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+P ATHIMI
Sbjct  174  CVRRAIYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDPKATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EFA Y +D+P+NFR
Sbjct  234  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFAGYRKDYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  354  EERGESWEQKLTQLRKNKQWHVEVY  378



>ref|XP_006396605.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
 gb|ESQ38058.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
Length=377

 Score =   381 bits (979),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 175/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+P ATHIMI
Sbjct  173  CVRRALYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDPKATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EFA YL+D P+NFR
Sbjct  233  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFAGYLKDNPENFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  353  EERGESWEKKLTQLRKNKQWHVEVY  377



>emb|CAB81081.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=360

 Score =   380 bits (977),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+P ATHIMI
Sbjct  156  CVRRAIYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDPKATHIMI  215

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EFA Y +D+P+NFR
Sbjct  216  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFAGYRKDYPENFR  275

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  276  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  335

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  336  EERGESWEQKLTQLRKNKQWHVEVY  360



>ref|NP_001190682.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
 gb|AEE82513.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
Length=350

 Score =   380 bits (976),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+P ATHIMI
Sbjct  146  CVRRAIYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDPKATHIMI  205

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EFA Y +D+P+NFR
Sbjct  206  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFAGYRKDYPENFR  265

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  266  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  325

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  326  EERGESWEQKLTQLRKNKQWHVEVY  350



>gb|ACG39703.1| ferredoxin--NADP reductase, root isozyme [Zea mays]
Length=381

 Score =   380 bits (977),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE++PNATHIMI
Sbjct  177  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEEDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  237  ATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  297  YDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SW+ KL+QLKKNKQWHVEVY
Sbjct  357  ERRGESWDQKLAQLKKNKQWHVEVY  381



>ref|XP_008665551.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Zea mays]
 gb|ACF87736.1| unknown [Zea mays]
 gb|ACN29024.1| unknown [Zea mays]
 gb|ACR35923.1| unknown [Zea mays]
 gb|ACR36711.1| unknown [Zea mays]
 tpg|DAA51768.1| TPA: ferredoxin-NADP reductase Precursor [Zea mays]
Length=381

 Score =   380 bits (977),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE++PNATHIMI
Sbjct  177  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEEDPNATHIMI  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  237  ATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  296

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  297  YDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  356

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SW+ KL+QLKKNKQWHVEVY
Sbjct  357  ERRGESWDQKLAQLKKNKQWHVEVY  381



>ref|XP_002463784.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
 gb|EER90782.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
Length=380

 Score =   380 bits (977),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKE+ SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE++PNATHIMI
Sbjct  176  CVRRAVYYDPETGKEEPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEEDPNATHIMI  235

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  236  ATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  295

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  296  YDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  355

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  356  EQRGESWDQKLSQLKKNKQWHVEVY  380



>ref|XP_008225595.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Prunus mume]
Length=377

 Score =   380 bits (977),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDP+TGKED SKNGVC NFLC+S PGDK++ITGP+GKIMLLPEDNPNATHIMI
Sbjct  173  CVRRAVYYDPKTGKEDPSKNGVCSNFLCNSKPGDKIKITGPAGKIMLLPEDNPNATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFMESVP FKF GLAWLFLGVANTDSLLYD+EF KYL+D+PDNFR
Sbjct  233  ATGTGVAPYRGYLRRMFMESVPKFKFGGLAWLFLGVANTDSLLYDEEFTKYLKDYPDNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            Y+  LSRE KN  GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  293  YNIALSREHKNNRGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLRGMMPGIQETLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            + RG +WE KLSQLKKNKQWHVEVY
Sbjct  353  DGRGENWEEKLSQLKKNKQWHVEVY  377



>pdb|3LO8|A Chain A, Crystal Structure Of The Oxidized Form Of Ferredoxin:nadp+ 
Reductase From Maize Root At 1.05 Angstroms
Length=311

 Score =   378 bits (970),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 173/204 (85%), Positives = 190/204 (93%), Gaps = 0/204 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE++PNATHIMI
Sbjct  107  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKIQLTGPSGKIMLLPEEDPNATHIMI  166

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  167  ATGTGVAPFRGYLRRMFMEDVPNYRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  226

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKN++GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  227  YDKALSREQKNRSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  286

Query  224  EERGLSWETKLSQLKKNKQWHVEV  153
            E RG SW+ KL+QLKKNKQWHVEV
Sbjct  287  ERRGESWDQKLAQLKKNKQWHVEV  310



>gb|EMT16236.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Aegilops 
tauschii]
Length=372

 Score =   380 bits (976),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED  KNGVC NFLC+S PGDK+Q+TGPSGKIMLLPE +PNATHIMI
Sbjct  168  CVRRAVYYDPETGKEDPLKNGVCSNFLCNSKPGDKIQMTGPSGKIMLLPESDPNATHIMI  227

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VP F+F GLAWLFLGVAN+DSLLYD+EF  YL+ +PDNFR
Sbjct  228  ATGTGVAPYRGYLRRMFMEDVPNFRFGGLAWLFLGVANSDSLLYDEEFTSYLKQYPDNFR  287

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            +D+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  288  FDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDGGAHIYFCGLKGMMPGIQDTLKKVA  347

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  348  EQRGESWDQKLSQLKKNKQWHVEVY  372



>gb|KFK44861.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=384

 Score =   380 bits (976),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 192/206 (93%), Gaps = 2/206 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE++PNATHIMI
Sbjct  180  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPENDPNATHIMI  239

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP  KF GLAWLFLGVANTDSLLYDDEF KYL+D P+NFR
Sbjct  240  ATGTGVAPYRGYLRRMFMENVPN-KFTGLAWLFLGVANTDSLLYDDEFTKYLKDHPENFR  298

Query  404  YDRVLSRE-QKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            +D+ LSRE +KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRV
Sbjct  299  FDKALSREGEKNKRGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRV  358

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            AEERG SWE KL+QL+KNKQWHVEVY
Sbjct  359  AEERGESWELKLTQLRKNKQWHVEVY  384



>gb|AAM96978.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score =   380 bits (975),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 192/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+P ATHIMI
Sbjct  174  CVRRAIYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDPKATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EFA Y +D+P+NFR
Sbjct  234  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFAGYRKDYPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYS+EIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  294  YDKALSREEKNKKGGKMYVQDKIEEYSNEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  354  EERGESWEQKLTQLRKNKQWHVEVY  378



>gb|KFK44862.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=383

 Score =   380 bits (976),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/206 (87%), Positives = 192/206 (93%), Gaps = 2/206 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE++PNATHIMI
Sbjct  179  CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPENDPNATHIMI  238

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP  KF GLAWLFLGVANTDSLLYDDEF KYL+D P+NFR
Sbjct  239  ATGTGVAPYRGYLRRMFMENVPN-KFTGLAWLFLGVANTDSLLYDDEFTKYLKDHPENFR  297

Query  404  YDRVLSRE-QKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            +D+ LSRE +KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRV
Sbjct  298  FDKALSREGEKNKRGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRV  357

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            AEERG SWE KL+QL+KNKQWHVEVY
Sbjct  358  AEERGESWELKLTQLRKNKQWHVEVY  383



>ref|XP_011085204.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=393

 Score =   380 bits (976),  Expect = 8e-128, Method: Compositional matrix adjust.
 Identities = 186/205 (91%), Positives = 195/205 (95%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK GVC NFLCDS PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  189  CVRRAVYYDPETGKEDPSKKGVCSNFLCDSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  248

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+VPTFKF GLAWLFLGVAN+DSLLYDDEF+KYL+D+PDNFR
Sbjct  249  ATGTGVAPFRGYLRRMFMENVPTFKFGGLAWLFLGVANSDSLLYDDEFSKYLRDYPDNFR  308

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YDR LSREQKN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  309  YDRALSREQKNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  368

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG SW+ KLSQLKK KQWHVEVY
Sbjct  369  EQRGESWDEKLSQLKKKKQWHVEVY  393



>ref|XP_010691939.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=376

 Score =   379 bits (973),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 189/205 (92%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED  K GVC NFLC++ PGDKVQITGPSGK+MLLPED PNATHIMI
Sbjct  173  CVRRALYYDPETGKEDPEKMGVCSNFLCNAKPGDKVQITGPSGKVMLLPED-PNATHIMI  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME VPT+KF GLAWLFLGVANTDSLLYDDEF KYL+++PDNFR
Sbjct  232  ATGTGVAPYRGYLRRMFMEDVPTYKFKGLAWLFLGVANTDSLLYDDEFTKYLKEYPDNFR  291

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQ+NK GGKMYVQDKIEEYSDEIFK+LD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  292  YDTALSREQQNKKGGKMYVQDKIEEYSDEIFKMLDNGAHIYFCGLKGMMPGIQDTLKRVA  351

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG  W+ KLSQLKKNKQWHVEVY
Sbjct  352  EERGEKWDEKLSQLKKNKQWHVEVY  376



>ref|XP_010431473.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=375

 Score =   379 bits (972),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+  ATHIMI
Sbjct  171  CVRRAIYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDQKATHIMI  230

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P NFR
Sbjct  231  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFSGYLKDYPKNFR  290

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  291  YDKALSREEKNKTGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  350

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  351  EERGESWEQKLTQLRKNKQWHVEVY  375



>ref|XP_010431466.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=377

 Score =   379 bits (972),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 173/205 (84%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETGKED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+  ATHIMI
Sbjct  173  CVRRAIYYDPETGKEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDQKATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P NFR
Sbjct  233  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFSGYLKDYPKNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDKALSREEKNKTGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  353  EERGESWEQKLTQLRKNKQWHVEVY  377



>ref|XP_006287956.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20854.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=377

 Score =   378 bits (970),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETG+ED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+  ATHIMI
Sbjct  173  CVRRAIYYDPETGEEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDQKATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P NFR
Sbjct  233  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFSSYLKDYPKNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  353  EERGESWEQKLTQLRKNKQWHVEVY  377



>ref|XP_006287955.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20853.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=375

 Score =   377 bits (969),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 191/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETG+ED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+  ATHIMI
Sbjct  171  CVRRAIYYDPETGEEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDQKATHIMI  230

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P NFR
Sbjct  231  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFSSYLKDYPKNFR  290

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  291  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVA  350

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNKQWHVEVY
Sbjct  351  EERGESWEQKLTQLRKNKQWHVEVY  375



>ref|XP_006844572.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
 gb|ERN06247.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
Length=377

 Score =   377 bits (967),  Expect = 8e-127, Method: Compositional matrix adjust.
 Identities = 170/205 (83%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDP+TG ED SKNG+C NFLC+S PGDKVQITGPSGK+MLLPE++P+ATHIMI
Sbjct  173  CVRRAVYYDPDTGNEDPSKNGICSNFLCNSKPGDKVQITGPSGKVMLLPEEDPDATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFRGYLRRMFMES+P+FKF GLAWLFLGVAN+DSLLYD+EF  Y++++P+NFR
Sbjct  233  ATGTGIAPFRGYLRRMFMESIPSFKFGGLAWLFLGVANSDSLLYDEEFNNYVKEYPENFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK GGK+YVQDKIEEYSDE+FKLLDEGAHIYFCGL+GMMPGIQDTLKRVA
Sbjct  293  YDLALSREQKNKLGGKLYVQDKIEEYSDEVFKLLDEGAHIYFCGLRGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +WE KLS+LKKNKQWHVEVY
Sbjct  353  EQRGENWEEKLSKLKKNKQWHVEVY  377



>ref|XP_008650954.1| PREDICTED: uncharacterized protein LOC100194249 isoform X1 [Zea 
mays]
Length=396

 Score =   376 bits (966),  Expect = 2e-126, Method: Compositional matrix adjust.
 Identities = 179/220 (81%), Positives = 191/220 (87%), Gaps = 15/220 (7%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQIT---------------GPSGKI  630
            CVRRAVYYDPETG+ED SK GVC NFLC S PGDKVQIT               GPSGKI
Sbjct  177  CVRRAVYYDPETGEEDPSKRGVCSNFLCGSKPGDKVQITADIQNVVHLTWCPYQGPSGKI  236

Query  629  MLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYD  450
            MLLPED+PNATHIMIATGTGVAP+RGYLRRMFME VPTFKF GLAWLFLGVAN+DSLLYD
Sbjct  237  MLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEDVPTFKFGGLAWLFLGVANSDSLLYD  296

Query  449  DEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGL  270
            +EF  YLQ +PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIF+LLD GAHIYFCGL
Sbjct  297  EEFTNYLQQYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFRLLDGGAHIYFCGL  356

Query  269  KGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            KGMMPGIQDTLK+VAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  357  KGMMPGIQDTLKKVAEQRGESWDQKLSQLKKNKQWHVEVY  396



>gb|KHG02797.1| hypothetical protein F383_08810 [Gossypium arboreum]
Length=376

 Score =   375 bits (963),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 189/205 (92%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYD ETGKED SK+GVC NFLC+  PGDKVQITGPSGKIMLLPEDNPNA HIMI
Sbjct  173  CVRRAVYYDTETGKEDPSKSGVCSNFLCNCKPGDKVQITGPSGKIMLLPEDNPNANHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRR+FME V TFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PD FR
Sbjct  233  ATGTGVAPFRGYLRRIFMEDV-TFKFKGLAWLFLGVANKDSLLYDDEFTKYLKDYPDQFR  291

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  292  YDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLRGMMPGIQETLKRVA  351

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQLKKNKQWHVEVY
Sbjct  352  EQRGENWDEKLSQLKKNKQWHVEVY  376



>ref|XP_011016596.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
[Populus euphratica]
Length=355

 Score =   374 bits (961),  Expect = 4e-126, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            C+RRAVYYDPETGKED SK+GVC NFLC+S PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  151  CIRRAVYYDPETGKEDPSKSGVCSNFLCNSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  210

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+VPT+KF GLAWLFLGVANTDSLLYDDEFAKYLQD+PD+FR
Sbjct  211  ATGTGVAPFRGYLRRMFMEAVPTYKFGGLAWLFLGVANTDSLLYDDEFAKYLQDYPDHFR  270

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  271  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQDTLKKVA  330

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG  W+ KLSQLKK KQWHVEVY
Sbjct  331  EQRGEKWDEKLSQLKKKKQWHVEVY  355



>ref|XP_011038878.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Populus euphratica]
Length=378

 Score =   375 bits (962),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 196/205 (96%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK+GVC NFLC+S PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKSGVCSNFLCNSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+VPT+KF GLAWLFLGVANTDSLLYD+EFAKYLQD+PD+FR
Sbjct  234  ATGTGVAPFRGYLRRMFMEAVPTYKFGGLAWLFLGVANTDSLLYDEEFAKYLQDYPDHFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG  W+ KLSQLKK KQWHVEVY
Sbjct  354  EQRGEKWDEKLSQLKKKKQWHVEVY  378



>ref|XP_010422426.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=377

 Score =   374 bits (960),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETG ED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+  ATHIMI
Sbjct  173  CVRRAIYYDPETGIEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDQKATHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P NFR
Sbjct  233  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFSGYLKDYPKNFR  292

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  293  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDSGAHIYFCGLKGMMPGIQDTLKRVA  352

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNK+WHVEVY
Sbjct  353  EERGESWEQKLTQLRKNKRWHVEVY  377



>ref|XP_010422427.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=375

 Score =   374 bits (959),  Expect = 1e-125, Method: Compositional matrix adjust.
 Identities = 171/205 (83%), Positives = 190/205 (93%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA+YYDPETG ED SK GVC NFLC++ PGDKV+ITGPSGK+MLLPED+  ATHIMI
Sbjct  171  CVRRAIYYDPETGIEDPSKAGVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDQKATHIMI  230

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME+VP FKF+GLAWLFLGVAN+DSLLYD+EF+ YL+D+P NFR
Sbjct  231  ATGTGVAPYRGYLRRMFMENVPNFKFDGLAWLFLGVANSDSLLYDEEFSGYLKDYPKNFR  290

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSRE+KNK GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVA
Sbjct  291  YDKALSREEKNKKGGKMYVQDKIEEYSDEIFKLLDSGAHIYFCGLKGMMPGIQDTLKRVA  350

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            EERG SWE KL+QL+KNK+WHVEVY
Sbjct  351  EERGESWEQKLTQLRKNKRWHVEVY  375



>gb|KJB56289.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=316

 Score =   367 bits (943),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 186/205 (91%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYY+PETGKED  K+GVC NFLC+  PGDKVQITGPSGKIMLLPE NP A HIMI
Sbjct  113  CVRRAVYYNPETGKEDPLKSGVCSNFLCNCKPGDKVQITGPSGKIMLLPEGNPKANHIMI  172

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFR YLRRMFME V TFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PD FR
Sbjct  173  ATGTGVAPFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSLLYDDEFTKYLEDYPDQFR  231

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  232  YDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLRGMMPGIQETLKRVA  291

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQLKKNKQWHVEVY
Sbjct  292  EQRGENWDEKLSQLKKNKQWHVEVY  316



>gb|KJB56286.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=376

 Score =   369 bits (948),  Expect = 8e-124, Method: Compositional matrix adjust.
 Identities = 174/205 (85%), Positives = 186/205 (91%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYY+PETGKED  K+GVC NFLC+  PGDKVQITGPSGKIMLLPE NP A HIMI
Sbjct  173  CVRRAVYYNPETGKEDPLKSGVCSNFLCNCKPGDKVQITGPSGKIMLLPEGNPKANHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFR YLRRMFME V TFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PD FR
Sbjct  233  ATGTGVAPFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSLLYDDEFTKYLEDYPDQFR  291

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  292  YDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLRGMMPGIQETLKRVA  351

