BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037K03

Length=697
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349280.1|  PREDICTED: auxin response factor 1-like isof...    140   5e-53   Solanum tuberosum [potatoes]
ref|NP_001234871.1|  auxin response factor 1                            140   8e-53   
ref|XP_010323707.1|  PREDICTED: auxin response factor 1 isoform X1      140   9e-53   
ref|XP_009627009.1|  PREDICTED: auxin response factor 1                 138   4e-52   Nicotiana tomentosiformis
ref|XP_009786487.1|  PREDICTED: auxin response factor 1                 129   2e-49   Nicotiana sylvestris
ref|XP_011087626.1|  PREDICTED: auxin response factor 1-like            113   1e-46   Sesamum indicum [beniseed]
emb|CDO97653.1|  unnamed protein product                                115   4e-46   Coffea canephora [robusta coffee]
ref|XP_002268348.2|  PREDICTED: auxin response factor 1 isoform X1      110   2e-44   Vitis vinifera
ref|XP_010657917.1|  PREDICTED: auxin response factor 1 isoform X2      110   2e-44   Vitis vinifera
ref|XP_010099783.1|  Auxin response factor 1                            112   3e-44   
ref|XP_011092260.1|  PREDICTED: auxin response factor 1 isoform X1      107   9e-43   Sesamum indicum [beniseed]
ref|XP_008218645.1|  PREDICTED: auxin response factor 1                 107   2e-42   Prunus mume [ume]
ref|XP_007225153.1|  hypothetical protein PRUPE_ppa002394mg             107   2e-42   Prunus persica
ref|XP_011003708.1|  PREDICTED: auxin response factor 1-like            102   3e-42   Populus euphratica
ref|XP_004300014.1|  PREDICTED: auxin response factor 1                 108   3e-42   Fragaria vesca subsp. vesca
ref|XP_008378943.1|  PREDICTED: auxin response factor 1                 108   4e-42   
ref|XP_006385188.1|  auxin response factor 1 family protein             102   9e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009355376.1|  PREDICTED: auxin response factor 1                 105   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_011028402.1|  PREDICTED: auxin response factor 1                 103   2e-41   Populus euphratica
ref|XP_006385086.1|  hypothetical protein POPTR_0004s23770g             103   2e-41   
gb|AIR95657.1|  auxin response factor 1 family protein                99.8    3e-41   Populus davidiana x Populus alba var. pyramidalis
ref|XP_010252371.1|  PREDICTED: auxin response factor 1                 101   5e-41   Nelumbo nucifera [Indian lotus]
ref|XP_003592874.1|  Auxin response factor                            99.8    7e-41   Medicago truncatula
gb|ABO80473.1|  AUX/IAA protein; Transcriptional factor B3; Auxin...  99.8    8e-41   Medicago truncatula
ref|XP_007023118.1|  Auxin response factor 1 isoform 1                  103   8e-41   Theobroma cacao [chocolate]
ref|XP_007023119.1|  Auxin response factor 1 isoform 2                  102   1e-40   
ref|XP_006470822.1|  PREDICTED: auxin response factor 1-like isof...    100   1e-40   Citrus sinensis [apfelsine]
gb|KHN11044.1|  Auxin response factor 1                               99.4    2e-40   Glycine soja [wild soybean]
ref|XP_004485416.1|  PREDICTED: auxin response factor 1-like isof...  96.7    5e-40   Cicer arietinum [garbanzo]
ref|XP_003540131.1|  PREDICTED: auxin response factor 1-like          99.4    7e-40   Glycine max [soybeans]
ref|XP_006431443.1|  hypothetical protein CICLE_v10000491mg           98.6    8e-40   Citrus clementina [clementine]
ref|XP_007153915.1|  hypothetical protein PHAVU_003G075800g           99.0    8e-40   Phaseolus vulgaris [French bean]
gb|KHN40198.1|  Auxin response factor 1                               97.8    2e-39   Glycine soja [wild soybean]
ref|XP_003528726.1|  PREDICTED: auxin response factor 1-like          97.8    2e-39   Glycine max [soybeans]
gb|KDP42510.1|  hypothetical protein JCGZ_00307                       95.5    2e-39   Jatropha curcas
ref|XP_006470825.1|  PREDICTED: auxin response factor 1-like isof...  96.3    3e-39   Citrus sinensis [apfelsine]
ref|XP_010930543.1|  PREDICTED: auxin response factor 7-like          95.5    4e-39   Elaeis guineensis
gb|EYU35034.1|  hypothetical protein MIMGU_mgv1a003127mg                101   4e-39   Erythranthe guttata [common monkey flower]
gb|KHG03459.1|  Auxin response factor 1 -like protein                 96.7    5e-39   Gossypium arboreum [tree cotton]
ref|XP_006598778.1|  PREDICTED: auxin response factor 1-like isof...  94.7    7e-39   
ref|XP_006598779.1|  PREDICTED: auxin response factor 1-like isof...  94.7    7e-39   Glycine max [soybeans]
ref|XP_003548301.1|  PREDICTED: auxin response factor 1-like isof...  94.7    7e-39   Glycine max [soybeans]
ref|XP_002527835.1|  Auxin response factor, putative                  94.4    1e-38   
gb|KJB70781.1|  hypothetical protein B456_011G091100                  96.3    1e-38   Gossypium raimondii
gb|ACX68650.3|  auxin response factor                                 96.7    2e-38   Dimocarpus longan [longan]
ref|XP_010912873.1|  PREDICTED: auxin response factor 7-like          94.0    3e-38   
ref|XP_008786460.1|  PREDICTED: auxin response factor 7-like          93.6    4e-38   Phoenix dactylifera
ref|XP_008795276.1|  PREDICTED: auxin response factor 7-like isof...  95.5    1e-37   Phoenix dactylifera
ref|XP_007148592.1|  hypothetical protein PHAVU_006G221500g           94.7    1e-37   Phaseolus vulgaris [French bean]
ref|XP_011092261.1|  PREDICTED: auxin response factor 1 isoform X2    94.0    2e-37   Sesamum indicum [beniseed]
gb|KGN49710.1|  hypothetical protein Csa_5G077780                     95.9    3e-37   Cucumis sativus [cucumbers]
ref|XP_004142338.1|  PREDICTED: auxin response factor 1-like          95.9    4e-37   
gb|AAZ81521.1|  auxin response factor 1                               90.9    2e-36   Gossypium barbadense [Egyptian cotton]
gb|ADW11246.1|  putative auxin response factor                        90.9    2e-36   Gossypium hirsutum [American cotton]
ref|XP_008460595.1|  PREDICTED: auxin response factor 1               95.9    3e-36   Cucumis melo [Oriental melon]
ref|XP_006470824.1|  PREDICTED: auxin response factor 1-like isof...  93.2    5e-36   Citrus sinensis [apfelsine]
emb|CBA11999.1|  putative auxin response factor 1                     91.7    1e-35   Illicium parviflorum
gb|KHN39693.1|  Auxin response factor 1                               93.6    6e-35   Glycine soja [wild soybean]
ref|XP_006470826.1|  PREDICTED: auxin response factor 1-like isof...  93.2    1e-34   Citrus sinensis [apfelsine]
ref|XP_009416967.1|  PREDICTED: auxin response factor 7-like          86.3    1e-33   
ref|XP_003575147.1|  PREDICTED: auxin response factor 7-like          90.5    2e-33   
ref|XP_004975691.1|  PREDICTED: auxin response factor 9-like          88.2    3e-33   Setaria italica
ref|XP_008347968.1|  PREDICTED: auxin response factor 1-like            107   3e-33   
ref|XP_009406475.1|  PREDICTED: auxin response factor 7-like isof...  87.4    1e-32   
ref|XP_009406473.1|  PREDICTED: auxin response factor 7-like isof...  87.0    1e-32   
ref|NP_849830.1|  auxin response factor 1                             85.5    3e-32   Arabidopsis thaliana [mouse-ear cress]
gb|AAM91657.1|  auxin response factor 1                               85.5    3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103143.1|  PREDICTED: auxin response factor 1 isoform X2    87.0    3e-32   Brassica rapa
ref|XP_010682136.1|  PREDICTED: auxin response factor 1               92.0    7e-32   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009103121.1|  PREDICTED: auxin response factor 1 isoform X1    87.0    8e-32   Brassica rapa
ref|XP_010414657.1|  PREDICTED: auxin response factor 1-like isof...  85.5    8e-32   Camelina sativa [gold-of-pleasure]
ref|NP_001185266.1|  auxin response factor 1                          85.5    8e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010511012.1|  PREDICTED: auxin response factor 1 isoform X1    85.1    9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010511014.1|  PREDICTED: auxin response factor 1 isoform X2    85.1    9e-32   Camelina sativa [gold-of-pleasure]
ref|XP_002888184.1|  hypothetical protein ARALYDRAFT_475338           85.5    1e-31   
ref|XP_010470201.1|  PREDICTED: auxin response factor 1-like isof...  85.5    1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_009379878.1|  PREDICTED: auxin response factor 7-like          85.9    2e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010414655.1|  PREDICTED: auxin response factor 1-like isof...  85.5    2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006300434.1|  hypothetical protein CARUB_v10022415mg           85.5    2e-31   Capsella rubella
gb|ACN31160.1|  unknown                                               92.4    2e-31   Zea mays [maize]
ref|XP_008669376.1|  PREDICTED: auxin response factor 9-like isof...  86.7    2e-31   
ref|XP_010470197.1|  PREDICTED: auxin response factor 1-like isof...  85.5    2e-31   Camelina sativa [gold-of-pleasure]
ref|NP_176184.1|  auxin response factor 1                             85.5    2e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008669375.1|  PREDICTED: auxin response factor 9-like isof...  86.7    2e-31   Zea mays [maize]
ref|XP_010418847.1|  PREDICTED: auxin response factor 1-like          85.5    2e-31   
gb|ADG43140.1|  auxin response factor 6                               86.7    2e-31   Zea mays [maize]
gb|EEC77345.1|  hypothetical protein OsI_16025                        89.4    3e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_002453992.1|  hypothetical protein SORBIDRAFT_04g022830        92.4    3e-31   Sorghum bicolor [broomcorn]
emb|CAE04227.2|  OSJNBa0064D20.11                                     89.4    3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001052879.1|  Os04g0442000                                     89.0    3e-31   
emb|CDY33603.1|  BnaC01g28340D                                        87.0    3e-31   Brassica napus [oilseed rape]
emb|CDY65065.1|  BnaA01g35830D                                        87.0    4e-31   Brassica napus [oilseed rape]
ref|XP_008795277.1|  PREDICTED: auxin response factor 7-like isof...  95.5    5e-31   Phoenix dactylifera
ref|XP_010065238.1|  PREDICTED: auxin response factor 1 isoform X1    87.8    5e-31   Eucalyptus grandis [rose gum]
gb|KCW62582.1|  hypothetical protein EUGRSUZ_G00076                   87.8    5e-31   Eucalyptus grandis [rose gum]
gb|KCW62583.1|  hypothetical protein EUGRSUZ_G00076                   87.4    6e-31   Eucalyptus grandis [rose gum]
ref|NP_001152338.1|  LOC100285977                                     92.4    7e-31   Zea mays [maize]
ref|XP_010065240.1|  PREDICTED: auxin response factor 1 isoform X2    87.4    7e-31   Eucalyptus grandis [rose gum]
ref|XP_009404302.1|  PREDICTED: auxin response factor 7-like          86.7    1e-30   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY27291.1|  BnaC04g18710D                                        87.4    1e-30   Brassica napus [oilseed rape]
ref|XP_004952778.1|  PREDICTED: auxin response factor 7-like isof...  92.4    2e-30   
ref|XP_006648743.1|  PREDICTED: auxin response factor 7-like          86.7    2e-30   Oryza brachyantha
ref|XP_006653437.1|  PREDICTED: auxin response factor 9-like          91.7    8e-30   Oryza brachyantha
gb|EPS68815.1|  auxin response factor 1                               88.6    2e-29   Genlisea aurea
ref|NP_001047137.1|  Os02g0557200                                     86.3    3e-29   
ref|XP_010548428.1|  PREDICTED: auxin response factor 1               91.7    4e-29   Tarenaya hassleriana [spider flower]
gb|EEC73404.1|  hypothetical protein OsI_07659                        86.3    4e-29   Oryza sativa Indica Group [Indian rice]