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQLKKNKQWHVEVY
Sbjct  352  EQRGENWDEKLSQLKKNKQWHVEVY  376



>gb|ACJ83525.1| unknown [Medicago truncatula]
Length=198

 Score =   362 bits (929),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 169/196 (86%), Positives = 183/196 (93%), Gaps = 0/196 (0%)
 Frame = -1

Query  737  PETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMIATGTGVAPF  558
            P+  ++  SKNGVC NFLCDS PGDK++ITGPSGKIMLLPED+PNATHIMIATGTGVAP+
Sbjct  3    PKQERKIPSKNGVCSNFLCDSKPGDKIKITGPSGKIMLLPEDDPNATHIMIATGTGVAPY  62

Query  557  RGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQ  378
            RGYLRRMFMESVPTFKF GLAWLFLGVAN+DSLLYDDEF KYL+D+P+NFRYDR LSRE+
Sbjct  63   RGYLRRMFMESVPTFKFGGLAWLFLGVANSDSLLYDDEFTKYLKDYPENFRYDRALSREE  122

Query  377  KNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWET  198
            KN+NGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQ+TLKRVAE RG SWE 
Sbjct  123  KNRNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQETLKRVAENRGESWEE  182

Query  197  KLSQLKKNKQWHVEVY  150
            KLSQLKKNKQWHVEVY
Sbjct  183  KLSQLKKNKQWHVEVY  198



>ref|XP_002298889.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
 gb|EEE83694.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
Length=378

 Score =   368 bits (945),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK+GVC NFLC+S PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKSGVCSNFLCNSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME+VPT+KF GLAWLFLGVAN DSLLYD+EFAKYLQD PD+FR
Sbjct  234  ATGTGVAPFRGYLRRMFMEAVPTYKFGGLAWLFLGVANNDSLLYDEEFAKYLQDNPDHFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFK LD+GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKRLDDGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG  W+ KLSQLKK KQWHVEVY
Sbjct  354  EQRGEKWDEKLSQLKKKKQWHVEVY  378



>gb|ACY70395.1| heterotrophic ferredoxin NADP+ oxidoreductase [Populus tremula 
x Populus tremuloides]
Length=378

 Score =   368 bits (944),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 180/205 (88%), Positives = 193/205 (94%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYY+PETGKED SK+GVC NFLC+S PGDKVQITGPSGKIMLLPED+PNATHIMI
Sbjct  174  CVRRAVYYNPETGKEDPSKSGVCSNFLCNSKPGDKVQITGPSGKIMLLPEDDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VPT+KF GLAWLFLGVAN DSLLYD+EFAKYLQD PD+FR
Sbjct  234  ATGTGVAPFRGYLRRMFMEDVPTYKFGGLAWLFLGVANNDSLLYDEEFAKYLQDNPDHFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQDTLK+VA
Sbjct  294  YDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQDTLKKVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG  W+ KLSQLKK KQWHVEVY
Sbjct  354  EQRGEKWDEKLSQLKKKKQWHVEVY  378



>ref|XP_007022877.1| Root FNR 1 isoform 1 [Theobroma cacao]
 gb|EOY25499.1| Root FNR 1 isoform 1 [Theobroma cacao]
Length=387

 Score =   366 bits (940),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 191/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC++ PGDKVQITGPSGKIMLLPEDNPNA HIMI
Sbjct  184  CVRRAVYYDPETGKEDHSKNGVCSNFLCNTKPGDKVQITGPSGKIMLLPEDNPNANHIMI  243

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME V TFKF GLAWLFLGVAN DSLLYDDEF KYLQDFPD+FR
Sbjct  244  ATGTGVAPFRGYLRRMFMEDV-TFKFRGLAWLFLGVANADSLLYDDEFTKYLQDFPDHFR  302

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  303  YDGALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQETLKRVA  362

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQLKK KQWHVEVY
Sbjct  363  EKRGENWDEKLSQLKKKKQWHVEVY  387



>ref|XP_007022878.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
 gb|EOY25500.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
Length=316

 Score =   363 bits (933),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 182/205 (89%), Positives = 191/205 (93%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC++ PGDKVQITGPSGKIMLLPEDNPNA HIMI
Sbjct  113  CVRRAVYYDPETGKEDHSKNGVCSNFLCNTKPGDKVQITGPSGKIMLLPEDNPNANHIMI  172

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME V TFKF GLAWLFLGVAN DSLLYDDEF KYLQDFPD+FR
Sbjct  173  ATGTGVAPFRGYLRRMFMEDV-TFKFRGLAWLFLGVANADSLLYDDEFTKYLQDFPDHFR  231

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGLKGMMPGIQ+TLKRVA
Sbjct  232  YDGALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLKGMMPGIQETLKRVA  291

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQLKK KQWHVEVY
Sbjct  292  EKRGENWDEKLSQLKKKKQWHVEVY  316



>gb|EPS58368.1| hypothetical protein M569_16446, partial [Genlisea aurea]
Length=330

 Score =   362 bits (930),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 184/207 (89%), Gaps = 2/207 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SK GVC NFLCDS  GDKVQITGPSGKIMLLPEDNPN  HIMI
Sbjct  124  CVRRAVYYDPETGKEDPSKKGVCSNFLCDSKRGDKVQITGPSGKIMLLPEDNPNGNHIMI  183

Query  584  ATGTGVAPFRGYLRRMFMESV--PTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDN  411
            ATGTGVAPFR YLRRMFME+V   +FKF GLAWLFLGVAN DSLLYD+EF+KYL D P N
Sbjct  184  ATGTGVAPFRAYLRRMFMENVTASSFKFGGLAWLFLGVANGDSLLYDEEFSKYLVDHPAN  243

Query  410  FRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKR  231
            FRYDR LSRE KNK GGKMYVQDK+EEYSDEI +LL++GAHIYFCGLKGMM GIQ+TLKR
Sbjct  244  FRYDRALSREHKNKRGGKMYVQDKMEEYSDEILELLEQGAHIYFCGLKGMMGGIQETLKR  303

Query  230  VAEERGLSWETKLSQLKKNKQWHVEVY  150
            VAEERG SWE KLS+LKKNKQWHVEVY
Sbjct  304  VAEERGESWEEKLSKLKKNKQWHVEVY  330



>ref|XP_002982108.1| hypothetical protein SELMODRAFT_179376 [Selaginella moellendorffii]
 gb|EFJ16776.1| hypothetical protein SELMODRAFT_179376 [Selaginella moellendorffii]
Length=348

 Score =   358 bits (919),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 173/211 (82%), Positives = 182/211 (86%), Gaps = 7/211 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITG------PSGKIMLLPEDNPN  603
            CVRRAVY+DPETGKED +K GVC NFLCD  PGDKVQITG      PSGKIMLLPE NP 
Sbjct  139  CVRRAVYWDPETGKEDPAKKGVCSNFLCDRKPGDKVQITGKLFLYRPSGKIMLLPESNPK  198

Query  602  ATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            A HIMIATGTG+APFRGYLRRMFME V +FKF GLAWLFLGVAN DSLLY DEF  YL++
Sbjct  199  AAHIMIATGTGIAPFRGYLRRMFMEDV-SFKFGGLAWLFLGVANRDSLLYHDEFEGYLKE  257

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQD  243
            +PDNFRYD  LSREQ NK GGKMYVQDKIEEYS+E+FKLLDEGAHIYFCGLKGMMPGIQD
Sbjct  258  YPDNFRYDIALSREQNNKRGGKMYVQDKIEEYSEEVFKLLDEGAHIYFCGLKGMMPGIQD  317

Query  242  TLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            TLKRVAEERG SWE KLS LKK KQWHVEVY
Sbjct  318  TLKRVAEERGESWEEKLSMLKKKKQWHVEVY  348



>ref|XP_002992209.1| hypothetical protein SELMODRAFT_134886 [Selaginella moellendorffii]
 gb|EFJ06706.1| hypothetical protein SELMODRAFT_134886 [Selaginella moellendorffii]
Length=348

 Score =   358 bits (918),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 172/211 (82%), Positives = 182/211 (86%), Gaps = 7/211 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITG------PSGKIMLLPEDNPN  603
            CVRRAVY+DPETGKED ++ GVC NFLCD  PGDKVQITG      PSGKIMLLPE NP 
Sbjct  139  CVRRAVYWDPETGKEDPARKGVCSNFLCDRKPGDKVQITGKLFLYRPSGKIMLLPESNPK  198

Query  602  ATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            A HIMIATGTG+APFRGYLRRMFME V +FKF GLAWLFLGVAN DSLLY DEF  YL++
Sbjct  199  AAHIMIATGTGIAPFRGYLRRMFMEDV-SFKFGGLAWLFLGVANRDSLLYHDEFEGYLKE  257

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQD  243
            +PDNFRYD  LSREQ NK GGKMYVQDKIEEYS+E+FKLLDEGAHIYFCGLKGMMPGIQD
Sbjct  258  YPDNFRYDIALSREQNNKRGGKMYVQDKIEEYSEEVFKLLDEGAHIYFCGLKGMMPGIQD  317

Query  242  TLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            TLKRVAEERG SWE KLS LKK KQWHVEVY
Sbjct  318  TLKRVAEERGESWEEKLSMLKKKKQWHVEVY  348



>ref|XP_001770917.1| predicted protein [Physcomitrella patens]
 ref|XP_001770962.1| predicted protein [Physcomitrella patens]
 gb|EDQ64247.1| predicted protein [Physcomitrella patens]
 gb|EDQ64292.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   356 bits (914),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 181/205 (88%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY+ PE   ED +K G+C NFLCD  PGDKVQITGPSGK+MLLPE +PNATHIM+
Sbjct  174  CVRRAVYWCPELQAEDPAKKGICSNFLCDCKPGDKVQITGPSGKVMLLPESDPNATHIMV  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP+RG+LRRMFME VPTFKF GLAWLFLGVAN+DSLLY DEF KY + FP+NFR
Sbjct  234  ATGTGIAPYRGFLRRMFMEDVPTFKFGGLAWLFLGVANSDSLLYHDEFTKYKEAFPENFR  293

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSRE+KN  GGKMYVQDKIEEYS+E+F LLD+GAHIYFCGL+GMMPGIQDTLKRVA
Sbjct  294  YDTALSREEKNSKGGKMYVQDKIEEYSEELFNLLDKGAHIYFCGLRGMMPGIQDTLKRVA  353

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG +WE KL++LKKNKQWHVEVY
Sbjct  354  EARGENWEEKLAKLKKNKQWHVEVY  378



>ref|XP_001774270.1| predicted protein [Physcomitrella patens]
 gb|EDQ60906.1| predicted protein [Physcomitrella patens]
Length=291

 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 161/205 (79%), Positives = 183/205 (89%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY+DPETGKED +K G+C NFLCDS PGDKVQI GPSGK++LLPE++P+ATHIM+
Sbjct  88   CVRRAVYWDPETGKEDPAKKGICSNFLCDSKPGDKVQIVGPSGKVLLLPEEDPSATHIMV  147

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP+RGYLRRMFME    FKFNGLAWLF+GVANTDSLLY DEF  YL+++PDNFR
Sbjct  148  ATGTGIAPYRGYLRRMFMEDT-EFKFNGLAWLFMGVANTDSLLYHDEFNTYLKEYPDNFR  206

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKN  GGK+YVQDK+EEYS+E+F  LD+GAHIYFCGL+GMMPGIQD LKRVA
Sbjct  207  YDIALSREQKNSRGGKLYVQDKMEEYSEELFDKLDKGAHIYFCGLRGMMPGIQDMLKRVA  266

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E RG SWETKL+ LKKNKQWHVEVY
Sbjct  267  ESRGESWETKLAALKKNKQWHVEVY  291



>ref|XP_002874840.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51099.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   344 bits (883),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 156/185 (84%), Positives = 174/185 (94%), Gaps = 0/185 (0%)
 Frame = -1

Query  704  GVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMES  525
            GVC NFLC++ PGDKV+ITGPSGK+MLLPED+P ATHIMIATGTGVAP+RGYLRRMFME+
Sbjct  171  GVCSNFLCNAKPGDKVKITGPSGKVMLLPEDDPKATHIMIATGTGVAPYRGYLRRMFMEN  230

Query  524  VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQ  345
            VP FKF+GLAWLFLGVAN+DSLLYD+EF  YL+D+P+NF+YD+ LSRE+KNK GGKMYVQ
Sbjct  231  VPNFKFDGLAWLFLGVANSDSLLYDEEFTGYLKDYPENFKYDKALSREEKNKKGGKMYVQ  290

Query  344  DKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQW  165
            DKIEEYSDEIFKLLD GAHIYFCGLKGMMPGIQDTLKRVAEERG SWE KL+QL+KNKQW
Sbjct  291  DKIEEYSDEIFKLLDNGAHIYFCGLKGMMPGIQDTLKRVAEERGESWEQKLTQLRKNKQW  350

Query  164  HVEVY  150
            HVEVY
Sbjct  351  HVEVY  355



>gb|KJB56288.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=364

 Score =   335 bits (860),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 170/188 (90%), Gaps = 1/188 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYY+PETGKED  K+GVC NFLC+  PGDKVQITGPSGKIMLLPE NP A HIMI
Sbjct  173  CVRRAVYYNPETGKEDPLKSGVCSNFLCNCKPGDKVQITGPSGKIMLLPEGNPKANHIMI  232

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFR YLRRMFME V TFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PD FR
Sbjct  233  ATGTGVAPFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSLLYDDEFTKYLEDYPDQFR  291

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  292  YDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLRGMMPGIQETLKRVA  351

Query  224  EERGLSWE  201
            E+RG +W+
Sbjct  352  EQRGENWD  359



>ref|XP_006448908.1| hypothetical protein CICLE_v100156272mg, partial [Citrus clementina]
 gb|ESR62148.1| hypothetical protein CICLE_v100156272mg, partial [Citrus clementina]
Length=165

 Score =   317 bits (813),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 157/165 (95%), Gaps = 0/165 (0%)
 Frame = -1

Query  644  PSGKIMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTD  465
            PSGKIMLLPEDNPNATHIMIATGTG+APFRGYLRRMFMESV T+KF GLAWLFLGVAN+D
Sbjct  1    PSGKIMLLPEDNPNATHIMIATGTGIAPFRGYLRRMFMESVHTYKFGGLAWLFLGVANSD  60

Query  464  SLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHI  285
            SLLYDDEF KYLQD+PDNFRYD+ LSREQKNK GGKMYVQDKIEEYSDEIFKLLD GAHI
Sbjct  61   SLLYDDEFTKYLQDYPDNFRYDKALSREQKNKKGGKMYVQDKIEEYSDEIFKLLDGGAHI  120

Query  284  YFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            YFCGLKGMMPGIQ+TLKRVAE+RG SW+ KLSQLKKNKQWHVEVY
Sbjct  121  YFCGLKGMMPGIQETLKRVAEQRGESWDQKLSQLKKNKQWHVEVY  165



>ref|XP_008796785.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic 
[Phoenix dactylifera]
Length=160

 Score =   299 bits (765),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 139/160 (87%), Positives = 150/160 (94%), Gaps = 0/160 (0%)
 Frame = -1

Query  629  MLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYD  450
            MLLPED+PNATHIMIATGTGVAP+RGYLRRMFME+VPT+KF GLAWLFLGVANTDSLLYD
Sbjct  1    MLLPEDDPNATHIMIATGTGVAPYRGYLRRMFMEAVPTYKFGGLAWLFLGVANTDSLLYD  60

Query  449  DEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGL  270
            DEF  YL D+PDNFRYD+ LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL
Sbjct  61   DEFTGYLHDYPDNFRYDKALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDRGAHIYFCGL  120

Query  269  KGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            KGMMPGIQDTLKRVA +RG +W+ KLSQL+K KQWHVEVY
Sbjct  121  KGMMPGIQDTLKRVAVQRGENWDEKLSQLRKKKQWHVEVY  160



>gb|KJB56287.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=349

 Score =   305 bits (781),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 162/205 (79%), Gaps = 28/205 (14%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYY+PETGKED  K+GVC NFLC+  PGDKVQIT                     
Sbjct  173  CVRRAVYYNPETGKEDPLKSGVCSNFLCNCKPGDKVQIT---------------------  211

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
                  APFR YLRRMFME V TFKF GLAWLFLGVAN DSLLYDDEF KYL+D+PD FR
Sbjct  212  ------APFRSYLRRMFMEDV-TFKFKGLAWLFLGVANKDSLLYDDEFTKYLEDYPDQFR  264

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSREQKNK+GGKMYVQDKIEEYSDEIFKLLD+GAHIYFCGL+GMMPGIQ+TLKRVA
Sbjct  265  YDLALSREQKNKSGGKMYVQDKIEEYSDEIFKLLDDGAHIYFCGLRGMMPGIQETLKRVA  324

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            E+RG +W+ KLSQLKKNKQWHVEVY
Sbjct  325  EQRGENWDEKLSQLKKNKQWHVEVY  349



>gb|KIZ06612.1| ferredoxin--NADP+ reductase [Monoraphidium neglectum]
Length=341

 Score =   296 bits (759),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY DPETGKED +K G+C NFLCD+ PG ++Q+TGP+GK++LLPE +P +  I +
Sbjct  138  CVRRAVYVDPETGKEDPAKKGICSNFLCDAEPGTQIQMTGPAGKVLLLPE-SPKSVLICV  196

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR + RR F E+VP +KF+GL WLF+GVAN+DSLLY+DE       +PDNFR
Sbjct  197  ATGTGIAPFRSFWRRCFFENVPGWKFDGLFWLFMGVANSDSLLYEDEIQAIKATYPDNFR  256

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQKNK+GGKMY+QDK+EEY+D IFKLLDEGAHIYFCGLKGMMPGI   L+RVA
Sbjct  257  VDYALSREQKNKSGGKMYIQDKVEEYADIIFKLLDEGAHIYFCGLKGMMPGITSMLERVA  316

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            + +GL++E    +LK   QWHVEVY
Sbjct  317  KAKGLNFEEFAEKLKHKNQWHVEVY  341



>gb|EJK72001.1| hypothetical protein THAOC_06509 [Thalassiosira oceanica]
Length=340

 Score =   295 bits (756),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   +D +K GVC NFLCD+ PGD++++TGPSGK+ML+PE++PN  +IM+
Sbjct  135  CVRRATYWCPELQADDPAKKGVCSNFLCDTTPGDELKMTGPSGKVMLMPEEDPNTDYIMV  194

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+RG++RR+F E  P    + G AWLFLGVAN+D+LLYDDEF      +PDNF
Sbjct  195  ATGTGIAPYRGFIRRLFFEDTPAADVYKGQAWLFLGVANSDALLYDDEFQDAKARYPDNF  254

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NK GGKMY+QDK+EEY+DEIF  LD GAHIYFCGLKGMMPGIQD LK V
Sbjct  255  RIDYALSREQENKKGGKMYIQDKVEEYADEIFNKLDSGAHIYFCGLKGMMPGIQDMLKAV  314

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
             EE+G+S++  L  LK+ KQWHVEVY
Sbjct  315  CEEKGISYDEWLKGLKQAKQWHVEVY  340



>ref|XP_005644145.1| ferredoxin-NADP+ reductase [Coccomyxa subellipsoidea C-169]
 gb|EIE19601.1| ferredoxin-NADP+ reductase [Coccomyxa subellipsoidea C-169]
Length=349

 Score =   295 bits (756),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 132/205 (64%), Positives = 161/205 (79%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE    D +K G+C NFLCD+ PGD++ +TGP+GKI+LLPED  NA  IM+
Sbjct  146  CVRRAEYWCPEMKANDPAKKGICSNFLCDAKPGDEITMTGPTGKILLLPEDK-NAAIIMV  204

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP+R + RR F+E +  +K+ GLAWLF+GVAN+D+ LYDDE    L+  PD FR
Sbjct  205  ATGTGIAPYRAFWRRFFLEEIEGYKYTGLAWLFMGVANSDAKLYDDELQAILKAHPDQFR  264

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQ NKNGGKMY+QDK+EEYSDE+F LLD GAHIYFCGLKGMMPGIQ+ L+RVA
Sbjct  265  VDYALSREQTNKNGGKMYIQDKVEEYSDEVFDLLDNGAHIYFCGLKGMMPGIQEMLERVA  324

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
             E+G+ WE    +LKKN QWHVEVY
Sbjct  325  SEKGMVWEEFFQKLKKNNQWHVEVY  349



>ref|XP_005853875.1| ferredoxin--NADP+ reductase [Nannochloropsis gaditana CCMP526]
 gb|EKU22482.1| ferredoxin--NADP+ reductase [Nannochloropsis gaditana CCMP526]
Length=411

 Score =   296 bits (759),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K G+C N+LCD+ PGD V + GP+GK+ML+PE  P A  IM+
Sbjct  206  CVRRATYWCPELKAEDPTKKGICSNYLCDAKPGDSVALAGPTGKVMLIPEKTPEADLIMV  265

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+R ++RR+F+E  P  K F GLAWLFLGVAN DSLLYDDE+ +  + +P+NF
Sbjct  266  ATGTGIAPYRTFVRRLFVEDTPARKAFKGLAWLFLGVANKDSLLYDDEWQEVKKAYPNNF  325

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NK GGKMY+QDK+EEY+DEIF  L +GAHIYFCGLKGMMPGIQDTL+RV
Sbjct  326  RVDYALSREQENKKGGKMYIQDKMEEYADEIFDRLSKGAHIYFCGLKGMMPGIQDTLERV  385

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A+E+G+ W+  L  LKKN QWHVEVY
Sbjct  386  AQEKGIEWKDMLEGLKKNHQWHVEVY  411



>gb|EWM23857.1| Ferredoxin reductase-type FAD-binding domain protein [Nannochloropsis 
gaditana]
Length=437

 Score =   297 bits (761),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 133/206 (65%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K G+C N+LCD+ PGD V + GP+GK+ML+PE  P A  IM+
Sbjct  232  CVRRATYWCPELKAEDPAKKGICSNYLCDAKPGDSVALAGPTGKVMLIPEKTPEADLIMV  291

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+R ++RR+F+E  P  K F GLAWLFLGVAN DSLLYDDE+ +  + +P+NF
Sbjct  292  ATGTGIAPYRTFVRRLFVEDTPARKAFKGLAWLFLGVANKDSLLYDDEWQEVKKAYPNNF  351

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NK GGKMY+QDK+EEY+DEIF  L +GAHIYFCGLKGMMPGIQDTL+RV
Sbjct  352  RVDYALSREQENKKGGKMYIQDKMEEYADEIFDRLSKGAHIYFCGLKGMMPGIQDTLERV  411

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A+E+G+ W+  L  LKKN QWHVEVY
Sbjct  412  AQEKGIEWKDMLEGLKKNHQWHVEVY  437



>ref|XP_002954986.1| ferredoxin-NADP+ reductase [Volvox carteri f. nagariensis]
 gb|AAB40978.1| ferredoxin-NADP+ reductase [Volvox carteri]
 gb|EFJ43974.1| ferredoxin-NADP+ reductase [Volvox carteri f. nagariensis]
Length=346

 Score =   291 bits (745),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 163/205 (80%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY DPETGKED +K G+C N+LCD+ PG ++ +TGP+GK++LLP D  NA  I +
Sbjct  143  CVRRAVYVDPETGKEDPAKKGICSNYLCDATPGTEIVMTGPTGKVLLLPADA-NAPLICV  201

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR + RR FME+VP++KF GL WLF+GVAN+D+ LYD+E     + +P  FR
Sbjct  202  ATGTGIAPFRSFWRRCFMENVPSYKFTGLFWLFMGVANSDAKLYDEELQALAKAYPSQFR  261

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQKN+ GGKMY+QDK+EEYSDEIF LLD GAH+YFCGLKGMMPGIQ+ L+RVA
Sbjct  262  LDYALSREQKNRKGGKMYIQDKVEEYSDEIFDLLDNGAHMYFCGLKGMMPGIQEMLERVA  321

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            + +GL++E  +  LK   QWHVEVY
Sbjct  322  KSKGLNYEEWVEGLKHRNQWHVEVY  346



>emb|CAA55406.1| ferredoxin NADP reductase [Chlamydomonas reinhardtii]
Length=255

 Score =   287 bits (735),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 163/205 (80%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY DPETGKED +K G+C NFLCD+ PG ++ +TGP+GK++LLP D  NA  I +
Sbjct  52   CVRRAVYVDPETGKEDPAKKGLCSNFLCDATPGTEISMTGPTGKVLLLPAD-ANAPLICV  110

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR + RR F+E+VP++KF GL WLF+GVAN+D+ LYD+E     + +P  FR
Sbjct  111  ATGTGIAPFRSFWRRCFIENVPSYKFTGLFWLFMGVANSDAKLYDEELQAIAKAYPGQFR  170

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQ N+ GGKMY+QDK+EEY+DEIF LLD GAH+YFCGLKGMMPGIQD L+RVA
Sbjct  171  LDYALSREQNNRKGGKMYIQDKVEEYADEIFDLLDNGAHMYFCGLKGMMPGIQDMLERVA  230

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+GL++E  +  LK   QWHVEVY
Sbjct  231  KEKGLNYEEWVEGLKHKNQWHVEVY  255



>ref|XP_001697352.1| ferredoxin-nadp reductase [Chlamydomonas reinhardtii]
 gb|EDP00292.1| ferredoxin-nadp reductase [Chlamydomonas reinhardtii]
Length=346

 Score =   290 bits (743),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 130/205 (63%), Positives = 163/205 (80%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY DPETGKED +K G+C NFLCD+ PG ++ +TGP+GK++LLP D  NA  I +
Sbjct  143  CVRRAVYVDPETGKEDPAKKGLCSNFLCDATPGTEISMTGPTGKVLLLPADA-NAPLICV  201

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR + RR F+E+VP++KF GL WLF+GVAN+D+ LYD+E     + +P  FR
Sbjct  202  ATGTGIAPFRSFWRRCFIENVPSYKFTGLFWLFMGVANSDAKLYDEELQAIAKAYPGQFR  261

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQ N+ GGKMY+QDK+EEY+DEIF LLD GAH+YFCGLKGMMPGIQD L+RVA
Sbjct  262  LDYALSREQNNRKGGKMYIQDKVEEYADEIFDLLDNGAHMYFCGLKGMMPGIQDMLERVA  321

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+GL++E  +  LK   QWHVEVY
Sbjct  322  KEKGLNYEEWVEGLKHKNQWHVEVY  346



>gb|ABA55546.1| chloroplast ferredoxin-dependent NADP oxireductase [Karlodinium 
veneficum]
Length=382

 Score =   291 bits (746),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K GVC N+LCD+NPGD V++TGPSGK+MLLPED P    IM+
Sbjct  177  CVRRATYWCPELKAEDPAKKGVCSNYLCDANPGDMVKLTGPSGKVMLLPEDKPETDIIMV  236

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP R +++RMF+E  P  K F GLAWLFLGVANTD+LLYDD++       PD F
Sbjct  237  ATGTGIAPMRSFIQRMFVEQTPYAKDFKGLAWLFLGVANTDALLYDDDWKAIQAASPDQF  296

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            RYD  LSREQ NK+GGKMY+QDK+EEYSDEIF  L +GAHIYFCGLKGMMPGIQD LK+V
Sbjct  297  RYDVALSREQTNKDGGKMYIQDKVEEYSDEIFDRLTKGAHIYFCGLKGMMPGIQDMLKKV  356

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A  +GL ++     LKKN QWHVEVY
Sbjct  357  AAAKGLDYDEFTKGLKKNGQWHVEVY  382



>ref|XP_002184856.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43592.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=340

 Score =   290 bits (742),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ P+   +D +K G+C NFLCD+ PGD+V +TGP+GK+MLLPE+ P+  +IM+
Sbjct  135  CVRRATYWCPDLKADDPAKKGICSNFLCDTKPGDEVNMTGPAGKVMLLPEEEPDTDYIMV  194

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+RG++RR+F E  P  + + G AWLFLGVAN+D+LLYDDE+   L+++P+NF
Sbjct  195  ATGTGIAPYRGFVRRLFTEETPAGEAYKGQAWLFLGVANSDALLYDDEWQTVLKEYPENF  254

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NKNGGKMY+QDK+EEY+DEIF  LD GAHIYFCGLKGMMPGIQD LK V
Sbjct  255  RLDYALSREQENKNGGKMYIQDKVEEYADEIFAKLDSGAHIYFCGLKGMMPGIQDMLKSV  314

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
             EE+ + ++  L  LK  KQWHVEVY
Sbjct  315  CEEKKVDYDEWLKGLKSKKQWHVEVY  340



>ref|XP_003084170.1| ferredoxin-NADP reductase (ISS) [Ostreococcus tauri]
 emb|CAL58586.1| Ferredoxin-NADP+ reductase [Ostreococcus tauri]
Length=364

 Score =   290 bits (742),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 163/205 (80%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+DPE   ED +K G+C NFLCD+ PG +V +TGP+G++MLLP+D P    IM+
Sbjct  161  CVRRATYWDPEMNAEDPAKKGICSNFLCDAKPGQEVMMTGPTGQVMLLPKD-PATPVIMV  219

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP R YLRR F+E +P+++F GLAWLF+GVAN+D+ LYDDEF + ++ FPD FR
Sbjct  220  ATGTGIAPMRSYLRRFFLEDIPSWEFKGLAWLFMGVANSDAKLYDDEFQEMVKRFPDQFR  279

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSRE  NKNGGKMY+QDK+EEY D++F+LLD GAH+YFCGLKGMMPGI   L+ V 
Sbjct  280  IDYALSREDTNKNGGKMYIQDKVEEYKDQVFQLLDGGAHMYFCGLKGMMPGILSMLEGVC  339

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+G+S+E  L  LKKN QWHVEVY
Sbjct  340  KEKGISYEEWLEGLKKNGQWHVEVY  364



>gb|ABD51927.1| chloroplast ferredoxin NADP oxidoreductase [Guillardia theta]
Length=366

 Score =   290 bits (741),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 162/207 (78%), Gaps = 2/207 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K GVC N+LCDS PGD++ +TGPSGK+ML+PED+PN T+IM+
Sbjct  160  CVRRATYWCPELKAEDPAKKGVCSNYLCDSKPGDEISLTGPSGKVMLMPEDDPNMTYIMV  219

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+APFR +LRR+F E  P  K F GLAWLFLGVAN DSLLYD+EF  YL+  PD  
Sbjct  220  ATGTGIAPFRSFLRRLFGEGNPAGKNFKGLAWLFLGVANKDSLLYDEEFQVYLRQNPDKM  279

Query  407  RYDRVLSREQK-NKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKR  231
            R D  LSRE   NK GGKMY+QDK+EEY+DE+F  LD+GAHIYFCGLKGMMPGIQD L+ 
Sbjct  280  RLDYALSREGPLNKKGGKMYIQDKVEEYADEVFDALDKGAHIYFCGLKGMMPGIQDMLRG  339

Query  230  VAEERGLSWETKLSQLKKNKQWHVEVY  150
            V E +GL++E  L  LKK  QWHVEVY
Sbjct  340  VCESKGLNFEEYLEGLKKKGQWHVEVY  366



>ref|XP_005835894.1| hypothetical protein GUITHDRAFT_162347 [Guillardia theta CCMP2712]
 gb|EKX48914.1| hypothetical protein GUITHDRAFT_162347 [Guillardia theta CCMP2712]
Length=391

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 162/207 (78%), Gaps = 2/207 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K GVC N+LCDS PGD++ +TGPSGK+ML+PED+PN T+IM+
Sbjct  185  CVRRATYWCPELKAEDPAKKGVCSNYLCDSKPGDEISLTGPSGKVMLMPEDDPNMTYIMV  244

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+APFR +LRR+F E  P  K F GLAWLFLGVAN DSLLYD+EF  YL+  PD  
Sbjct  245  ATGTGIAPFRSFLRRLFGEGNPAGKNFKGLAWLFLGVANKDSLLYDEEFQVYLRQNPDKM  304

Query  407  RYDRVLSREQK-NKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKR  231
            R D  LSRE   NK GGKMY+QDK+EEY+DE+F  LD+GAHIYFCGLKGMMPGIQD L+ 
Sbjct  305  RLDYALSREGPLNKKGGKMYIQDKVEEYADEVFDALDKGAHIYFCGLKGMMPGIQDMLRG  364

Query  230  VAEERGLSWETKLSQLKKNKQWHVEVY  150
            V E +GL++E  L  LKK  QWHVEVY
Sbjct  365  VCESKGLNFEEYLEGLKKKGQWHVEVY  391



>sp|P53991.1|FENR_CHLRE RecName: Full=Ferredoxin--NADP reductase, chloroplastic; Short=FNR; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAA79131.1| ferredoxin-NADP+ reductase [Chlamydomonas reinhardtii]
Length=354

 Score =   288 bits (738),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 162/205 (79%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY DPETGKED +K G+C NFLCD+ PG ++ +TGP+GK++LLP D  NA  I +
Sbjct  151  CVRRAVYVDPETGKEDPAKKGLCSNFLCDATPGTEISMTGPTGKVLLLPADA-NAPLICV  209

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR + RR F+E+VP++KF GL WLF+GV N+D+ LYD+E     + +P  FR
Sbjct  210  ATGTGIAPFRSFWRRCFIENVPSYKFTGLFWLFMGVGNSDAKLYDEELQAIAKAYPGQFR  269

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQ N+ GGKMY+QDK+EEY+DEIF LLD GAH+YFCGLKGMMPGIQD L+RVA
Sbjct  270  LDYALSREQNNRKGGKMYIQDKVEEYADEIFDLLDNGAHMYFCGLKGMMPGIQDMLERVA  329

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+GL++E  +  LK   QWHVEVY
Sbjct  330  KEKGLNYEEWVEGLKHKNQWHVEVY  354



>ref|XP_005790923.1| hypothetical protein EMIHUDRAFT_361737 [Emiliania huxleyi CCMP1516]
 gb|EOD38494.1| hypothetical protein EMIHUDRAFT_361737 [Emiliania huxleyi CCMP1516]
Length=382

 Score =   289 bits (739),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/209 (63%), Positives = 163/209 (78%), Gaps = 4/209 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   +D +K GVC N+LCDS PGD V++TGPSGK+ML+PE +PN   IM+
Sbjct  174  CVRRATYWCPELKADDPAKKGVCSNYLCDSKPGDDVKLTGPSGKVMLIPEKDPNVDLIMV  233

Query  584  ATGTGVAPFRGYLRRMFMESVP----TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFP  417
            ATGTG+AP+R ++RR+F+E  P      K +GLAWLFLGVAN+D+LLYDDE+   L+  P
Sbjct  234  ATGTGIAPYRSFIRRLFVEETPFGEAYTKGSGLAWLFLGVANSDALLYDDEWQSVLKAHP  293