emb|CBI16989.3|  unnamed protein product                              87.8    1e-28   Vitis vinifera
ref|XP_002266947.1|  PREDICTED: auxin response factor 1-like          87.8    1e-28   Vitis vinifera
gb|ADG43148.1|  auxin response factor 14                              92.4    9e-28   Zea mays [maize]
ref|XP_010239942.1|  PREDICTED: auxin response factor 9-like          83.6    1e-27   Brachypodium distachyon [annual false brome]
ref|NP_001183800.1|  hypothetical protein                             92.0    1e-27   
ref|XP_009403719.1|  PREDICTED: auxin response factor 7-like          77.8    2e-26   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAE02512.1|  P0076O17.10                                          88.2    3e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006392241.1|  hypothetical protein EUTSA_v10023326mg           87.8    1e-24   
ref|XP_002446522.1|  hypothetical protein SORBIDRAFT_06g017490        87.8    3e-24   Sorghum bicolor [broomcorn]
ref|XP_010100721.1|  Auxin response factor 18                         72.4    2e-23   
ref|XP_009764747.1|  PREDICTED: auxin response factor 9-like isof...  72.4    3e-23   Nicotiana sylvestris
ref|XP_009764748.1|  PREDICTED: auxin response factor 9-like isof...  72.0    3e-23   Nicotiana sylvestris
ref|XP_004172315.1|  PREDICTED: auxin response factor 1-like          96.3    4e-23   
pdb|4LDY|A  Chain A, Crystal Structure Of The Dna Binding Domain ...  84.7    9e-23   Arabidopsis thaliana [mouse-ear cress]
pdb|4LDX|A  Chain A, Crystal Structure Of The Dna Binding Domain ...  84.7    9e-23   Arabidopsis thaliana [mouse-ear cress]
pdb|4LDV|A  Chain A, Crystal Structure Of The Dna Binding Domain ...  84.7    9e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010324454.1|  PREDICTED: auxin response factor 12 isoform X1   73.9    3e-22   
ref|XP_009341874.1|  PREDICTED: auxin response factor 9-like          72.4    3e-22   Pyrus x bretschneideri [bai li]
ref|XP_010324457.1|  PREDICTED: auxin response factor 12 isoform X2   73.9    3e-22   
ref|XP_009592767.1|  PREDICTED: auxin response factor 9-like          72.4    3e-22   Nicotiana tomentosiformis
ref|NP_001234602.1|  auxin response factor 12                         74.3    4e-22   Solanum lycopersicum
ref|XP_006352241.1|  PREDICTED: auxin response factor 9-like isof...  74.3    4e-22   Solanum tuberosum [potatoes]
ref|XP_006352240.1|  PREDICTED: auxin response factor 9-like isof...  74.3    4e-22   Solanum tuberosum [potatoes]
ref|XP_006852604.1|  hypothetical protein AMTR_s00021p00221770        73.9    5e-22   Amborella trichopoda
emb|CBA12006.1|  putative auxin response factor 2/1/9                 72.8    5e-22   Cycas rumphii
ref|XP_010523815.1|  PREDICTED: auxin response factor 18-like iso...  78.6    6e-22   Tarenaya hassleriana [spider flower]
gb|KDO86503.1|  hypothetical protein CISIN_1g005368mg                 72.0    8e-22   Citrus sinensis [apfelsine]
ref|XP_006491296.1|  PREDICTED: auxin response factor 18-like iso...  72.0    9e-22   
emb|CDP12183.1|  unnamed protein product                              67.4    1e-21   Coffea canephora [robusta coffee]
ref|XP_006343828.1|  PREDICTED: auxin response factor 9-like          72.8    2e-21   Solanum tuberosum [potatoes]
ref|XP_008341793.1|  PREDICTED: auxin response factor 9               73.9    2e-21   Malus domestica [apple tree]
ref|XP_008233127.1|  PREDICTED: auxin response factor 18-like         74.7    3e-21   Prunus mume [ume]
ref|XP_009358638.1|  PREDICTED: auxin response factor 9               73.9    3e-21   Pyrus x bretschneideri [bai li]
gb|EMT27061.1|  Auxin response factor 9                               81.6    4e-21   
ref|XP_008239157.1|  PREDICTED: auxin response factor 9               71.6    4e-21   Prunus mume [ume]
ref|XP_007210293.1|  hypothetical protein PRUPE_ppa002617mg           72.4    5e-21   
ref|XP_010055888.1|  PREDICTED: auxin response factor 9-like          73.2    6e-21   Eucalyptus grandis [rose gum]
gb|KCW72443.1|  hypothetical protein EUGRSUZ_E00888                   72.8    8e-21   Eucalyptus grandis [rose gum]
ref|XP_006491295.1|  PREDICTED: auxin response factor 18-like iso...  72.0    9e-21   Citrus sinensis [apfelsine]
ref|XP_002303662.2|  hypothetical protein POPTR_0003s14200g           72.4    1e-20   
ref|XP_006444823.1|  hypothetical protein CICLE_v100191741mg          71.2    1e-20   
ref|XP_010053162.1|  PREDICTED: auxin response factor 9-like          73.6    2e-20   Eucalyptus grandis [rose gum]
ref|XP_010523816.1|  PREDICTED: auxin response factor 18-like iso...  78.6    2e-20   Tarenaya hassleriana [spider flower]
gb|EMT17168.1|  Auxin response factor 4                               77.4    2e-20   
gb|KJB41550.1|  hypothetical protein B456_007G109500                  72.4    2e-20   Gossypium raimondii
gb|KJB41546.1|  hypothetical protein B456_007G109500                  72.4    2e-20   Gossypium raimondii
gb|EPS63285.1|  auxin response factor 2                               70.9    2e-20   Genlisea aurea
gb|KJB41543.1|  hypothetical protein B456_007G109500                  72.0    2e-20   Gossypium raimondii
gb|KJB41551.1|  hypothetical protein B456_007G109500                  72.4    2e-20   Gossypium raimondii
gb|KJB41547.1|  hypothetical protein B456_007G109500                  72.0    2e-20   Gossypium raimondii
ref|XP_006339724.1|  PREDICTED: auxin response factor 9-like isof...  71.6    2e-20   Solanum tuberosum [potatoes]
gb|KJB41549.1|  hypothetical protein B456_007G109500                  72.4    2e-20   Gossypium raimondii
dbj|BAK03995.1|  predicted protein                                    76.3    2e-20   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB41548.1|  hypothetical protein B456_007G109500                  72.0    2e-20   Gossypium raimondii