Query  416  DNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTL  237
             NFR D  LSREQKNK+GGKMY+QDK+ EYSDEIF  +D GAH+YFCGLKGMMPGI + L
Sbjct  294  KNFRLDYALSREQKNKDGGKMYIQDKVAEYSDEIFTRMDNGAHMYFCGLKGMMPGITEML  353

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + V +E+GL WE KL+Q KK  QWHVEVY
Sbjct  354  EGVCKEKGLKWEDKLTQWKKAGQWHVEVY  382



>ref|XP_005770769.1| hypothetical protein EMIHUDRAFT_432385 [Emiliania huxleyi CCMP1516]
 gb|EOD18340.1| hypothetical protein EMIHUDRAFT_432385 [Emiliania huxleyi CCMP1516]
Length=352

 Score =   288 bits (737),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 164/209 (78%), Gaps = 4/209 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   +D +K GVC N+LCDS PGD V++TGPSGK+ML+PE +PN   IM+
Sbjct  144  CVRRATYWCPELKADDPAKKGVCSNYLCDSKPGDDVKLTGPSGKVMLIPEKDPNVDLIMV  203

Query  584  ATGTGVAPFRGYLRRMFMESVP----TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFP  417
            ATGTG+AP+R ++RR+F+E  P      K  G AWLFLGVAN+D+LLYDDE+ + L+ +P
Sbjct  204  ATGTGIAPYRSFIRRLFVEKTPFGEAYTKGTGQAWLFLGVANSDALLYDDEWQEVLKKYP  263

Query  416  DNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTL  237
            DNFR D  LSREQKNK+GGKMY+QDK+ EYSDEIF  +D GAH+YFCGLKGMMPGI + L
Sbjct  264  DNFRLDYALSREQKNKDGGKMYIQDKVAEYSDEIFSKMDNGAHMYFCGLKGMMPGITEML  323

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + V +++GL WE KLS+ KK  QWHVEVY
Sbjct  324  EGVCKDKGLVWEDKLSEWKKAGQWHVEVY  352



>ref|XP_002290014.1| ferredoxin--NADP+ reductase [Thalassiosira pseudonana CCMP1335]
 gb|EED93551.1| ferredoxin--NADP+ reductase [Thalassiosira pseudonana CCMP1335]
Length=361

 Score =   287 bits (735),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   +D +K G+C NFLCD+  GD+V +TGP+GK+ML+PE++P   +IM+
Sbjct  156  CVRRATYWCPELKADDPAKKGICSNFLCDTTAGDEVMMTGPAGKVMLMPEEDPKTDYIMV  215

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+APFRG++RR+F ES P  K + G AWLFLGVAN+D+LLYDDEF +    FPDNF
Sbjct  216  ATGTGIAPFRGFVRRLFFESTPAAKAYQGQAWLFLGVANSDALLYDDEFQEAKSKFPDNF  275

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ NK GGKMY+QDK+EEY+DE+F  L+ GAHIYFCGLKGMMPGIQD L  V
Sbjct  276  RLDYALSREQNNKKGGKMYIQDKVEEYADEVFNKLNNGAHIYFCGLKGMMPGIQDMLAEV  335

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
             + +GL ++  + +LK  KQWHVEVY
Sbjct  336  CKSKGLDYDEWIKELKGKKQWHVEVY  361



>gb|AAP79145.1| ferredoxin-NADP oxidoreductase [Bigelowiella natans]
Length=367

 Score =   286 bits (731),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+DPE GKED +K GVC N+LCD+ PG ++ +TGP+GK+ML+PE+ P    IM+
Sbjct  162  CVRRATYWDPELGKEDPAKKGVCSNYLCDAKPGTELALTGPAGKVMLMPEEKPETPIIML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTF-KFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+RG+LRR+F+E+     KF GLAWLFLGVAN+D+LLYD+++    + +P+ F
Sbjct  222  ATGTGIAPYRGFLRRLFVENTEAAEKFKGLAWLFLGVANSDALLYDEDWKAMQEKYPEKF  281

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            RYD  LSREQKNK+GGKMY+QDK+EEY  E+F+L++ GAHIYFCGLKGMMPG+   ++ V
Sbjct  282  RYDVALSREQKNKSGGKMYIQDKVEEYGKEVFELMNLGAHIYFCGLKGMMPGVLGAMESV  341

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A+ +G++WE  L + KK  QWHVEVY
Sbjct  342  AKSQGVNWEETLQKWKKAGQWHVEVY  367



>gb|ABF73016.1| plastid ferredoxin NADPH reductase protein precursor [Karenia 
brevis]
Length=398

 Score =   287 bits (734),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 131/206 (64%), Positives = 165/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE  KED +K GVC N+LCD++ GD V++TGP+GK+MLLPED P    IM+
Sbjct  193  CVRRATYWCPEMEKEDPAKKGVCSNYLCDASAGDVVKLTGPTGKVMLLPEDKPETDIIMV  252

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+R +L+RMF+E  P  K F GLAWLFLGVAN+D+LLYD+++    ++ PDNF
Sbjct  253  ATGTGIAPYRSFLKRMFIEKTPFAKDFKGLAWLFLGVANSDALLYDEDWKAIEKENPDNF  312

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            RYD  LSRE  NK+GGKMY+QDK+EEY DE+F  LD+GAHIYFCGLKGMMPGIQ  L++V
Sbjct  313  RYDVALSREMTNKDGGKMYIQDKVEEYGDEVFDRLDKGAHIYFCGLKGMMPGIQGMLEKV  372

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A  +GL++E  + +LKKN QWHVEVY
Sbjct  373  AGAKGLNYEEFIKKLKKNGQWHVEVY  398



>ref|XP_002180511.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47919.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=298

 Score =   283 bits (723),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K GVC NFLCD+ PG++VQ+TGP+GK+ML+PE+NP+  +IM+
Sbjct  93   CVRRATYWCPEMKAEDPTKKGVCSNFLCDTRPGEEVQMTGPAGKVMLMPEENPDTDYIMV  152

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+RG++RR+F E  P  + + G AWLFLGVAN+D+LLYDDE+ +   + P+ F
Sbjct  153  ATGTGIAPYRGFVRRLFTEKTPAAEAYKGQAWLFLGVANSDALLYDDEWQEVKTNNPNQF  212

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NK GGKMY+QDK+EEY+DEIF+ LD GAHIYFCGLKGMMPGIQ+ L+ V
Sbjct  213  RLDYALSREQENKKGGKMYIQDKVEEYADEIFQKLDAGAHIYFCGLKGMMPGIQEMLQTV  272

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
              ++G+ ++  L  LK  KQWHVEVY
Sbjct  273  CTQKGVEYDEWLKGLKAKKQWHVEVY  298



>ref|XP_001422240.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00557.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   284 bits (727),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 160/205 (78%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+DPE   ED +K G+C NFLCD+ PG +V +TGP+G++MLLP+D P    IM+
Sbjct  157  CVRRATYWDPEMNAEDPAKKGICSNFLCDAKPGAEVMMTGPTGQVMLLPKD-PATPVIMV  215

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP R Y+RR F+E VP ++F GLAWLF+GVAN+D+ LYDDEF +  + FPD FR
Sbjct  216  ATGTGIAPMRSYIRRFFLEDVPNWEFKGLAWLFMGVANSDAKLYDDEFQECAKRFPDQFR  275

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSRE  NKNGGKMY+QDK+EEY D++F+LLD GAH+YFCGLKGMMPGI   L+ V 
Sbjct  276  IDYALSREDTNKNGGKMYIQDKVEEYKDQVFQLLDGGAHMYFCGLKGMMPGILSMLEGVC  335

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+G+S+E  L  LKK  QWHVEVY
Sbjct  336  KEKGISYEEWLEGLKKKGQWHVEVY  360



>ref|XP_002180502.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47910.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=320

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 164/206 (80%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K GVC NFLCD+ PG++VQ+TGP+GK+ML+PE+NP+  +IM+
Sbjct  115  CVRRATYWCPELKAEDPTKKGVCSNFLCDTRPGEEVQMTGPAGKVMLMPEENPDTDYIMV  174

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+RG++RR+F E  P  + + G AWLFLGVAN+D+LLYDDE+ +   + P+ F
Sbjct  175  ATGTGIAPYRGFVRRLFTEKTPAAEAYKGQAWLFLGVANSDALLYDDEWQEVKTNNPNQF  234

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NK GGKMY+QDK+EEY+DEIF+ LD GAHIYFCGLKGMMPGIQ+ L+ V
Sbjct  235  RLDYALSREQENKKGGKMYIQDKVEEYADEIFQKLDAGAHIYFCGLKGMMPGIQEMLQTV  294

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
              ++G+ ++  L  LK  KQWHVEVY
Sbjct  295  CTQKGVEYDEWLKGLKAKKQWHVEVY  320



>ref|XP_007510909.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66469.1| predicted protein [Bathycoccus prasinos]
Length=369

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 159/205 (78%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+D E G ED  K G+C NFLCD+ PG ++ +TGP+G++MLLP+D P+   IM+
Sbjct  166  CVRRATYWDEEKGAEDPEKKGICSNFLCDATPGTEIMMTGPTGQVMLLPKD-PSTPVIMV  224

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP R Y+RR F+E VP++ F GLAWLF+GVAN+D+ LYDDEF + ++ FP  FR
Sbjct  225  ATGTGIAPMRAYIRRFFVEDVPSWNFTGLAWLFMGVANSDATLYDDEFQECVKRFPGQFR  284

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQ NK GGKMY+QDK+EEY D++F LLD GAH+YFCGLKGMMPGI   L+ V 
Sbjct  285  IDYALSREQNNKKGGKMYIQDKVEEYKDQVFGLLDGGAHMYFCGLKGMMPGILSMLEGVC  344

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+G+ +E  L  LKKN QWHVEVY
Sbjct  345  KEKGIDYEEWLEGLKKNGQWHVEVY  369



>ref|XP_002295321.1| ferredoxin-nadp reductase [Thalassiosira pseudonana CCMP1335]
 gb|EED87387.1| ferredoxin-nadp reductase [Thalassiosira pseudonana CCMP1335]
Length=339

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 159/206 (77%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   +D +K G+C NFLCD+ PG +V +TGP+GK+ML+PE++P   +IM+
Sbjct  134  CVRRATYWCPELKADDPAKKGICSNFLCDTEPGAEVMMTGPAGKVMLMPEEDPKTDYIMV  193

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+APFR ++RR+F E  P    + G AWLFLGVAN+D+LLYDDEF      +P+NF
Sbjct  194  ATGTGIAPFRSFVRRLFFEDTPAAAAYKGEAWLFLGVANSDALLYDDEFQDAKARYPENF  253

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NKNGGKMY+QDK+EEY+DE+F  LD GAHIYFCGLKGMMPGIQD L  V
Sbjct  254  RLDYALSREQENKNGGKMYIQDKVEEYADEVFNKLDNGAHIYFCGLKGMMPGIQDMLAEV  313

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
             + +GL +E  + +LK  KQWHVEVY
Sbjct  314  CKSKGLDYEEWIKELKGKKQWHVEVY  339



>gb|AAW79315.1| chloroplast ferredoxin NADP(+) reductase, partial [Isochrysis 
galbana]
 gb|ABA55514.1| chloroplast ferredoxin dependent NADH oxireductase, partial [Isochrysis 
galbana]
Length=367

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 160/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   +D +K GVC NFLCDS PGD+V++TGPSGK+ML+PE +  A  IM+
Sbjct  162  CVRRATYWCPELKADDPAKKGVCSNFLCDSKPGDEVKLTGPSGKVMLIPEQDATADLIMV  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+R ++RR+F+E  P  + + GLAWLFLGVAN D+LLYDDE+   L+ +P NF
Sbjct  222  ATGTGIAPYRSFIRRLFVEKTPYGEVYKGLAWLFLGVANKDALLYDDEWQSVLKSYPKNF  281

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ NK+GGKMY+QDK+ EYSDEIF  +D GAH+YFCGLKGMMPGI + L+ V
Sbjct  282  RVDYALSREQTNKDGGKMYIQDKVAEYSDEIFTRMDNGAHMYFCGLKGMMPGITEMLEGV  341

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            ++ +G+ WE KL + K   QWHVEVY
Sbjct  342  SKAKGIVWEDKLKEWKSKGQWHVEVY  367



>gb|AFK49031.1| unknown [Lotus japonicus]
Length=147

 Score =   273 bits (699),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = -1

Query  590  MIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDN  411
            MI TGTGVAPFRGYLRRMFMESVPTFKF GLAWLFLGVANTDSLLY DEF KYL+D+P N
Sbjct  1    MIGTGTGVAPFRGYLRRMFMESVPTFKFGGLAWLFLGVANTDSLLYHDEFTKYLKDYPTN  60

Query  410  FRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKR  231
            FRYD  LSREQKNKNGGKMYVQDKIEEYSDEIFKLLD GAHIYFCGL+GMMPGIQ+TLKR
Sbjct  61   FRYDIALSREQKNKNGGKMYVQDKIEEYSDEIFKLLDNGAHIYFCGLRGMMPGIQETLKR  120

Query  230  VAEERGLSWETKLSQLKKNKQWHVEVY  150
            VA++RG +W+ KLSQLKKNKQWHVEVY
Sbjct  121  VADQRGENWDEKLSQLKKNKQWHVEVY  147



>emb|CBJ31206.1| hypothetical protein Esi_0238_0041 [Ectocarpus siliculosus]
Length=398

 Score =   281 bits (720),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/206 (63%), Positives = 159/206 (77%), Gaps = 4/206 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA   DPETGKED SK GVC NFLC +  G +V +TGPSGKIMLLPE+ P+A  IM+
Sbjct  196  CVRRATVIDPETGKEDPSKEGVCSNFLCRARAGQEVTLTGPSGKIMLLPEETPDADVIMV  255

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
             TGTG+AP+RG+L+R+F E  P  + F G AWLFLGVA T+ LLY D++ + L+ FP NF
Sbjct  256  GTGTGIAPYRGFLQRLFKEDTPAARAFTGTAWLFLGVATTEGLLYHDDWMEMLRKFPFNF  315

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R +    RE+KN +GGKMY+QD++E+Y+DE+F+ LD GAHIYFCGLKGMMPGI D L RV
Sbjct  316  RCE---GREEKNASGGKMYIQDRVEQYADEVFERLDGGAHIYFCGLKGMMPGITDMLARV  372

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A ERG+SW+ KL +LK   QWHVEVY
Sbjct  373  AGERGISWDAKLKELKSKGQWHVEVY  398



>ref|XP_009040433.1| hypothetical protein AURANDRAFT_31888 [Aureococcus anophagefferens]
 gb|EGB04876.1| hypothetical protein AURANDRAFT_31888 [Aureococcus anophagefferens]
Length=336

 Score =   279 bits (713),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+DPE GK+D +K GVC NF+CDS PGD V++TGPSGK+ML+PE+  +  +IM+
Sbjct  131  CVRRATYWDPEMGKDDPAKKGVCSNFICDSKPGDAVKMTGPSGKVMLMPEEKADTDYIMV  190

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+R ++RR+F E+ P  + + G AWLFLGVAN+D+LLYD+E+   L  +PDNF
Sbjct  191  ATGTGIAPYRSFIRRLFTETTPAGEAYKGTAWLFLGVANSDALLYDEEWQATLAKYPDNF  250

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            + D  LSREQ N  GGKMY+QDK+EEY+DEIF  L +GA +YFCGLKGMMPGIQD LK V
Sbjct  251  KLDYALSREQSNSKGGKMYIQDKVEEYADEIFDRLGKGAVMYFCGLKGMMPGIQDMLKSV  310

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
             +++GL ++  +  LKK  QW VEVY
Sbjct  311  CDKKGLDYDEYIKDLKKKGQWRVEVY  336



>ref|XP_009035092.1| hypothetical protein AURANDRAFT_23206 [Aureococcus anophagefferens]
 gb|EGB10278.1| hypothetical protein AURANDRAFT_23206 [Aureococcus anophagefferens]
Length=342

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 161/206 (78%), Gaps = 1/206 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+DPE GK+D +K GVC NF+CDS PGD +++TGPSGK+ML+PE+  +  +IM+
Sbjct  137  CVRRATYWDPEMGKDDPAKKGVCSNFICDSKPGDPIKMTGPSGKVMLMPEEKADTDYIMV  196

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+R ++RR+F E+ P  + + G AWLFLGVAN+D+LLYD+E+   L  +PDNF
Sbjct  197  ATGTGIAPYRSFIRRLFTETTPAGEAYKGTAWLFLGVANSDALLYDEEWQATLAKYPDNF  256

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            + D  LSREQ N  GGKMY+QDK+EEY+DEIF  L +GA +YFCGLKGMMPGIQD LK V
Sbjct  257  KLDYALSREQTNTKGGKMYIQDKVEEYADEIFDRLGKGAVMYFCGLKGMMPGIQDMLKGV  316

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
             +++GL ++  +  LKK  QW VEVY
Sbjct  317  CDKKGLDYDEYIKGLKKAGQWRVEVY  342



>ref|XP_003064407.1| ferredoxin-NADP oxidoreductase [Micromonas pusilla CCMP1545]
 gb|EEH51312.1| ferredoxin-NADP oxidoreductase [Micromonas pusilla CCMP1545]
Length=383

 Score =   276 bits (706),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 159/205 (78%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+D E   ED +K G+C NFLCD+ PG +V +TGP+G++MLLPED P    IM+
Sbjct  180  CVRRATYWDSEKNAEDPAKKGICSNFLCDAKPGAEVMMTGPTGQVMLLPED-PATPVIMV  238

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP R Y+RR F+E V  ++F GLAWLF+GVAN+D+ LYDDEF++ ++ FP  FR
Sbjct  239  ATGTGIAPMRSYIRRFFVEDVKNWEFKGLAWLFMGVANSDAKLYDDEFSECIKRFPGQFR  298

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSRE +N+ GGKMY+QDK+EEY D++F+LLD GAH+YFCGLKGMMPGI + L+ V 
Sbjct  299  VDYALSRESQNRKGGKMYIQDKVEEYKDQVFQLLDGGAHMYFCGLKGMMPGILEMLEGVC  358

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+G+ +E  L  LKK  QWHVEVY
Sbjct  359  KEKGIDYEEWLEGLKKKGQWHVEVY  383



>emb|CDY51794.1| BnaC03g75370D [Brassica napus]
Length=242

 Score =   270 bits (689),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLCDS PGDK+QITGPSGK+MLLPE++PN THIMI
Sbjct  88   CVRRAVYYDPETGKEDPSKNGVCSNFLCDSKPGDKIQITGPSGKVMLLPENDPNVTHIMI  147

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAP+RGYLRRMFME++P +KF GL WLF+GVANTD LLYDDEF KYL+D PDNFR
Sbjct  148  ATGTGVAPYRGYLRRMFMENLPNYKFGGLDWLFVGVANTDILLYDDEFNKYLKDHPDNFR  207

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYS  324
            +D+ LSREQKNK GGKMYVQDKIEEYS
Sbjct  208  FDKALSREQKNKKGGKMYVQDKIEEYS  234



>ref|XP_002500720.1| ferredoxin-NADP oxidoreductase chloroplast precursor [Micromonas 
sp. RCC299]
 gb|ACO61978.1| ferredoxin-NADP oxidoreductase chloroplast precursor [Micromonas 
sp. RCC299]
Length=368

 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/205 (60%), Positives = 159/205 (78%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+ PE   ED +K G+C NFLCD+ PG +V +TGP+G++MLLP+D P    IM+
Sbjct  165  CVRRATYWCPEMKAEDPAKKGICSNFLCDAKPGQEVMMTGPTGQVMLLPKD-PATPVIMV  223

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP R Y RR F+E V +++F GLAWLF+GVAN+D+ LYDDE  + ++ FP  FR
Sbjct  224  ATGTGIAPMRSYYRRFFVEDVKSWEFKGLAWLFMGVANSDAKLYDDEIQECIKRFPGQFR  283

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQ NKNGGKMY+QDK+EEY D+IF+LLD GAH+YFCGLKGMMPGI + L+ V 
Sbjct  284  CDYALSREQTNKNGGKMYIQDKVEEYKDQIFQLLDGGAHMYFCGLKGMMPGILEMLEGVC  343

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
            +E+G+++E  L  LK+  QWHVEVY
Sbjct  344  KEKGINYEEWLEGLKEKGQWHVEVY  368



>ref|XP_011400423.1| Ferredoxin-NADP reductase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM27456.1| Ferredoxin-NADP reductase, chloroplastic [Auxenochlorella protothecoides]
Length=293

 Score =   268 bits (685),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 150/205 (73%), Gaps = 1/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+D E G ED +K G+C NFLCD+ PG +V +TGP+GKI+LLPED      IM+
Sbjct  90   CVRRATYWDEEKGAEDPAKKGICSNFLCDAKPGTEVTMTGPTGKILLLPEDQKTPV-IMV  148

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+AP+R + RR F+E VP + F GLAWLF+G AN+D+ LYD+E     +  PD FR
Sbjct  149  ATGTGIAPYRAFWRRFFIEDVPGYNFEGLAWLFMGAANSDATLYDEEIQALAKAHPDQFR  208

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
             D  LSREQKN  GGKMY+QDKIEEY+DE+F LL  GAHIYFCGLKGM+PGI + L+RVA
Sbjct  209  VDYALSREQKNSKGGKMYIQDKIEEYADEVFDLLSSGAHIYFCGLKGMLPGILEMLERVA  268

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
              +G+ W     +LK   Q H+EVY
Sbjct  269  GTKGIDWPDFQQKLKHAGQLHIEVY  293



>emb|CBN78345.1| ferredoxin-NADP oxidoreductase [Ectocarpus siliculosus]
Length=414

 Score =   272 bits (695),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y+D E GKED +K GVC N+LCD+ PG K+++TGPSGK+ML+PED P    IMI
Sbjct  180  CVRRATYWDEEMGKEDPAKKGVCSNYLCDAEPGAKLKLTGPSGKVMLMPEDKPETDLIMI  239

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK-FNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+AP+R ++RR+F E+ P  + + G AWLFLGVAN+D+LLYD E+ + L++FPDNF
Sbjct  240  ATGTGIAPYRSFVRRLFAEATPAKEAYKGQAWLFLGVANSDALLYDAEWQQVLKEFPDNF  299

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ+NK+GGKMY+QDK+EEY DE+F+ L +GAHIYFCGLKGMMPGI + L++V
Sbjct  300  RLDYALSREQENKSGGKMYIQDKVEEYGDEVFQKLSKGAHIYFCGLKGMMPGILNMLEKV  359

Query  227  AEERGLSWET  198
            A ++ ++WET
Sbjct  360  ATKKKMNWET  369



>ref|XP_002974410.1| hypothetical protein SELMODRAFT_101002 [Selaginella moellendorffii]
 gb|EFJ24632.1| hypothetical protein SELMODRAFT_101002 [Selaginella moellendorffii]
Length=304

 Score =   267 bits (683),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 154/205 (75%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+RA+Y DP+TG+ED SK GVC NFLCD  PGDKV + GP GK+MLL E NP+ +HIM+
Sbjct  100  CVKRAIYVDPQTGEEDPSKKGVCSNFLCDCKPGDKVDLVGPFGKLMLLNESNPSDSHIMV  159

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRG+L+R+  + + + KF G AWLF+G      LLY++EF +Y +D P +FR
Sbjct  160  ATGTGVAPFRGFLQRLLEDKMGSRKFEGSAWLFMGAPTAGRLLYNEEFERYARDRPLSFR  219

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSRE  NK GG+ YVQD++EE+ +EIFKLLD G+HIYFCG K M+ G++   + VA
Sbjct  220  YDTALSRESCNKRGGRFYVQDRMEEHGEEIFKLLDGGSHIYFCGRKDMLVGVEAVFEEVA  279

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
               G  W  KL++LKKN+QWHVEVY
Sbjct  280  RRMGEDWRGKLAKLKKNRQWHVEVY  304



>ref|XP_002985709.1| hypothetical protein SELMODRAFT_122698 [Selaginella moellendorffii]
 gb|EFJ13287.1| hypothetical protein SELMODRAFT_122698 [Selaginella moellendorffii]
Length=304

 Score =   266 bits (681),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 120/205 (59%), Positives = 153/205 (75%), Gaps = 0/205 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+RA+Y DP+TG+ED SK GVC NFLCD  PGDKV + GP GK+MLL E NP+ +HIM+
Sbjct  100  CVKRAIYVDPQTGEEDPSKKGVCSNFLCDCKPGDKVDLVGPFGKLMLLNESNPSDSHIMV  159

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRG+L+R+  + +   KF G AWLF+G      LLY++EF +Y +D P +FR
Sbjct  160  ATGTGVAPFRGFLQRLLEDKMRPRKFEGSAWLFMGAPTAGRLLYNEEFERYARDLPWSFR  219

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSRE  NK GG+ YVQD++EE+ +EIFKLLD G+HIYFCG K M+ G++   + VA
Sbjct  220  YDTALSRESCNKRGGRFYVQDRMEEHGEEIFKLLDGGSHIYFCGRKDMLVGVEAVFEEVA  279

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
               G  W  KL++LKKN+QWHVEVY
Sbjct  280  RRMGEDWRGKLAKLKKNRQWHVEVY  304



>ref|XP_005848997.1| hypothetical protein CHLNCDRAFT_35035 [Chlorella variabilis]
 gb|EFN56895.1| hypothetical protein CHLNCDRAFT_35035 [Chlorella variabilis]
Length=358

 Score =   254 bits (650),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 122/211 (58%), Positives = 151/211 (72%), Gaps = 7/211 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY+DPE GKED +K G+C NFLCD+ PG ++ +TGP+GK++LLPED PNA  I +
Sbjct  149  CVRRAVYWDPEMGKEDPAKKGICSNFLCDAKPGQEITMTGPTGKVLLLPED-PNAVVICV  207

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWL-----FLGV-ANTDSLLYDDEFAKYLQD  423
            ATGTG+APFR + RRMFME++P +KF G   L     F  +       LYD+E A     
Sbjct  208  ATGTGIAPFRTFWRRMFMENIPGYKFTGAGPLARRRGFRALRGGGGPRLYDEEMAACAAA  267

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQD  243
            +PD FR D  LSREQ+N  GGKMY+QDK+EEYSDE+F LL+ GAHIYFCGLKGMMPGI +
Sbjct  268  YPDQFRLDYALSREQQNVRGGKMYIQDKVEEYSDEVFDLLNNGAHIYFCGLKGMMPGILE  327

Query  242  TLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             L+RVA  +GL++      LK   Q HVEVY
Sbjct  328  MLERVATGKGLNYAEWFEGLKHKNQVHVEVY  358



>ref|XP_005789289.1| hypothetical protein EMIHUDRAFT_42969, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD36860.1| hypothetical protein EMIHUDRAFT_42969, partial [Emiliania huxleyi 
CCMP1516]
Length=320

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 121/227 (53%), Positives = 153/227 (67%), Gaps = 22/227 (10%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFL---------------CDSNPGDKVQITGPSGKI  630
            CVRRA+Y+D +TG  D +K GVC NFL               CDS+PGD+V +TGP+GK+
Sbjct  94   CVRRALYWDADTGAHDPAKKGVCSNFLRARAGRARRGRVHDTCDSSPGDEVHLTGPTGKV  153

Query  629  MLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTF-KFNGLAWLFLGVANTDSLLY  453
            ML+PE  P    IM+ATGTG+AP+RG+LRR+F+E  P    F GLAWLFLGVAN D+LLY
Sbjct  154  MLMPEHEPATDLIMLATGTGIAPYRGFLRRLFLEPTPAADAFRGLAWLFLGVANRDALLY  213

Query  452  DDEFAKYLQD------FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGA  291
            DDE+   LQ            R D    R      GGKMY+QDK+ +++DE+F+ +D GA
Sbjct  214  DDEWQAILQRETARGRSAAQGREDGARRRSATRPVGGKMYIQDKVAQHADEVFERMDNGA  273

Query  290  HIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            H+YFCGLKGMMPGI + L+ V +E+GL WE KLS+ KK  QWHVEVY
Sbjct  274  HMYFCGLKGMMPGITEMLEGVCKEKGLVWEDKLSEWKKAGQWHVEVY  320



>ref|XP_002977684.1| hypothetical protein SELMODRAFT_107413 [Selaginella moellendorffii]
 gb|EFJ21022.1| hypothetical protein SELMODRAFT_107413 [Selaginella moellendorffii]
Length=303

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 150/205 (73%), Gaps = 6/205 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R V YDP     + +  G+C NFLCD+ PGD+V+I GP G  +LL E+NP    IM+
Sbjct  105  CVKRIVSYDPN--DPNSTIPGICSNFLCDARPGDQVRIVGPFGSSLLLNEENPRGAQIMV  162

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRG+LRRMF+E VP FKF+GLAWLFLGVA++ SLLY DEF +  +DFP +FR
Sbjct  163  GTGTGVAPFRGFLRRMFVEEVP-FKFDGLAWLFLGVASSKSLLYHDEFERIARDFPSSFR  221

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSRE  +++GGK YVQ +I+E   E+ +LL+ G HIYFCG + MM GIQ+T +++ 
Sbjct  222  YDLALSREMVDRSGGKFYVQHRIKERGKEVLELLESGGHIYFCGREEMMEGIQETFRKLC  281

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
               G SW  KLS  K+NKQWHV+VY
Sbjct  282  ---GDSWHEKLSGWKRNKQWHVDVY  303



>ref|XP_002979592.1| hypothetical protein SELMODRAFT_419219 [Selaginella moellendorffii]
 gb|EFJ19481.1| hypothetical protein SELMODRAFT_419219 [Selaginella moellendorffii]
Length=303

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 117/205 (57%), Positives = 150/205 (73%), Gaps = 6/205 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R V YDP     + +  G+C NFLCD+ PGD+V+I GP G  +LL E+NP    IM+
Sbjct  105  CVKRIVSYDPN--DPNSTIPGICSNFLCDARPGDQVRIVGPFGSSLLLNEENPRGAQIMV  162

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTGVAPFRG+LRRMF+E VP FKF+GLAWLFLGVA++ SLLY DEF +  +DFP +FR
Sbjct  163  GTGTGVAPFRGFLRRMFVEEVP-FKFDGLAWLFLGVASSKSLLYHDEFERIARDFPSSFR  221

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVA  225
            YD  LSRE  +++GGK YVQ +I+E   E+ +LL+ G HIYFCG + MM GIQ+T +++ 
Sbjct  222  YDLALSREMVDRSGGKFYVQHRIKERGKEVLELLESGGHIYFCGREEMMEGIQETFRKLC  281

Query  224  EERGLSWETKLSQLKKNKQWHVEVY  150
               G SW  KLS  K+NKQWHV+VY
Sbjct  282  ---GDSWHEKLSGWKRNKQWHVDVY  303



>ref|XP_002291633.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED91740.1| predicted protein, partial [Thalassiosira pseudonana CCMP1335]
Length=294

 Score =   239 bits (609),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 147/208 (71%), Gaps = 4/208 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA + DP TG++D  K GVC NFLC+ NPGD V + GP GK MLLPED P    IM+
Sbjct  88   CVRRAEFIDPVTGEKDPEKQGVCSNFLCNVNPGDTVSVAGPVGKTMLLPED-PTKDVIMV  146

Query  584  ATGTGVAPFRGYLRRMFME-SVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDF-PDN  411
            ATGTG+APFRG++ R+FME ++    F G AWL LGV  +  LLY +EF   L++  P+ 
Sbjct  147  ATGTGIAPFRGFMHRLFMENTLARHMFGGSAWLVLGVPVSGGLLYKEEFDCMLRNASPNQ  206

Query  410  FRYDRVLSREQKNK-NGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLK  234
             R D  +SRE  N  +GGK+YVQ  I +   E+F  LD GAHIYFCGLKGM+PGI ++L+
Sbjct  207  LRIDYAISREMTNTIDGGKLYVQHVIAQNGKELFNRLDNGAHIYFCGLKGMLPGILESLE  266

Query  233  RVAEERGLSWETKLSQLKKNKQWHVEVY  150
             VA+E+G+ W  KLS+LKKN QWHVEVY
Sbjct  267  GVAKEQGVDWTAKLSELKKNNQWHVEVY  294



>gb|KDD75893.1| hypothetical protein H632_c449p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=327

 Score =   239 bits (611),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 152/206 (74%), Gaps = 2/206 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            C+RRA ++DPE G+ED  K G+C NFLCD+ PG ++ ++GP+GK++L+P D+P+A  I +
Sbjct  123  CIRRATFWDPELGREDPEKKGICSNFLCDAAPGTEIDLSGPTGKLLLMP-DDPHADVITV  181

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFN-GLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTG+APFR + RR F E+VP+ +   G  WLF+GVAN+D+ LY  E     Q  P  F
Sbjct  182  ATGTGIAPFRAFWRRRFFEAVPSEQGGRGHMWLFMGVANSDAKLYASEIEAVEQAHPTRF  241

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
            R D  LSREQ N +GGKMYVQD++E+++DE+F  L  GAHIYFCGLKGM+PGI +TL+RV
Sbjct  242  RVDYALSREQTNASGGKMYVQDRLEQHADEVFDRLSAGAHIYFCGLKGMLPGILETLERV  301

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A E+G+ W   L  LKK  +WHVEVY
Sbjct  302  AGEKGIDWPAFLEGLKKEHRWHVEVY  327



>gb|EJK44714.1| hypothetical protein THAOC_36724 [Thalassiosira oceanica]
Length=395

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 143/207 (69%), Gaps = 3/207 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRA Y DP TG++D +K GVC NFLCD   GD+V + GP GK MLLP+D+ N   IMI
Sbjct  190  CVRRAEYVDPVTGEKDPAKQGVCSNFLCDVRAGDEVSVAGPVGKTMLLPKDS-NTDIIMI  248

Query  584  ATGTGVAPFRGYLRRMFME-SVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDF-PDN  411
            ATGTG+APFRG++ R+FME ++    F G AWL LGV  T  LLY +EF    ++   D 
Sbjct  249  ATGTGIAPFRGFMHRLFMENTLARHMFGGRAWLVLGVPVTGGLLYKEEFDCMQRNAGADQ  308

Query  410  FRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKR  231
             R D  +SRE   K GGKMYVQ+ I E   E+F  LD GA IYFCGLKGMMPGI D+L+ 
Sbjct  309  LRIDYAISREMTAKTGGKMYVQNVIAENGREVFDRLDNGAVIYFCGLKGMMPGILDSLEE  368

Query  230  VAEERGLSWETKLSQLKKNKQWHVEVY  150
            VA  +G+ W  KL++LKKN QWHVEVY
Sbjct  369  VAASQGIVWSEKLAELKKNHQWHVEVY  395



>ref|XP_009034033.1| hypothetical protein AURANDRAFT_52453 [Aureococcus anophagefferens]
 gb|EGB11690.1| hypothetical protein AURANDRAFT_52453 [Aureococcus anophagefferens]
Length=418