gb|KJB41544.1|  hypothetical protein B456_007G109500                  72.0    2e-20   Gossypium raimondii
ref|XP_010267580.1|  PREDICTED: auxin response factor 18              73.6    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010266558.1|  PREDICTED: auxin response factor 9-like          72.8    3e-20   Nelumbo nucifera [Indian lotus]
ref|XP_004300502.1|  PREDICTED: auxin response factor 9 isoform X1    74.7    3e-20   Fragaria vesca subsp. vesca
gb|KHG18665.1|  Auxin response factor 18 -like protein                69.7    3e-20   Gossypium arboreum [tree cotton]
ref|XP_011465372.1|  PREDICTED: auxin response factor 9 isoform X2    74.7    3e-20   Fragaria vesca subsp. vesca
ref|XP_009797447.1|  PREDICTED: auxin response factor 9-like          74.3    4e-20   Nicotiana sylvestris
ref|XP_007220626.1|  hypothetical protein PRUPE_ppa002230mg           74.7    4e-20   
ref|XP_009375411.1|  PREDICTED: auxin response factor 18 isoform X2   69.7    4e-20   Pyrus x bretschneideri [bai li]
gb|EMS58454.1|  Auxin response factor 4                               77.0    5e-20   Triticum urartu
ref|XP_010327130.1|  PREDICTED: auxin response factor 18              71.6    5e-20   Solanum lycopersicum
ref|XP_006339723.1|  PREDICTED: auxin response factor 9-like isof...  71.6    7e-20   Solanum tuberosum [potatoes]
ref|XP_006339725.1|  PREDICTED: auxin response factor 9-like isof...  71.6    7e-20   Solanum tuberosum [potatoes]
ref|XP_006439306.1|  hypothetical protein CICLE_v10019131mg           70.1    7e-20   Citrus clementina [clementine]
ref|XP_006439307.1|  hypothetical protein CICLE_v10019131mg           70.1    7e-20   
gb|KDO76598.1|  hypothetical protein CISIN_1g005491mg                 71.6    8e-20   Citrus sinensis [apfelsine]
gb|AFD01308.1|  auxin response factor 9                               69.7    9e-20   Brassica rapa subsp. pekinensis [bai cai]
emb|CBA11996.1|  putative auxin response factor 2                     69.7    9e-20   Cabomba aquatica
gb|KDO76597.1|  hypothetical protein CISIN_1g005491mg                 71.2    9e-20   Citrus sinensis [apfelsine]
emb|CBA11993.1|  putative auxin response factor 2                     70.1    1e-19   Amborella trichopoda
ref|XP_009590537.1|  PREDICTED: auxin response factor 9 isoform X2    74.3    1e-19   Nicotiana tomentosiformis
gb|KDO76596.1|  hypothetical protein CISIN_1g005491mg                 71.2    1e-19   Citrus sinensis [apfelsine]
gb|KDO76595.1|  hypothetical protein CISIN_1g005491mg                 71.2    1e-19   Citrus sinensis [apfelsine]
ref|XP_002518850.1|  hypothetical protein RCOM_1311830                73.2    1e-19   
ref|XP_009590536.1|  PREDICTED: auxin response factor 11 isoform X1   74.3    1e-19   Nicotiana tomentosiformis
ref|XP_006368789.1|  hypothetical protein POPTR_0001s10900g           67.0    1e-19   
ref|XP_010659520.1|  PREDICTED: auxin response factor 9               68.2    1e-19   Vitis vinifera
ref|XP_006476351.1|  PREDICTED: auxin response factor 9-like isof...  71.2    1e-19   Citrus sinensis [apfelsine]
emb|CBI34510.3|  unnamed protein product                              68.2    1e-19   Vitis vinifera
gb|KDO76593.1|  hypothetical protein CISIN_1g005491mg                 71.2    1e-19   Citrus sinensis [apfelsine]
ref|XP_010661956.1|  PREDICTED: auxin response factor 18              73.9    1e-19   Vitis vinifera
ref|XP_011022476.1|  PREDICTED: auxin response factor 9-like          70.9    1e-19   Populus euphratica
emb|CBI40565.3|  unnamed protein product                              73.9    1e-19   Vitis vinifera
ref|XP_002299455.2|  hypothetical protein POPTR_0001s10900g           67.0    1e-19   
ref|XP_011093958.1|  PREDICTED: auxin response factor 18-like         75.5    1e-19   Sesamum indicum [beniseed]
gb|KJB18969.1|  hypothetical protein B456_003G078000                  71.2    2e-19   Gossypium raimondii
gb|KJB18966.1|  hypothetical protein B456_003G078000                  71.2    2e-19   Gossypium raimondii
ref|XP_011026848.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  66.2    2e-19   Populus euphratica
gb|KJB18967.1|  hypothetical protein B456_003G078000                  71.6    2e-19   Gossypium raimondii
ref|XP_006855394.1|  hypothetical protein AMTR_s00057p00141830        68.9    2e-19   
ref|XP_009137577.1|  PREDICTED: auxin response factor 9               71.2    2e-19   Brassica rapa
ref|XP_006413489.1|  hypothetical protein EUTSA_v10024554mg           73.2    2e-19   
gb|KJB18968.1|  hypothetical protein B456_003G078000                  71.2    2e-19   Gossypium raimondii
gb|KJB18971.1|  hypothetical protein B456_003G078000                  71.2    2e-19   Gossypium raimondii
gb|KJB18970.1|  hypothetical protein B456_003G078000                  71.2    2e-19   Gossypium raimondii
gb|AFD01307.1|  auxin response factor 9-1                             67.4    3e-19   Brassica rapa subsp. pekinensis [bai cai]
gb|KDO76594.1|  hypothetical protein CISIN_1g005491mg                 70.1    3e-19   Citrus sinensis [apfelsine]
ref|XP_002876640.1|  hypothetical protein ARALYDRAFT_349241           72.8    3e-19   
ref|XP_006598900.1|  PREDICTED: auxin response factor 7-like isof...  70.5    3e-19   Glycine max [soybeans]
ref|XP_006476352.1|  PREDICTED: auxin response factor 9-like isof...  69.7    3e-19   Citrus sinensis [apfelsine]
ref|XP_006598901.1|  PREDICTED: auxin response factor 7-like isof...  70.5    3e-19   Glycine max [soybeans]
ref|XP_006476350.1|  PREDICTED: auxin response factor 9-like isof...  69.7    3e-19   Citrus sinensis [apfelsine]
ref|XP_011082305.1|  PREDICTED: auxin response factor 9               69.3    3e-19   Sesamum indicum [beniseed]
ref|NP_001031706.1|  auxin response factor 9                          68.9    3e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007051523.1|  Auxin response factor 11 isoform 2               69.7    3e-19   