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 148/206 (72%), Gaps = 2/206 (1%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVY DPETG+ED +K G+C NFLCD +PGD V +TGP GK +LLPE +P+A  IM+
Sbjct  214  CVRRAVYVDPETGEEDPAKKGICSNFLCDGSPGDVVALTGPVGKGLLLPE-SPDADVIMV  272

Query  584  ATGTGVAPFRGYLRRMFMESVPTF-KFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNF  408
            ATGTGVAP+RG+++R+F E  P    F G AWLF G   +DS+LY + +       PD F
Sbjct  273  ATGTGVAPYRGFVKRLFDEQTPANDAFTGRAWLFFGGPTSDSILYPELWDAAKASKPDQF  332

Query  407  RYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRV  228
                 +SREQ N++GG+MYVQ +I E++DEIF  LD GAH Y CGLKGM PGI+  L+ V
Sbjct  333  DLTLAISREQTNEDGGRMYVQHRIVEHADEIFDRLDNGAHFYLCGLKGMQPGIEAALEEV  392

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
             +++GL ++  +  LKK+K++HVEVY
Sbjct  393  CDKKGLVFKDWVKALKKDKRYHVEVY  418



>ref|XP_002183949.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44618.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=299

 Score =   227 bits (579),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 115/217 (53%), Positives = 145/217 (67%), Gaps = 12/217 (6%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPE----DNPNAT  597
            CVRRA Y DP+T K D +K GVC NFLCD  PG  VQ+ GP GK MLLP+    +N  A 
Sbjct  83   CVRRAEYVDPQTRKVDPTKAGVCSNFLCDMVPGTIVQVAGPVGKTMLLPDIGNSNNEKAN  142

Query  596  H---IMIATGTGVAPFRGYLRRMFME-SVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYL  429
                IM+ATGTG+APFR +LRR+F+E +V    + G AWL LGV+ T  LLY DEF +  
Sbjct  143  QQDIIMVATGTGIAPFRAFLRRLFLENTVAKQMYQGQAWLILGVSVTGGLLYADEFERMQ  202

Query  428  Q----DFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGLKGM  261
            Q    ++P   R D  +SRE KN+ GGK+YVQD + E ++ ++  L++GA IYFCGLKGM
Sbjct  203  QPSNTNWPGQLRVDYAISREMKNQQGGKLYVQDVLSEEAEMLWTKLEDGAIIYFCGLKGM  262

Query  260  MPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            MPGI + L+ VA+ RG  W   L +LK N QWHVEVY
Sbjct  263  MPGILEALEDVAKARGKVWSQTLRRLKANGQWHVEVY  299



>gb|ABF99221.1| Ferredoxin-NADP reductase, root isozyme, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=304

 Score =   225 bits (574),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/120 (84%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRRAVYYDPETGKED SKNGVC NFLC+S PGDKV++TGPSGKIMLLPE++PNATHIMI
Sbjct  174  CVRRAVYYDPETGKEDPSKNGVCSNFLCNSKPGDKVKVTGPSGKIMLLPEEDPNATHIMI  233

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTGVAPFRGYLRRMFME VP ++F GLAWLFLGVANTDSLLYD+EF  YL+ +PDNFR
Sbjct  234  ATGTGVAPFRGYLRRMFMEDVPKYRFGGLAWLFLGVANTDSLLYDEEFTSYLKQYPDNFR  293



>ref|WP_035831811.1| ferredoxin-NADP reductase [Cyanobium sp. CACIAM 14]
 gb|KEF41796.1| ferredoxin-NADP reductase [Cyanobium sp. CACIAM 14]
Length=391

 Score =   228 bits (580),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 142/210 (68%), Gaps = 11/210 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  FLCD  PG KV+ITGP GK MLLP +  +A  IM+
Sbjct  188  CVRQLQYE-----KDGVTINGVCSTFLCDIEPGAKVKITGPVGKEMLLPPEE-DANIIML  241

Query  584  ATGTGVAPFRGYLRRMF----MESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFP  417
            ATGTG+AP R YLRRMF     E  P ++F G AWLF+GV  T +LLY+D+F +YL  +P
Sbjct  242  ATGTGIAPMRAYLRRMFEPAEREKNPEYQFRGKAWLFMGVPKTANLLYEDDFQRYLSKYP  301

Query  416  DNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDT  240
            D+FRY + +SREQ+N +GG+MY+QD++ E++DEIF L+ D   H+Y CGL+GM PGI + 
Sbjct  302  DHFRYTKAISREQQNPSGGRMYIQDRVTEHADEIFSLIEDPKTHVYMCGLRGMEPGIDEA  361

Query  239  LKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            +   A  +GL W     QLKK  +WHVE Y
Sbjct  362  MTTAAAAKGLDWSELRPQLKKADRWHVETY  391



>ref|WP_006170829.1| ferredoxin--NADP reductase [Synechococcus sp. WH 5701]
 gb|EAQ74003.1| ferredoxin--NADP reductase (FNR) [Synechococcus sp. WH 5701]
Length=385

 Score =   226 bits (576),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 141/210 (67%), Gaps = 11/210 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  FLCD  PG KV+ITGP GK MLLP D  +A  IM+
Sbjct  182  CVRQLQYE-----KDGETINGVCSTFLCDIEPGAKVKITGPVGKEMLLPPDE-DANVIML  235

Query  584  ATGTGVAPFRGYLRRMF----MESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFP  417
            ATGTG+AP R YLRRMF        P ++F G AWL +GV  T +LLY+++   YL +FP
Sbjct  236  ATGTGIAPMRAYLRRMFDPGERAKNPGYQFRGKAWLIMGVPTTPNLLYEEDLQGYLAEFP  295

Query  416  DNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDT  240
            DNFRY + +SREQ+N +GG+MY+QD++ E+ DEIF ++ D   H+Y CGL+GM PGI + 
Sbjct  296  DNFRYTKAISREQQNPSGGRMYIQDRVAEHGDEIFTMIEDSKTHVYMCGLRGMEPGIDEA  355

Query  239  LKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + AE +GL+W     QLKK  +WHVE Y
Sbjct  356  MSKAAESKGLNWSELRPQLKKADRWHVETY  385



>gb|ABO17805.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9301]
Length=321

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 145/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  +A  +M+
Sbjct  119  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DANIVML  172

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  173  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLSD  229

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
            +PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  230  YPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  289

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  290  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  321



>ref|WP_036920327.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=333

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 145/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGD+V+ITGP GK MLLPED  +A  +M+
Sbjct  131  CVRQLQYE-----KDGQTINGVCSTYLCDIKPGDQVKITGPVGKEMLLPEDE-DANIVML  184

Query  584  ATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  S      + F G AWLF+G   + +LLY+++  +YLQ++PD
Sbjct  185  ATGTGIAPMRAYLRRMFEPSEREKNNWNFKGKAWLFMGAPKSANLLYEEDLQRYLQNYPD  244

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  245  NFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  304

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     QL+K  +WHVE Y
Sbjct  305  TKAAEEKGLNWAELRPQLRKAGRWHVETY  333



>ref|WP_008191760.1| FAD/NAD-binding oxidoreductase, partial [Moorea producens]
 gb|EGJ28514.1| FAD/NAD-binding oxidoreductase [Moorea producens 3L]
Length=297

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y  PETG+   + NGVC  FLC+ NPGD V+ITGP GK MLLP D PNA  IM+
Sbjct  96   CVRQLQYKHPETGE---TVNGVCSTFLCNMNPGDDVKITGPVGKEMLLPSD-PNANIIMM  151

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L RMF E    +KF GLAWL  G++ T ++LY D+  +  Q+ PDNFR
Sbjct  152  ATGTGIAPFRAFLWRMFKEQHEDYKFKGLAWLIFGISTTPNILYKDDLEEMQQNNPDNFR  211

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTLKRV  228
                +SREQKN  GGKMY+Q ++ E++DE++KL+ +   H Y CGLKGM  GI + L   
Sbjct  212  LTYAISREQKNSEGGKMYIQHRVAEHADELWKLMQQPNTHTYICGLKGMEGGIDEALTAA  271

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A +  + W T   Q+KK  +WHVE Y
Sbjct  272  AAKEDVDWTTYRQQMKKAHRWHVETY  297



>ref|WP_043326144.1| ferredoxin-NADP reductase [Cyanobium gracile]
Length=390

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 142/210 (68%), Gaps = 11/210 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  FLCD  PG KV+ITGP GK MLLP D  +A  IM+
Sbjct  187  CVRQLQYE-----KDGSTINGVCSTFLCDIEPGAKVKITGPVGKEMLLPPDE-DANIIML  240

Query  584  ATGTGVAPFRGYLRRMFMESV----PTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFP  417
            ATGTG+AP R YLRRMF  S     P ++F G AWL +GV  T +LLY+D+F +YL ++P
Sbjct  241  ATGTGIAPMRAYLRRMFEPSERAKNPEYQFRGKAWLIMGVPKTPNLLYEDDFQRYLTEYP  300

Query  416  DNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDT  240
            +NFRY + +SREQ+N +GG+MY+QD++ E++DEIF L+ D   H+Y CGL+GM PGI + 
Sbjct  301  ENFRYTKAISREQQNPSGGRMYIQDRVTEHADEIFSLIEDPKTHVYMCGLRGMEPGIDEA  360

Query  239  LKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            +   A  +GL W     QLKK  +WHVE Y
Sbjct  361  MTAAAAAKGLDWSELRPQLKKADRWHVETY  390



>ref|WP_025930500.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_528O2]
Length=375

 Score =   224 bits (572),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  ++  +M+
Sbjct  173  CVRQLQY-----EKDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDSNIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL D+PD
Sbjct  227  ATGTGIAPMRAYLRRMFESTEKEKNNWNFKGKAWLFMGAPKSANLLYEEDLQRYLNDYPD  286

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N NGG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  287  NFKYTKAISREQQNTNGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  346

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     QLKK  +WHVE Y
Sbjct  347  TKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_041484700.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=370

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 145/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  +A  +M+
Sbjct  168  CVRQLQY-----EKDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DANIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLSD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
            +PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  YPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>gb|AFY27502.1| Oxidoreductase NAD-binding domain/CpcD/allophycocyanin linker 
domain protein [Cyanobium gracile PCC 6307]
Length=401

 Score =   225 bits (574),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 142/210 (68%), Gaps = 11/210 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  FLCD  PG KV+ITGP GK MLLP D  +A  IM+
Sbjct  198  CVRQLQYE-----KDGSTINGVCSTFLCDIEPGAKVKITGPVGKEMLLPPDE-DANIIML  251

Query  584  ATGTGVAPFRGYLRRMFMESV----PTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFP  417
            ATGTG+AP R YLRRMF  S     P ++F G AWL +GV  T +LLY+D+F +YL ++P
Sbjct  252  ATGTGIAPMRAYLRRMFEPSERAKNPEYQFRGKAWLIMGVPKTPNLLYEDDFQRYLTEYP  311

Query  416  DNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDT  240
            +NFRY + +SREQ+N +GG+MY+QD++ E++DEIF L+ D   H+Y CGL+GM PGI + 
Sbjct  312  ENFRYTKAISREQQNPSGGRMYIQDRVTEHADEIFSLIEDPKTHVYMCGLRGMEPGIDEA  371

Query  239  LKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            +   A  +GL W     QLKK  +WHVE Y
Sbjct  372  MTAAAAAKGLDWSELRPQLKKADRWHVETY  401



>ref|WP_036896868.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=365

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPED  +A  +M+
Sbjct  163  CVRQLQYE-----KDGQTINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEDE-DANIVML  216

Query  584  ATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  S      + F G AWLF+G   + +LLY+++  +YL ++PD
Sbjct  217  ATGTGIAPMRAYLRRMFEPSEREKNNWNFKGKAWLFMGAPKSANLLYEEDLQRYLANYPD  276

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  277  NFKYTKAISREQQNAKGGRMYIQDRVTESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  336

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + A+E+GL+W     QL+K  +WHVE Y
Sbjct  337  TKAAQEKGLNWAELRPQLRKAGRWHVETY  365



>ref|WP_032527499.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF96481.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9302]
Length=369

 Score =   224 bits (570),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  FLCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  167  CVRQLQYE-----KDGETINGVCSTFLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  220

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL D+PD
Sbjct  221  ATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLTDYPD  280

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  281  NFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  340

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     QLKK  +WHVE Y
Sbjct  341  TKAAEEKGLNWSELRPQLKKAGRWHVETY  369



>ref|XP_010910721.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like, 
partial [Elaeis guineensis]
Length=182

 Score =   217 bits (553),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 107/160 (67%), Positives = 127/160 (79%), Gaps = 3/160 (2%)
 Frame = -1

Query  629  MLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYD  450
            MLL ED+PNATHIMIATGT +A   GYLRRMFME+VP  KF GLAWLFLG+ + D+LLYD
Sbjct  1    MLLLEDDPNATHIMIATGTEIA---GYLRRMFMEAVPMNKFGGLAWLFLGLTSIDNLLYD  57

Query  449  DEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDEGAHIYFCGL  270
            DEF  YL++ PD  +       EQ+NK+G KMYVQDKIEEYSD+IF+ LDEG  IYFC L
Sbjct  58   DEFTSYLRNHPDKHQVQEFPILEQRNKSGRKMYVQDKIEEYSDKIFRFLDEGVFIYFCRL  117

Query  269  KGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            KG+M GIQDT +RVA +RG +W+ KLSQL+KNKQW+VE Y
Sbjct  118  KGVMLGIQDTPERVAVQRGENWDEKLSQLRKNKQWYVEFY  157



>ref|WP_002806441.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|EEE40085.1| ferredoxin--NADP reductase [Prochlorococcus marinus str. MIT 
9202]
Length=394

 Score =   224 bits (570),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  +A  +M+
Sbjct  192  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DANIVML  245

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL DFPD
Sbjct  246  ATGTGIAPMRAYLRRMFEATEKEKNNWNFKGKAWLFMGAPKSANLLYEEDLQRYLSDFPD  305

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  306  NFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  365

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + A+E+GL+W     QLKK  +WHVE Y
Sbjct  366  TKAAQEKGLNWSDLRPQLKKAGRWHVETY  394



>ref|WP_011825598.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABM77692.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9303]
Length=366

 Score =   223 bits (567),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 141/209 (67%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y       +  + NGVC ++LCD NPG K +ITGP GK MLLP+D   A  IM+
Sbjct  164  CVRQLQYE-----LDGKTINGVCSSYLCDINPGAKTKITGPVGKEMLLPDDE-EANVIML  217

Query  584  ATGTGVAPFRGYLRRMFM---ESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF     S   +KF G AWLF+G   T +LLYDD+F +YL++FPD
Sbjct  218  ATGTGIAPMRAYLRRMFEPTERSKNGWKFRGKAWLFMGAPYTANLLYDDDFERYLREFPD  277

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTL  237
            NF Y + +SREQ+N  GG+MY+QD++ EYSD+IFK+++    H+Y CGLKGM PGI + +
Sbjct  278  NFIYTKAISREQQNSKGGRMYIQDRVMEYSDQIFKMIENPKTHVYMCGLKGMEPGIDEAM  337

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
               A  +G+ W     QLKK  +WHVE Y
Sbjct  338  TAAATAKGIDWSELRPQLKKAHRWHVETY  366



>ref|WP_010317887.1| ferredoxin--NADP reductase [Synechococcus sp. CB0205]
Length=391

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/209 (52%), Positives = 140/209 (67%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  FLCD  PG KV+ITGP GK MLLPED   A  IM+
Sbjct  189  CVRQLQYE-----KDGETINGVCSTFLCDIEPGAKVKITGPVGKEMLLPEDE-EANIIML  242

Query  584  ATGTGVAPFRGYLRRMFMESVPT---FKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   T +LLYDD+F +Y ++FP+
Sbjct  243  ATGTGIAPMRTYLRRMFEPAEREKNGWNFRGKAWLFMGAPTTANLLYDDDFNRYEREFPE  302

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NFRY + +SREQKN NGG+MY+QD++ E +DEIF ++ D   H+Y CGL+GM PGI + +
Sbjct  303  NFRYTKAISREQKNANGGRMYIQDRVSENADEIFAMIEDPKTHVYMCGLRGMEPGIDEAM  362

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
               A  +GL W     +LKK ++WHVE Y
Sbjct  363  TTAAAAKGLDWSELRPKLKKAERWHVETY  391



>ref|WP_032524602.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF87384.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. GP2]
Length=380

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  178  CVRQLQY-----EKDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  231

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL D+PD
Sbjct  232  ATGTGIAPMRAYLRRMFEATEKEKNNWNFKGKAWLFMGAPKSANLLYEEDLQRYLVDYPD  291

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  292  NFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  351

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     QLKK  +WHVE Y
Sbjct  352  TKAAEEKGLNWSELRPQLKKAGRWHVETY  380



>ref|WP_025965632.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_496M6]
Length=369

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  +A  +M+
Sbjct  167  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DANIVML  220

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  221  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLSD  277

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  278  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  337

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  338  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  369



>ref|XP_010536399.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=255

 Score =   218 bits (555),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 140/206 (68%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R VY    T ++     GVC NFLCD  PG  V+ITGP GK ML+P+D PNAT IM+
Sbjct  55   CVKRLVY----TNEQGEIVKGVCSNFLCDLKPGADVKITGPLGKEMLMPKD-PNATVIML  109

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L +MF E    ++FNGLAWLFLGV  T SLLY +EF K     P+NFR
Sbjct  110  ATGTGIAPFRSFLWKMFFEKHSDYEFNGLAWLFLGVPTTSSLLYQEEFDKMKAKAPENFR  169