ref|XP_007051522.1|  Auxin response factor 11 isoform 1               70.1    3e-19   
ref|XP_002527834.1|  Auxin response factor, putative                  81.6    3e-19   
ref|XP_010538837.1|  PREDICTED: auxin response factor 9-like          71.6    4e-19   Tarenaya hassleriana [spider flower]
ref|XP_009375409.1|  PREDICTED: auxin response factor 18 isoform X1   69.7    4e-19   
ref|XP_011074533.1|  PREDICTED: auxin response factor 9-like          68.2    4e-19   Sesamum indicum [beniseed]
gb|KDP25269.1|  hypothetical protein JCGZ_20425                       71.6    4e-19   Jatropha curcas
gb|EPS70611.1|  hypothetical protein M569_04145                       69.3    5e-19   Genlisea aurea
ref|XP_008811924.1|  PREDICTED: auxin response factor 23-like         71.2    5e-19   Phoenix dactylifera
emb|CDP08662.1|  unnamed protein product                              68.6    5e-19   Coffea canephora [robusta coffee]
gb|KEH22928.1|  auxin response factor 2                               67.4    5e-19   Medicago truncatula
ref|XP_008352781.1|  PREDICTED: auxin response factor 18-like iso...  69.7    5e-19   
emb|CDY10978.1|  BnaA03g46370D                                        70.1    5e-19   Brassica napus [oilseed rape]
ref|XP_010942377.1|  PREDICTED: auxin response factor 23-like         69.3    6e-19   
gb|KJB09639.1|  hypothetical protein B456_001G153900                  70.5    6e-19   Gossypium raimondii
gb|KJB09635.1|  hypothetical protein B456_001G153900                  70.5    6e-19   Gossypium raimondii
ref|XP_008462117.1|  PREDICTED: auxin response factor 18-like         66.6    6e-19   
gb|KJB09636.1|  hypothetical protein B456_001G153900                  70.5    7e-19   Gossypium raimondii
ref|XP_010529651.1|  PREDICTED: auxin response factor 9-like isof...  73.9    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_007040577.1|  Auxin response factor 9 isoform 2                70.1    7e-19   
ref|XP_010529646.1|  PREDICTED: auxin response factor 9-like isof...  73.9    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_004173327.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  66.6    7e-19   
ref|XP_010529650.1|  PREDICTED: auxin response factor 9-like isof...  73.9    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_004139643.1|  PREDICTED: auxin response factor 18-like         66.6    7e-19   Cucumis sativus [cucumbers]
gb|KHG01748.1|  Auxin response factor 18 -like protein                70.5    7e-19   Gossypium arboreum [tree cotton]
ref|XP_010529649.1|  PREDICTED: auxin response factor 9-like isof...  73.9    7e-19   Tarenaya hassleriana [spider flower]
gb|KJB09637.1|  hypothetical protein B456_001G153900                  70.1    8e-19   Gossypium raimondii
gb|KJB09638.1|  hypothetical protein B456_001G153900                  70.1    9e-19   Gossypium raimondii
ref|XP_007040576.1|  Auxin response factor 9 isoform 1                70.1    9e-19   
ref|XP_006491297.1|  PREDICTED: auxin response factor 18-like iso...  72.0    9e-19   Citrus sinensis [apfelsine]
ref|XP_003564986.1|  PREDICTED: auxin response factor 4-like          72.0    1e-18   Brachypodium distachyon [annual false brome]
ref|XP_007040578.1|  Auxin response factor 9 isoform 3                70.1    1e-18   
gb|KHG11573.1|  Auxin response factor 9 -like protein                 68.9    1e-18   Gossypium arboreum [tree cotton]
ref|XP_004306655.1|  PREDICTED: auxin response factor 18              71.6    1e-18   Fragaria vesca subsp. vesca
ref|XP_007040579.1|  Auxin response factor 9 isoform 4                70.1    1e-18   
emb|CDY50434.1|  BnaC07g38640D                                        68.6    1e-18   Brassica napus [oilseed rape]
ref|XP_002864764.1|  hypothetical protein ARALYDRAFT_919450           69.3    1e-18   
ref|XP_010544846.1|  PREDICTED: auxin response factor 18              75.9    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_006292708.1|  hypothetical protein CARUB_v10018954mg           72.8    2e-18   Capsella rubella
ref|XP_010109775.1|  hypothetical protein L484_003135                 63.9    2e-18   
ref|XP_009625131.1|  PREDICTED: auxin response factor 2-like isof...  70.5    2e-18   Nicotiana tomentosiformis
ref|XP_010696146.1|  PREDICTED: auxin response factor 18-like         70.9    2e-18   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY03502.1|  BnaC01g15800D                                        69.3    2e-18   
ref|XP_009137407.1|  PREDICTED: auxin response factor 9-like          73.2    2e-18   Brassica rapa
gb|KHG03862.1|  Auxin response factor 9 -like protein                 69.3    2e-18   Gossypium arboreum [tree cotton]
gb|KJB39716.1|  hypothetical protein B456_007G026900                  69.3    2e-18   Gossypium raimondii
emb|CDY47607.1|  BnaA01g13580D                                        71.2    2e-18   Brassica napus [oilseed rape]
ref|XP_009116845.1|  PREDICTED: auxin response factor 18              78.2    2e-18   Brassica rapa
ref|XP_011073189.1|  PREDICTED: auxin response factor 2-like          71.2    2e-18   Sesamum indicum [beniseed]
ref|XP_006646638.1|  PREDICTED: auxin response factor 4-like          73.2    3e-18   
ref|XP_006413488.1|  hypothetical protein EUTSA_v10024554mg           73.2    3e-18   Eutrema salsugineum [saltwater cress]
ref|NP_194129.1|  auxin response factor 9                             68.9    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KFK35371.1|  hypothetical protein AALP_AA5G276400                  75.5    3e-18   Arabis alpina [alpine rockcress]
gb|EYU21820.1|  hypothetical protein MIMGU_mgv1a001371mg              70.5    3e-18   Erythranthe guttata [common monkey flower]
dbj|BAJ96055.1|  predicted protein                                    72.0    3e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004510661.1|  PREDICTED: auxin response factor 9-like isof...  70.9    4e-18   Cicer arietinum [garbanzo]
gb|KHG20295.1|  Auxin response factor 9 -like protein                 70.5    4e-18   Gossypium arboreum [tree cotton]
gb|EYU21819.1|  hypothetical protein MIMGU_mgv1a001371mg              70.1    4e-18   Erythranthe guttata [common monkey flower]
emb|CDM85878.1|  unnamed protein product                              71.6    4e-18   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010483894.1|  PREDICTED: auxin response factor 2               69.3    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004252281.1|  PREDICTED: auxin response factor 2-like          68.6    4e-18   Solanum lycopersicum
ref|XP_010458034.1|  PREDICTED: auxin response factor 2-like isof...  69.3    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010458051.1|  PREDICTED: auxin response factor 2-like isof...  69.3    4e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008352656.1|  PREDICTED: auxin response factor 18-like iso...  69.7    5e-18   
gb|KHN06318.1|  Auxin response factor 18                              67.8    5e-18   
gb|EMT09779.1|  Auxin response factor 4                               71.6    5e-18   
gb|EYU23309.1|  hypothetical protein MIMGU_mgv1a002989mg              67.8    5e-18   
ref|XP_006583221.1|  PREDICTED: auxin response factor 18-like iso...  67.8    5e-18   
ref|XP_010469026.1|  PREDICTED: auxin response factor 18-like         72.0    5e-18   
ref|XP_006583222.1|  PREDICTED: auxin response factor 18-like iso...  67.8    5e-18   
ref|XP_010325288.1|  PREDICTED: auxin response factor 9 isoform X1    65.1    6e-18   
ref|XP_006346635.1|  PREDICTED: auxin response factor 2-like          69.3    6e-18   
dbj|BAJ85053.1|  predicted protein                                    71.6    6e-18   
ref|NP_001234534.1|  auxin response factor 9                          65.1    6e-18   
ref|XP_010512556.1|  PREDICTED: auxin response factor 18              72.0    7e-18   
ref|XP_006402437.1|  hypothetical protein EUTSA_v10005857mg           74.7    7e-18   
gb|KEH18629.1|  auxin response factor 2                               72.0    7e-18   
emb|CBI35669.3|  unnamed protein product                              68.9    7e-18   
ref|XP_009625132.1|  PREDICTED: auxin response factor 2-like isof...  68.2    8e-18   
ref|XP_002268849.1|  PREDICTED: auxin response factor 2-like          68.9    8e-18   
dbj|BAD93968.1|  ARF1-binding protein                                 69.3    8e-18   
gb|AAK55665.1|AF378862_1  AT5g62000/mtg10_20                          69.3    8e-18   
ref|NP_851244.1|  auxin response factor 2                             69.3    8e-18   
dbj|BAD93891.1|  ARF1-binding protein                                 69.3    8e-18   
ref|NP_001190591.1|  auxin response factor 2                          69.3    8e-18   
ref|XP_010439106.1|  PREDICTED: auxin response factor 9-like isof...  69.3    8e-18   
ref|XP_009404739.1|  PREDICTED: auxin response factor 23-like iso...  70.5    8e-18   
ref|XP_010439105.1|  PREDICTED: auxin response factor 9-like isof...  69.3    9e-18   
ref|XP_009404741.1|  PREDICTED: auxin response factor 23-like iso...  70.5    9e-18   
ref|XP_009404740.1|  PREDICTED: auxin response factor 23-like iso...  70.5    1e-17   
gb|KHN40286.1|  Auxin response factor 9                               71.2    1e-17   
ref|XP_006663482.1|  PREDICTED: auxin response factor 23-like         67.0    1e-17   
ref|XP_010250544.1|  PREDICTED: auxin response factor 2-like isof...  67.4    1e-17   
ref|XP_003529106.1|  PREDICTED: auxin response factor 9-like          70.9    1e-17   
ref|NP_567119.1|  auxin response factor 18                            71.2    1e-17   
gb|KDP22546.1|  hypothetical protein JCGZ_26377                       68.6    1e-17   
ref|XP_010250545.1|  PREDICTED: auxin response factor 2-like isof...  67.4    1e-17   
ref|XP_006279989.1|  hypothetical protein CARUB_v10025860mg           69.3    1e-17   
gb|AFD01315.1|  auxin response factor 18-1                            75.9    1e-17   
ref|XP_004510662.1|  PREDICTED: auxin response factor 9-like isof...  70.9    1e-17   
ref|XP_009592683.1|  PREDICTED: auxin response factor 2-like isof...  65.9    1e-17   
ref|XP_009592685.1|  PREDICTED: auxin response factor 2-like isof...  65.9    1e-17   
ref|XP_002511100.1|  Auxin response factor, putative                  67.4    1e-17   
ref|XP_002869750.1|  predicted protein                                68.9    2e-17   
ref|XP_010926858.1|  PREDICTED: auxin response factor 4-like          68.2    2e-17   
ref|XP_008776920.1|  PREDICTED: auxin response factor 4-like          68.2    2e-17   
ref|XP_009769543.1|  PREDICTED: auxin response factor 2-like isof...  68.2    2e-17   
ref|XP_008437407.1|  PREDICTED: auxin response factor 9               69.3    2e-17   
ref|XP_009769542.1|  PREDICTED: auxin response factor 2-like isof...  68.2    2e-17   
emb|CAC83756.1|  auxin response factor 1                              70.1    2e-17   
sp|Q2R3F5.2|ARFW_ORYSJ  RecName: Full=Auxin response factor 23; A...  69.7    2e-17   
ref|NP_001067988.1|  Os11g0523800                                     69.7    2e-17   
gb|ABG22497.1|  Auxin response factor 2, putative, expressed          69.7    2e-17   
gb|EYU24518.1|  hypothetical protein MIMGU_mgv1a003422mg              68.9    2e-17   
ref|XP_010448631.1|  PREDICTED: auxin response factor 9 isoform X2    69.3    2e-17   
ref|XP_006602602.1|  PREDICTED: auxin response factor 9-like isof...  69.3    2e-17   
gb|KFK43322.1|  hypothetical protein AALP_AA1G109700                  60.8    2e-17   
ref|XP_009112005.1|  PREDICTED: auxin response factor 2-like          70.5    2e-17   
gb|EMS47784.1|  Auxin response factor 4                               71.6    2e-17   
ref|XP_009142634.1|  PREDICTED: auxin response factor 11              66.6    3e-17   