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N+ G KMY+Q ++ EY+DE+++LL  +  +IY CGLKGM  GI D +  +
Sbjct  170  VDYAISREQTNEKGEKMYIQTRMAEYADELWELLKKDNTYIYMCGLKGMEKGIDDIMVSL  229

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A   G+ W     Q+KK +QW+VEVY
Sbjct  230  AARDGIDWIEYKKQMKKAEQWNVEVY  255



>gb|ABV50826.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9215]
Length=368

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  166  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  219

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL D+PD
Sbjct  220  ATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLSDYPD  279

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  280  NFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  339

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + A+E+GL+W     QLKK  +WHVE Y
Sbjct  340  TKAAQEKGLNWSDLRPQLKKAGRWHVETY  368



>ref|WP_011376636.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABB50145.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9312]
 gb|KGG01997.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9311]
Length=370

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 142/209 (68%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL D+PD
Sbjct  222  ATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLTDYPD  281

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  282  NFTYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  341

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     QLKK  +WHVE Y
Sbjct  342  TKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025972231.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527L22]
Length=375

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLAD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMSKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_032516697.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGG05909.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9322]
 gb|KGG05978.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9321]
 gb|KGG11008.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9401]
Length=390

 Score =   222 bits (565),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  188  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  241

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  242  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLTD  298

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  299  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  358

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  359  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  390



>ref|WP_025933682.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_498A3]
Length=375

 Score =   221 bits (564),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLAD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMSKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_032515058.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGG03418.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9314]
Length=375

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLAD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025914731.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_520K10]
Length=375

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQY-----EKDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNNWNFKGKAWLFMGAPKSANLLYEEDLQRYLTD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
            +PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ D   HIY CGLKGM PGI 
Sbjct  284  YPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDNKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025888618.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_526B17]
Length=370

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 145/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK+ +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKSGRWHVETY  370



>ref|WP_025934437.1| ferredoxin-NADP reductase, partial [Prochlorococcus sp. scB243_498J20]
Length=314

 Score =   219 bits (558),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  112  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  165

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  166  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  222

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  223  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  282

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  283  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  314



>ref|YP_002049405.1| ferredoxin--NADP reductase (FNR) [Paulinella chromatophora]
 gb|ACB43195.1| ferredoxin--NADP reductase (FNR) [Paulinella chromatophora]
Length=381

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 139/210 (66%), Gaps = 11/210 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  FLCD  PG K ++TGP GK MLLP D   A  IM+
Sbjct  178  CVRQLQYE-----KDGETINGVCSTFLCDIKPGAKTKMTGPVGKEMLLPADE-MANVIML  231

Query  584  ATGTGVAPFRGYLRRMF----MESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFP  417
            ATGTG+AP R YLRRMF        P ++F G AWLF+G   T +LLYDD+F +Y  +FP
Sbjct  232  ATGTGIAPMRTYLRRMFEPGERSKNPEYQFRGKAWLFMGAPTTANLLYDDDFNRYQSEFP  291

Query  416  DNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDT  240
            +NFRY + +SREQ+N +GG+MY+QD++ E++DEIF ++ D   H+Y CGL+GM PGI   
Sbjct  292  ENFRYTKAISREQQNTSGGRMYIQDRVTEHADEIFGMIEDSRTHVYMCGLRGMEPGIDQA  351

Query  239  LKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            +   A+ +G +W     QLKK ++WHVE Y
Sbjct  352  MTAAAQAKGFNWAELRPQLKKAERWHVETY  381



>ref|WP_032522615.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF95140.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9201]
Length=398

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  196  CVRQLQY-----EKDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANVVML  249

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL D+PD
Sbjct  250  ATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLTDYPD  309

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLD-EGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F +++ E  HIY CGLKGM PGI + +
Sbjct  310  NFKYTKAISREQQNAKGGRMYIQDRVLESANELFNMIENEKTHIYLCGLKGMEPGIDEAM  369

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     QLKK  +WHVE Y
Sbjct  370  TKAAEEKGLNWSELRPQLKKAGRWHVETY  398



>ref|WP_011820472.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABM72372.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9515]
Length=384

 Score =   221 bits (563),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  +A  +M+
Sbjct  182  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DANIVML  235

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL+++PD
Sbjct  236  ATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLENYPD  295

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++EIF ++ DE  HIY CGLKGM PGI + +
Sbjct  296  NFKYTKAISREQQNTKGGRMYIQDRVLESANEIFNMIEDEKTHIYLCGLKGMEPGIDEAM  355

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + A E+GL+W     QLKK  +WHVE Y
Sbjct  356  TKAAAEKGLNWSELRPQLKKAGRWHVETY  384



>gb|KHN01599.1| Ferredoxin--NADP reductase, leaf isozyme, chloroplastic [Glycine 
soja]
Length=362

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 142/206 (69%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R VY    T +      GVC NFLCD  PG +V ITGP GK ML+P+D PNAT IM+
Sbjct  162  CVKRLVY----TNENGEIVKGVCSNFLCDLKPGAEVTITGPVGKEMLMPKD-PNATIIML  216

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SLLY +EF K  + +PDNFR
Sbjct  217  GTGTGIAPFRSFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSLLYKEEFEKMQEKYPDNFR  276

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N+NG KMY+Q ++ +Y++E+++LL  +   +Y CGLKGM  GI D +  +
Sbjct  277  LDFAVSREQTNENGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSL  336

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A + G+ W     QLKK++QW+VEVY
Sbjct  337  AAKDGIDWTEYKRQLKKSEQWNVEVY  362



>ref|XP_010103488.1| Ferredoxin--NADP reductase, embryo isozyme [Morus notabilis]
 gb|EXC46730.1| Ferredoxin--NADP reductase, embryo isozyme [Morus notabilis]
Length=295

 Score =   218 bits (556),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 131/185 (71%), Gaps = 5/185 (3%)
 Frame = -1

Query  704  GVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMIATGTGVAPFRGYLRRMFMES  525
            G     LC+S PGDK Q TGP  + MLL + +PNATHI +ATGTGVAPFR +LRR F E 
Sbjct  116  GTTSELLCNSKPGDKFQFTGPVREAMLLGDFSPNATHIFVATGTGVAPFRAHLRRFFKED  175

Query  524  VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFRYDRVLSREQKNKNGGKMYVQ  345
            +PTF+F+GLAWLF GV N+DS LY +EF +YL+D P+NFRYD   SR Q+ K     YVQ
Sbjct  176  IPTFRFSGLAWLFHGVVNSDSQLYGEEFEQYLKDNPENFRYDVAFSRVQQKK-----YVQ  230

Query  344  DKIEEYSDEIFKLLDEGAHIYFCGLKGMMPGIQDTLKRVAEERGLSWETKLSQLKKNKQW  165
            D + + +DE+F LL  GA+IY  GL+GM+  I++ LK VAE++ L WE  L+ LK N QW
Sbjct  231  DAVADKADEVFDLLLNGAYIYLAGLQGMVSPIEEALKIVAEKKQLDWEAVLAALKANNQW  290

Query  164  HVEVY  150
             VEVY
Sbjct  291  RVEVY  295



>ref|WP_041484386.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=394

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/209 (49%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  192  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  245

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL D+PD
Sbjct  246  ATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLSDYPD  305

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  306  NFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  365

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + A+E+GL+W     QLKK  +WHVE Y
Sbjct  366  TKAAQEKGLNWSDLRPQLKKAGRWHVETY  394



>ref|WP_025962971.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_521O20]
Length=380

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  178  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  232  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  288

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  289  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  348

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  349  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  380



>ref|XP_003547929.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
isoform 1 [Glycine max]
Length=362

 Score =   220 bits (561),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 142/206 (69%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R VY    T +      GVC NFLCD  PG +V ITGP GK ML+P+D PNAT IM+
Sbjct  162  CVKRLVY----TNENGEIVKGVCSNFLCDLKPGAEVTITGPVGKEMLMPKD-PNATIIML  216

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
             TGTG+APFR +L +MF E    +KFNGLAWLFLGV  + SLLY +EF K  + +PDNFR
Sbjct  217  GTGTGIAPFRSFLWKMFFEKHEDYKFNGLAWLFLGVPTSSSLLYKEEFEKMQEKYPDNFR  276

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N+NG KMY+Q ++ +Y++E+++LL  +   +Y CGLKGM  GI D +  +
Sbjct  277  LDFAVSREQTNENGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSL  336

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A + G+ W     QLKK++QW+VEVY
Sbjct  337  AAKDGIDWTEYKRQLKKSEQWNVEVY  362



>ref|WP_025890941.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_526N9]
Length=380

 Score =   221 bits (562),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  178  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  232  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  288

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  289  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  348

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  349  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  380



>ref|WP_025944110.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_526B22]
Length=375

 Score =   221 bits (562),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_032519107.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGG09891.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SB]
Length=370

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025975443.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_495K23]
Length=370

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025900667.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_498N8]
Length=370

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025925380.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=375

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025958422.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527L15]
Length=370

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_011132708.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 emb|CAE19534.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
subsp. pastoris str. CCMP1986]
 gb|KGF88762.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. EQPAC1]
Length=370

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 143/209 (68%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC ++LCD  PG KV+ITGP GK MLLP D  +A  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSSYLCDIKPGAKVKITGPVGKEMLLP-DEEDANIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +      + F G AWLF+G   + +LLY+++  +YL+ +PD
Sbjct  222  ATGTGIAPMRAYLRRMFEATEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLETYPD  281

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++EIF ++ DE  HIY CGLKGM PGI + +
Sbjct  282  NFKYTKAISREQQNTKGGRMYIQDRVLESANEIFNMIEDEKTHIYLCGLKGMEPGIDEAM  341

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     QLKK  +WHVE Y
Sbjct  342  TKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025968699.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_519D13]
Length=370

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_019504594.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=402

 Score =   221 bits (563),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 142/208 (68%), Gaps = 7/208 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y DPETG++     GVC +FLC+ NPGD V ITGP GK MLLPED  +A  IMI
Sbjct  199  CVRKLEYKDPETGED---VEGVCSSFLCNLNPGDDVSITGPVGKEMLLPEDE-DANVIMI  254

Query  584  ATGTGVAPFRGYLRRMFMES--VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDN  411
            ATGTG+APFR YL RMF E    P + F GLAWLF G+A T ++LY D+  +  + +PDN
Sbjct  255  ATGTGIAPFRAYLWRMFFEGDKNPDYNFKGLAWLFFGIAKTPNILYKDQLDELAEKYPDN  314

Query  410  FRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLK  234
            FR D  +SREQKN  GGKMY+Q +I E++D++++L+ +   H Y CGLKGM  GI + L 
Sbjct  315  FRLDYAISREQKNSEGGKMYIQHRIAEHADKLWELMQNPKTHTYICGLKGMEGGIDEALS  374

Query  233  RVAEERGLSWETKLSQLKKNKQWHVEVY  150
              A++ G++W+     +KK  +WHVE Y
Sbjct  375  AAADKHGVNWDDYRKAMKKEHRWHVETY  402



>ref|WP_025956780.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_498L10]
Length=375

 Score =   220 bits (561),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025891782.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=370

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025881692.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527E14]
Length=370

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025941824.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=375

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_011125275.1| MULTISPECIES: ferredoxin--NADP reductase [Prochlorococcus]
 ref|NP_875515.1| Ferredoxin-NADP oxidoreductase, PetH [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|AAQ00168.1| Ferredoxin-NADP oxidoreductase, PetH [Prochlorococcus marinus 
subsp. marinus str. CCMP1375]
 gb|KGG13966.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. LG]
 gb|KGG19099.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SS2]
 gb|KGG23361.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SS35]
 gb|KGG32403.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. SS51]
 gb|KGG35711.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. SS52]
Length=364

 Score =   220 bits (560),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 139/209 (67%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      KE  + +GVC  +LCD  PGDKV+ITGP GK MLLP+D  +A  IM+
Sbjct  162  CVRQLQYE-----KEGQTIDGVCSTYLCDIKPGDKVKITGPVGKEMLLPDDE-DANIIML  215

Query  584  ATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLR+MF ++      + F G AWLF+G   T +LLYDD+F  Y   +P+
Sbjct  216  ATGTGIAPMRAYLRKMFEKTEREKNNWYFKGKAWLFMGAPKTANLLYDDDFENYKAQYPE  275

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTL  237
            N RY + +SREQKN  GG+MY+QD++ EY+DEIF L++    HIY CGLKGM PGI + +
Sbjct  276  NLRYTKAISREQKNTKGGRMYIQDRVLEYADEIFSLIENPKTHIYLCGLKGMEPGIDEAM  335

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
               A  +GL+W     QLKK  +WHVE Y
Sbjct  336  TTAASAKGLNWSELRPQLKKAGRWHVETY  364



>ref|WP_012195665.1| ferredoxin--NADP reductase [Prochlorococcus marinus]
 gb|ABX09044.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. MIT 9211]
Length=361

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/209 (51%), Positives = 138/209 (66%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + +GVC  +LCD  PGDKV+ITGP GK MLLPED  NA  IM+
Sbjct  159  CVRQLQYE-----KDGKTIDGVCSTYLCDIKPGDKVKITGPVGKEMLLPEDE-NANIIML  212

Query  584  ATGTGVAPFRGYLRRMF---MESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF    +   ++ + G AWLF+G   T +LLYD +F  Y   FP+
Sbjct  213  ATGTGIAPMRAYLRRMFDPTEQEKNSWNYKGNAWLFMGAPKTANLLYDSDFEGYKSKFPN  272

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTL  237
            N RY + +SREQKN  GG+MY+QD++ E++DEIF L++    HIY CGLKGM PGI + +
Sbjct  273  NLRYTKAISREQKNARGGRMYIQDRVLEHADEIFALIENPKTHIYLCGLKGMEPGIDEAM  332

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + A  +GL W     QLKK  +WHVE Y
Sbjct  333  TQAAASKGLVWSELRPQLKKAGRWHVETY  361



>ref|WP_006632795.1| ferredoxin--NADP reductase [Microcoleus vaginatus]
 gb|EGK88014.1| Ferredoxin--NADP(+) reductase [Microcoleus vaginatus FGP-2]
Length=401

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 141/206 (68%), Gaps = 5/206 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRR  Y  PETG++     GVC  FL    PGD V+ITGP GK MLLP+D   AT IM+
Sbjct  200  CVRRLEYKSPETGEQVF---GVCSTFLTGLQPGDDVKITGPVGKEMLLPDDE-EATIIMM  255

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR YL RMF E+ P +KF GLAWLFLGVA T ++LY +E  +  ++FPDNFR
Sbjct  256  ATGTGIAPFRAYLWRMFKENNPDYKFKGLAWLFLGVAYTPNILYKEELEQLQREFPDNFR  315

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTLKRV  228
                +SREQKN +GGKMY+Q++I+E +D++++L+ +   H Y CGLKGM  GI + +   
Sbjct  316  LTYAISREQKNADGGKMYIQNRIQENADQLWELVQKPNTHTYICGLKGMEGGIDEGMSAA  375

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            + + G+ W     QLKK  +WHVE Y
Sbjct  376  SSKYGVEWAAYQKQLKKEHRWHVETY  401



>ref|WP_025923346.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB243_495D8]
Length=369

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  167  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  220

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ D
Sbjct  221  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYIAD  277

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  278  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  337

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  338  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  369



>ref|WP_025973953.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_529B19]
Length=370

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NG+C  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  168  CVRQLQYE-----KDGETINGICSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>gb|ABM70465.1| ferredoxin-NADP oxidoreductase (FNR) [Prochlorococcus marinus 
str. AS9601]
Length=326

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  124  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  177

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  178  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYITE  234

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  235  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  294

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  295  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  326



>ref|WP_012630377.1| ferredoxin--NADP reductase [Cyanothece sp. PCC 7425]
 gb|ACL47344.1| oxidoreductase FAD/NAD(P)-binding domain protein [Cyanothece 
sp. PCC 7425]
Length=400

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 140/206 (68%), Gaps = 5/206 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRR  Y  PETG+      GVC  +L   NPGD+V+ITGP GK MLLP+D P AT IM+
Sbjct  199  CVRRLEYNHPETGERVF---GVCSTYLTGLNPGDEVKITGPVGKEMLLPDD-PEATIIMM  254

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR YL RMF E+ P +KF GLAWLF GVA T ++LY +E     Q +PDNFR
Sbjct  255  ATGTGIAPFRAYLWRMFKENNPEYKFRGLAWLFFGVAYTPNILYKEELETLQQQYPDNFR  314

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTLKRV  228
                +SREQKN  GGKMY+Q +I+E +DE+++L+ +   H+Y CGLKGM  GI + +   
Sbjct  315  LTCAISREQKNAQGGKMYIQHRIQENADELWQLVQKPNTHVYICGLKGMEGGIDEGMSAA  374

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A + G SW     ++KK ++WHVE Y
Sbjct  375  AAKFGASWAEFQRKMKKEERWHVETY  400



>ref|WP_025893387.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_527N11]
Length=375

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLFD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_036533347.1| ferredoxin-NADP reductase [Neosynechococcus sphagnicola]
 gb|KGF72590.1| ferredoxin-NADP reductase [Neosynechococcus sphagnicola sy1]
Length=399

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 138/206 (67%), Gaps = 5/206 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVRR  Y  PETG++     GVC +FLC   PGD V+ITGP GK MLLP D P AT IM+
Sbjct  198  CVRRLEYKHPETGEQVF---GVCSSFLCGLQPGDDVKITGPVGKEMLLPND-PEATIIMM  253

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L RMF E+ P ++F GLAWLF GVA T ++LY DE  +  + FPDN R
Sbjct  254  ATGTGIAPFRAFLWRMFKENNPDYQFKGLAWLFFGVAYTPNVLYKDELEELQRQFPDNLR  313

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTLKRV  228
                +SREQKN +GGKMY+QD+I E +DE+++L+ +   H Y CGLKGM  GI   +   
Sbjct  314  LTYAISREQKNASGGKMYIQDRIAENADELWQLVQKPNTHTYICGLKGMEGGIDAGMSAA  373

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A + G +W      LKK ++WHVE Y
Sbjct  374  ASQSGANWSEYQKILKKQERWHVETY  399



>ref|WP_036902640.1| ferredoxin-NADP reductase [Prochlorococcus sp. MIT 0601]
 gb|KGG12234.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0601]
Length=365

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 139/209 (67%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + +GVC  +LCD  PGDKV+ITGP GK MLLP DN +A  IM+
Sbjct  163  CVRQLQYE-----KDGQTIDGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DNEDANIIML  216

Query  584  ATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLR+MF  S      + + G AWLF+G   T++LLYD +F  Y   FP+
Sbjct  217  ATGTGIAPMRAYLRKMFEPSERQKNNWNYKGNAWLFMGAPKTENLLYDSDFEHYKSQFPN  276

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            N RY + +SREQKN  GG+MY+QD++ E+++EIF ++ D   HIY CGLKGM PGI + +
Sbjct  277  NLRYTKAISREQKNSKGGRMYIQDRVLEHAEEIFSMIEDPKTHIYLCGLKGMEPGIDEAM  336

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + A  +GL W+    QLKK  +WHVE Y
Sbjct  337  NKAAASKGLKWDELRPQLKKQGRWHVETY  365



>ref|WP_025974310.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_529J11]
Length=375

 Score =   219 bits (559),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 144/212 (68%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  ++  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DSNIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AE++GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEQKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025939411.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_520B18]
Length=370

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLPE+  +   +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DCNIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL D
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLVD  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_032514193.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
 gb|KGF90625.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9107]
 gb|KGF90788.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9116]
 gb|KGF93650.1| Ferredoxin-NADP(+) reductase [Prochlorococcus marinus str. MIT 
9123]
Length=398

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 145/209 (69%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + +GVC  +LCD  PGDKV+ITGP GK MLLPE+  +A  +M+
Sbjct  196  CVRQLQY-----EKDGETIDGVCSTYLCDIKPGDKVKITGPVGKEMLLPEEE-DANIVML  249

Query  584  ATGTGVAPFRGYLRRMFMESVP---TFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF  +     ++ F G AWLF+G   + +LLY+++  +YL D+P+
Sbjct  250  ATGTGIAPMRAYLRRMFEATEKEKNSWNFKGKAWLFMGAPKSANLLYEEDLQRYLTDYPE  309

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI + +
Sbjct  310  NFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGIDEAM  369

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
             + AEE+GL+W     +LKK  +WHVE Y
Sbjct  370  TKAAEEKGLNWSELRPKLKKAGRWHVETY  398



>ref|WP_042850553.1| ferredoxin-NADP reductase [Prochlorococcus sp. MIT 0604]
 gb|AIQ95228.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0604]
Length=375

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 107/212 (50%), Positives = 142/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D   A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEEANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL +
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLNE  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025906619.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=370

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYITE  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNSKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_006852296.1| ferredoxin--NADP reductase [Synechococcus sp. WH 8016]
 gb|EHA63116.1| Ferredoxin--NADP(+) reductase [Synechococcus sp. WH 8016]
Length=383

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 138/209 (66%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR   Y      K+  + NGVC  +LCD  PG KV+ITGP GK MLLPED   A  IM+
Sbjct  181  CVRHLQYE-----KDGETINGVCSTYLCDVEPGTKVKITGPVGKEMLLPEDE-EANVIML  234

Query  584  ATGTGVAPFRGYLRRMFM---ESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF     +   + F G AWLF+G   T +LLYD++F  Y +++PD
Sbjct  235  ATGTGIAPMRTYLRRMFEPKERAENGWNFRGKAWLFMGAPKTANLLYDEDFLHYEKEYPD  294

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NFRY + +SREQ+N  GG+MY+QD++ E+++EIF ++ D   H+Y CGL+GM PGI + +
Sbjct  295  NFRYTKAISREQQNPKGGRMYIQDRVSEHAEEIFAMIEDPKTHVYMCGLRGMEPGIDEAM  354

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
               AE +GL W     +LKK  +WHVE Y
Sbjct  355  SAAAEAKGLDWSELRPKLKKAHRWHVETY  383



>ref|WP_025935188.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_518A17]
Length=380

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  178  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  231

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  232  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYIAE  288

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  289  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  348

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  349  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  380



>ref|WP_025894678.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=375

 Score =   219 bits (557),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYIAE  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_041484539.1| ferredoxin-NADP reductase [Prochlorococcus marinus]
Length=375

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYITE  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|WP_025939139.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB245a_518A6]
Length=375

 Score =   219 bits (557),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYIAE  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  375



>ref|XP_010536398.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme 2, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=366

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 140/206 (68%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R VY    T ++     GVC NFLCD  PG  V+ITGP GK ML+P+D PNAT IM+
Sbjct  166  CVKRLVY----TNEQGEIVKGVCSNFLCDLKPGADVKITGPLGKEMLMPKD-PNATVIML  220

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L +MF E    ++FNGLAWLFLGV  T SLLY +EF K     P+NFR
Sbjct  221  ATGTGIAPFRSFLWKMFFEKHSDYEFNGLAWLFLGVPTTSSLLYQEEFDKMKAKAPENFR  280

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N+ G KMY+Q ++ EY+DE+++LL  +  +IY CGLKGM  GI D +  +
Sbjct  281  VDYAISREQTNEKGEKMYIQTRMAEYADELWELLKKDNTYIYMCGLKGMEKGIDDIMVSL  340

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A   G+ W     Q+KK +QW+VEVY
Sbjct  341  AARDGIDWIEYKKQMKKAEQWNVEVY  366



>ref|WP_025922412.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_529D18]
Length=370

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYIAE  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_025955871.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
Length=370

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  168  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANIVML  221

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +Y+ +
Sbjct  222  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYIAE  278

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  279  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  338

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     QLKK  +WHVE Y
Sbjct  339  EAMTKAAEEKGLNWSELRPQLKKAGRWHVETY  370



>ref|WP_011359557.1| ferredoxin--NADP reductase [Synechococcus sp. CC9902]
 gb|ABB25717.1| ferredoxin--NADP reductase (FNR) [Synechococcus sp. CC9902]
Length=398

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/209 (51%), Positives = 142/209 (68%), Gaps = 9/209 (4%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+ + Y  E G++     GVC ++LCD  PG KV+ITGP GK MLLPED  +A  IM+
Sbjct  195  CVRQ-LEYKNEAGEQIY---GVCSSYLCDIEPGTKVKITGPVGKEMLLPEDE-DANIIML  249

Query  584  ATGTGVAPFRGYLRRMFMES---VPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF         + F G AWLF+G   T +LLYDD+F  YL+++PD
Sbjct  250  ATGTGIAPMRTYLRRMFESKERKANGWSFKGKAWLFMGAPKTANLLYDDDFNNYLKEYPD  309

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTL  237
            NFRY + +SRE++N  GG+MY+QD++ E++DEIF ++ D   H+Y CGL+GM PGI + +
Sbjct  310  NFRYTKAISREEQNSKGGRMYIQDRVSEHADEIFAMIEDPKTHVYMCGLRGMEPGIDEAM  369

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
               A  +GL W+    QLKK  +WHVE Y
Sbjct  370  SAAAAAKGLDWKELRPQLKKADRWHVETY  398



>ref|WP_036911108.1| MULTISPECIES: ferredoxin-NADP reductase [Prochlorococcus]
 gb|KGG28948.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0701]
 gb|KGG30621.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0702]
 gb|KGG36658.1| Ferredoxin-NADP(+) reductase [Prochlorococcus sp. MIT 0703]
Length=366

 Score =   218 bits (556),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 141/209 (67%), Gaps = 10/209 (5%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y       +  + +GVC  +LCD NPG K +ITGP GK MLLP+D  +A  IM+
Sbjct  164  CVRQLQYE-----LDGKTIDGVCSTYLCDINPGAKTKITGPVGKEMLLPDDE-DANVIML  217

Query  584  ATGTGVAPFRGYLRRMFM---ESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPD  414
            ATGTG+AP R YLRRMF     S   +KF G AWLF+G   T +LLYD++  +Y ++FPD
Sbjct  218  ATGTGIAPMRAYLRRMFEPAERSKNGWKFRGKAWLFMGAPYTANLLYDEDLNRYEREFPD  277

Query  413  NFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTL  237
            NFRY + +SREQ+N  GG+MY+QD++ E+SDEIFK+++    H+Y CGLKGM PGI + +
Sbjct  278  NFRYTKAISREQQNSKGGRMYIQDRVMEHSDEIFKMIESPKTHVYMCGLKGMEPGIDEAM  337

Query  236  KRVAEERGLSWETKLSQLKKNKQWHVEVY  150
               A  +G++W     QLKK  +WHVE Y
Sbjct  338  TAAASAKGINWSELRPQLKKAHRWHVETY  366



>pdb|1GAQ|A Chain A, Crystal Structure Of The Complex Between Ferredoxin 
And Ferredoxin-Nadp+ Reductase
 pdb|1GAQ|C Chain C, Crystal Structure Of The Complex Between Ferredoxin 
And Ferredoxin-Nadp+ Reductase
 pdb|1GAW|A Chain A, Crystal Structure Analysis Of The Ferredoxin-Nadp+ Reductase 
From Maize Leaf
 pdb|1GAW|B Chain B, Crystal Structure Analysis Of The Ferredoxin-Nadp+ Reductase 
From Maize Leaf
Length=314

 Score =   216 bits (551),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R +Y    T        GVC NFLCD  PGD VQITGP GK ML+P+D PNAT IM+
Sbjct  114  CVKRLIY----TNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKD-PNATIIML  168

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L +MF E    +KFNGL WLFLGV  + SLLY +EF K  +  P+NFR
Sbjct  169  ATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFR  228

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N  G +MY+Q ++ EY +E+++LL  +  ++Y CGLKGM  GI D +  +
Sbjct  229  VDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSL  288

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            AE+ G+ W     QLK+  QW+VEVY
Sbjct  289  AEKDGIDWFDYKKQLKRGDQWNVEVY  314



>pdb|3W5U|A Chain A, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5U|C Chain C, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5U|E Chain E, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5U|G Chain G, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5V|A Chain A, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
 pdb|3W5V|C Chain C, Cross-linked Complex Between Ferredoxin And Ferredoxin-nadp+ 
Reductase
Length=314

 Score =   216 bits (550),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R +Y    T        GVC NFLCD  PGD VQITGP GK ML+P+D PNAT IM+
Sbjct  114  CVKRLIY----TNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKD-PNATIIML  168

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L +MF E    +KFNGL WLFLGV  + SLLY +EF K  +  P+NFR
Sbjct  169  ATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFR  228

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N  G +MY+Q ++ EY +E+++LL  +  ++Y CGLKGM  GI D +  +
Sbjct  229  VDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSL  288

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            AE+ G+ W     QLK+  QW+VEVY
Sbjct  289  AEKDGIDWFDYKKQLKRGDQWNVEVY  314



>ref|XP_006844481.1| hypothetical protein AMTR_s00016p00108610 [Amborella trichopoda]
 gb|ERN06156.1| hypothetical protein AMTR_s00016p00108610 [Amborella trichopoda]
Length=371

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/206 (51%), Positives = 142/206 (69%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R VY    T ++     GVC NFLCD  PG +V++TGP GK ML+P D PNAT IM+
Sbjct  171  CVKRLVY----TNEQGEIVKGVCSNFLCDLKPGAEVKLTGPVGKEMLMPAD-PNATVIML  225

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFRG++ +MF E    +KFNGLAWLFLGV  + SLLY +EF K  +  P+NFR
Sbjct  226  ATGTGIAPFRGFVWKMFFEKYEDYKFNGLAWLFLGVPTSSSLLYKEEFEKMQEKAPNNFR  285

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N+ G KMY+Q ++ +Y++E+++LL  +   +Y CGLKGM  GI D +  +
Sbjct  286  VDFAVSREQTNEKGEKMYIQTRMAQYAEELWELLKKDNTFVYMCGLKGMEKGIDDIMVSL  345

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A + G+ W     QLKK +QW+VEVY
Sbjct  346  AAKDGVDWFEYKKQLKKEEQWNVEVY  371



>ref|NP_001105568.1| ferredoxin [Zea mays]
 ref|XP_008659023.1| PREDICTED: ferredoxin isoform X1 [Zea mays]
 dbj|BAA88236.1| ferredoxin [Zea mays]
 gb|ACG31602.1| ferredoxin--NADP reductase, leaf isozyme [Zea mays]
 gb|ACL53609.1| unknown [Zea mays]
 gb|AFW86197.1| ferredoxinFerredoxin--NADP reductase, leaf isozyme [Zea mays]
Length=355

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 138/206 (67%), Gaps = 6/206 (3%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CV+R +Y    T        GVC NFLCD  PGD VQITGP GK ML+P+D PNAT IM+
Sbjct  155  CVKRLIY----TNDAGEIVKGVCSNFLCDLQPGDNVQITGPVGKEMLMPKD-PNATIIML  209

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L +MF E    +KFNGL WLFLGV  + SLLY +EF K  +  P+NFR
Sbjct  210  ATGTGIAPFRSFLWKMFFEKHDDYKFNGLGWLFLGVPTSSSLLYKEEFGKMKERAPENFR  269

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQDTLKRV  228
             D  +SREQ N  G +MY+Q ++ EY +E+++LL  +  ++Y CGLKGM  GI D +  +
Sbjct  270  VDYAVSREQTNAAGERMYIQTRMAEYKEELWELLKKDNTYVYMCGLKGMEKGIDDIMVSL  329

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            AE+ G+ W     QLK+  QW+VEVY
Sbjct  330  AEKDGIDWFDYKKQLKRGDQWNVEVY  355



>ref|WP_025926660.1| ferredoxin-NADP reductase [Prochlorococcus sp. scB241_528J8]
Length=375

 Score =   218 bits (555),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 106/212 (50%), Positives = 143/212 (67%), Gaps = 16/212 (8%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
            CVR+  Y      K+  + NGVC  +LCD  PGDKV+ITGP GK MLLP D  +A  +M+
Sbjct  173  CVRQLQYE-----KDGETINGVCSTYLCDIKPGDKVKITGPVGKEMLLP-DEEDANVVML  226

Query  584  ATGTGVAPFRGYLRRMFMESVPTFK------FNGLAWLFLGVANTDSLLYDDEFAKYLQD  423
            ATGTG+AP R YLRRMF    PT K      F G AWLF+G   + +LLY+++  +YL +
Sbjct  227  ATGTGIAPMRAYLRRMFE---PTEKEKNKWNFKGKAWLFMGAPKSANLLYEEDLQRYLAE  283

Query  422  FPDNFRYDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLL-DEGAHIYFCGLKGMMPGIQ  246
             PDNF+Y + +SREQ+N  GG+MY+QD++ E ++E+F ++ DE  HIY CGLKGM PGI 
Sbjct  284  NPDNFKYTKAISREQQNTKGGRMYIQDRVLESANELFNMIEDEKTHIYLCGLKGMEPGID  343

Query  245  DTLKRVAEERGLSWETKLSQLKKNKQWHVEVY  150
            + + + AEE+GL+W     +LKK  +WHVE Y
Sbjct  344  EAMTKAAEEKGLNWSELRPKLKKAGRWHVETY  375



>ref|WP_015165197.1| ferredoxin--NADP(+) reductase [Pseudanabaena sp. PCC 7367]
 gb|AFY70234.1| Ferredoxin--NADP(+) reductase [Pseudanabaena sp. PCC 7367]
Length=300

 Score =   215 bits (548),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 135/206 (66%), Gaps = 5/206 (2%)
 Frame = -1

Query  764  CVRRAVYYDPETGKEDXSKNGVCGNFLCDSNPGDKVQITGPSGKIMLLPEDNPNATHIMI  585
             VRR VY  PETG+   +  GVC + +CD  PGD V ITGP GK MLLP D+PNAT IMI
Sbjct  99   SVRRLVYQHPETGE---TVEGVCSSHICDLKPGDDVTITGPVGKEMLLP-DDPNATIIMI  154

Query  584  ATGTGVAPFRGYLRRMFMESVPTFKFNGLAWLFLGVANTDSLLYDDEFAKYLQDFPDNFR  405
            ATGTG+APFR +L RMF E    +KFNGLAWLF GV N+ S LY  E        P NFR
Sbjct  155  ATGTGIAPFRAFLWRMFKEKHEDYKFNGLAWLFFGVPNSASALYKPELEWLQYKNPQNFR  214

Query  404  YDRVLSREQKNKNGGKMYVQDKIEEYSDEIFKLLDE-GAHIYFCGLKGMMPGIQDTLKRV  228
             D  LSREQKN++GGKMY+Q ++ EY+D+++ L+ +   H Y CGL+GM  GI + +   
Sbjct  215  LDYALSREQKNRDGGKMYIQHRMAEYADKLWNLIQKPTTHTYICGLRGMEGGIAEFMTET  274

Query  227  AEERGLSWETKLSQLKKNKQWHVEVY  150
            A + G+ W     Q+KK  +WHVE Y
Sbjct  275  AAKSGVEWSEYERQMKKEDRWHVETY  300



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680