ref|XP_006844540.1|  hypothetical protein AMTR_s00016p00168950        70.9    3e-17   
ref|XP_010413341.1|  PREDICTED: auxin response factor 18-like         69.7    3e-17   
ref|XP_006397845.1|  hypothetical protein EUTSA_v10001365mg           70.1    3e-17   
emb|CDY16798.1|  BnaA09g05840D                                        70.1    3e-17   
ref|XP_010099050.1|  Auxin response factor 2                          68.2    3e-17   
ref|XP_006394444.1|  hypothetical protein EUTSA_v10003641mg           69.3    3e-17   
dbj|BAJ34183.1|  unnamed protein product                              69.3    3e-17   
gb|AFD01295.1|  auxin response factor 2-3                             70.1    3e-17   
ref|XP_006285168.1|  hypothetical protein CARUB_v10006513mg           67.4    3e-17   
gb|KHN04711.1|  Auxin response factor 9                               68.9    3e-17   
ref|XP_010318417.1|  PREDICTED: auxin response factor 2 isoform X2    67.8    3e-17   
ref|XP_011042961.1|  PREDICTED: auxin response factor 2-like          67.0    3e-17   
ref|XP_010433833.1|  PREDICTED: auxin response factor 9-like isof...  69.3    3e-17   
ref|XP_010433834.1|  PREDICTED: auxin response factor 9-like isof...  69.3    3e-17   
ref|XP_008672541.1|  PREDICTED: uncharacterized protein LOC100274...  72.0    3e-17   
ref|XP_003552183.1|  PREDICTED: auxin response factor 9-like isof...  68.9    3e-17   
gb|KHN09922.1|  Auxin response factor 9                               68.9    3e-17   
ref|XP_002318767.1|  auxin response factor 2 family protein           67.0    3e-17   
gb|AAP06759.1|  auxin response factor-like protein                    64.7    3e-17   
gb|ADG43144.1|  auxin response factor 10                              72.0    3e-17   
ref|XP_009798135.1|  PREDICTED: auxin response factor 2-like isof...  67.8    3e-17   
ref|XP_008808096.1|  PREDICTED: auxin response factor 18-like         72.0    3e-17   
ref|XP_009798136.1|  PREDICTED: auxin response factor 2-like isof...  68.2    3e-17   
sp|A2ZET6.1|ARFW_ORYSI  RecName: Full=Auxin response factor 23; A...  69.3    3e-17   
emb|CDX87230.1|  BnaC09g05450D                                        70.1    3e-17   
ref|NP_001233765.1|  auxin response factor 2                          67.8    3e-17   
ref|XP_009151321.1|  PREDICTED: auxin response factor 2               69.3    3e-17   
emb|CDY00245.1|  BnaA06g21460D                                        69.3    4e-17   
gb|KJB49580.1|  hypothetical protein B456_008G126200                  68.9    4e-17   
ref|XP_007140507.1|  hypothetical protein PHAVU_008G118400g           63.9    4e-17   
ref|XP_007140506.1|  hypothetical protein PHAVU_008G118400g           63.9    4e-17   
gb|KJB49574.1|  hypothetical protein B456_008G126200                  68.9    4e-17   
ref|XP_002523326.1|  Auxin response factor, putative                  73.9    4e-17   
gb|KFK37437.1|  auxin response factor 11                              72.0    4e-17   
gb|KDP28473.1|  hypothetical protein JCGZ_14244                       74.7    4e-17   
ref|XP_009421031.1|  PREDICTED: auxin response factor 24-like iso...  70.5    4e-17   
ref|XP_010237692.1|  PREDICTED: auxin response factor 23-like iso...  69.3    4e-17   
gb|KJB49578.1|  hypothetical protein B456_008G126200                  68.9    4e-17   
ref|XP_010237689.1|  PREDICTED: auxin response factor 23-like iso...  69.3    4e-17   
gb|KJB49575.1|  hypothetical protein B456_008G126200                  68.9    4e-17   
ref|XP_009138752.1|  PREDICTED: auxin response factor 18-like         73.6    4e-17   
ref|XP_009421032.1|  PREDICTED: auxin response factor 24-like iso...  70.5    4e-17   
ref|XP_010924913.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  75.5    4e-17   
gb|KJB49576.1|  hypothetical protein B456_008G126200                  68.9    4e-17   
ref|XP_008451925.1|  PREDICTED: auxin response factor 18-like         67.0    4e-17   
gb|KJB49579.1|  hypothetical protein B456_008G126200                  68.9    4e-17   
ref|XP_011083049.1|  PREDICTED: auxin response factor 2               70.1    4e-17   
ref|XP_010678349.1|  PREDICTED: auxin response factor 2               65.5    5e-17   
gb|KGN53424.1|  hypothetical protein Csa_4G052740                     67.0    5e-17   
ref|XP_004149012.1|  PREDICTED: auxin response factor 9-like          67.0    5e-17   
ref|NP_001275789.1|  auxin-response factor                            68.6    5e-17   
gb|KJB49577.1|  hypothetical protein B456_008G126200                  68.6    5e-17   
ref|XP_009592684.1|  PREDICTED: auxin response factor 2-like isof...  66.2    5e-17   
ref|XP_006436945.1|  hypothetical protein CICLE_v10030696mg           68.6    5e-17   
ref|XP_006436944.1|  hypothetical protein CICLE_v10030696mg           68.6    5e-17   
ref|XP_004173524.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  67.0    6e-17   
ref|XP_008376147.1|  PREDICTED: auxin response factor 18 isoform X2   63.2    6e-17   
dbj|BAJ34449.1|  unnamed protein product                              70.1    6e-17   
gb|KJB51289.1|  hypothetical protein B456_008G210200                  67.4    7e-17   
gb|KJB51286.1|  hypothetical protein B456_008G210200                  67.0    7e-17   
ref|XP_003630586.1|  Auxin response factor-like protein               65.5    7e-17   
gb|KJB51282.1|  hypothetical protein B456_008G210200                  67.0    7e-17   
ref|XP_009130187.1|  PREDICTED: auxin response factor 2-like          68.9    7e-17   
gb|KJB51283.1|  hypothetical protein B456_008G210200                  67.0    7e-17   
gb|AES87135.2|  auxin response factor 2                               62.0    8e-17   
ref|XP_003630585.1|  Auxin response factor-like protein               65.5    8e-17   
ref|XP_003604938.1|  Auxin response factor                            62.0    8e-17   
ref|XP_003630584.1|  Auxin response factor-like protein               65.5    8e-17   
gb|AET05061.2|  auxin response factor 2                               65.5    8e-17   
gb|KEH29045.1|  auxin response factor 2                               62.0    8e-17   
ref|XP_003630583.1|  Auxin response factor-like protein               65.5    9e-17   
ref|XP_008656904.1|  PREDICTED: auxin response factor 4               72.0    9e-17   
gb|AFW84067.1|  hypothetical protein ZEAMMB73_313624                  72.0    9e-17   
gb|AFW84065.1|  hypothetical protein ZEAMMB73_313624                  72.0    9e-17   
ref|NP_001066765.1|  Os12g0479400                                     61.2    9e-17   
gb|KHN16369.1|  Auxin response factor 9                               65.1    9e-17   
gb|KGN50008.1|  hypothetical protein Csa_5G148790                     69.3    9e-17   
gb|EPS69726.1|  hypothetical protein M569_05037                       65.5    9e-17   
sp|Q2QQX6.1|ARFX_ORYSJ  RecName: Full=Auxin response factor 24        61.2    9e-17   
gb|EEE53204.1|  hypothetical protein OsJ_36082                        61.2    9e-17   
ref|XP_003520962.1|  PREDICTED: auxin response factor 9-like          65.1    1e-16   
ref|XP_007038118.1|  Auxin response factor-like protein isoform 1     68.6    1e-16   
gb|ACN34502.1|  unknown                                               72.0    1e-16   
gb|ADG43159.1|  auxin response factor 25                              72.0    1e-16   
ref|XP_006664554.1|  PREDICTED: auxin response factor 24-like         61.2    1e-16   
gb|AET05059.2|  auxin response factor 2                               65.5    1e-16   
ref|XP_002284543.1|  PREDICTED: auxin response factor 2               65.5    1e-16   
ref|XP_007038119.1|  Auxin response factor-like protein isoform 2     68.6    1e-16   
ref|XP_004143952.1|  PREDICTED: auxin response factor 9-like          68.9    1e-16   
emb|CAN67897.1|  hypothetical protein VITISV_040395                   65.9    1e-16   
ref|XP_008239553.1|  PREDICTED: auxin response factor 2               67.0    1e-16   
gb|EEE55935.1|  hypothetical protein OsJ_04626                        72.4    1e-16   
ref|XP_008791040.1|  PREDICTED: auxin response factor 23-like iso...  71.2    1e-16   
ref|XP_008791039.1|  PREDICTED: auxin response factor 23-like iso...  71.2    1e-16   
gb|EEC72083.1|  hypothetical protein OsI_05027                        72.4    1e-16   
ref|XP_006341482.1|  PREDICTED: auxin response factor 2-like          67.8    1e-16   
gb|EEC69273.1|  hypothetical protein OsI_38317                        60.8    1e-16   
tpg|DAA56015.1|  TPA: hypothetical protein ZEAMMB73_705793            70.1    1e-16   
ref|XP_004503803.1|  PREDICTED: auxin response factor 2-like          65.5    1e-16   
dbj|BAB85913.1|  auxin response factor 2                              72.4    1e-16   
ref|NP_001045270.1|  Os01g0927600                                     72.4    1e-16   
gb|KJB07943.1|  hypothetical protein B456_001G054600                  68.2    1e-16   
ref|XP_004165777.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  68.9    2e-16   
ref|XP_007210901.1|  hypothetical protein PRUPE_ppa001392mg           67.0    2e-16   
dbj|BAO45870.1|  auxin response factor                                66.6    2e-16   
gb|KCW86993.1|  hypothetical protein EUGRSUZ_B03551                   69.3    2e-16   
ref|XP_010237262.1|  PREDICTED: auxin response factor 24-like         61.2    2e-16   
ref|XP_010448630.1|  PREDICTED: auxin response factor 9 isoform X1    69.3    2e-16   
ref|XP_009389945.1|  PREDICTED: auxin response factor 11-like         69.7    2e-16   
emb|CDX86939.1|  BnaC03g52090D                                        68.2    2e-16   
ref|XP_010044876.1|  PREDICTED: auxin response factor 2-like          68.9    2e-16   
ref|XP_009373631.1|  PREDICTED: auxin response factor 2-like          66.6    2e-16   
ref|XP_010433831.1|  PREDICTED: auxin response factor 9-like isof...  69.3    2e-16   
ref|XP_010433832.1|  PREDICTED: auxin response factor 9-like isof...  69.3    2e-16   
gb|AAG43286.2|AF140228_1  putative auxin response factor 1            66.2    2e-16   
gb|KHG00740.1|  Auxin response factor 2 -like protein                 67.4    2e-16   
gb|KHN36953.1|  Auxin response factor 9                               65.1    2e-16   
ref|XP_006573317.1|  PREDICTED: auxin response factor 9-like          65.1    2e-16   
emb|CDX80025.1|  BnaA05g01310D                                        66.6    3e-16   
gb|AAW82475.1|  auxin response factor 2                               76.3    3e-16   
ref|XP_004506577.1|  PREDICTED: auxin response factor 9-like          62.0    3e-16   
gb|KFK28953.1|  hypothetical protein AALP_AA7G070000                  69.3    3e-16   
ref|XP_010547792.1|  PREDICTED: auxin response factor 2-like          66.2    3e-16   
emb|CDY67247.1|  BnaCnng54100D                                        68.9    3e-16   
ref|XP_009410808.1|  PREDICTED: auxin response factor 9-like isof...  72.8    3e-16   
ref|XP_009410807.1|  PREDICTED: auxin response factor 18-like iso...  72.8    3e-16   
ref|XP_006431458.1|  hypothetical protein CICLE_v10003317mg           87.4    3e-16   
ref|XP_011023161.1|  PREDICTED: auxin response factor 18 isoform X1   67.0    3e-16   
ref|XP_010518327.1|  PREDICTED: auxin response factor 11-like iso...  68.6    5e-16   
ref|XP_003532359.1|  PREDICTED: auxin response factor 2-like          65.9    5e-16   
ref|XP_010912174.1|  PREDICTED: auxin response factor 11 isoform X1   68.6    5e-16   
ref|XP_006293856.1|  hypothetical protein CARUB_v10022841mg           65.5    5e-16   
ref|XP_008392709.1|  PREDICTED: auxin response factor 2-like          66.2    5e-16   
ref|XP_007043809.1|  Auxin response factor 2 isoform 1                68.9    5e-16   
ref|XP_003525433.1|  PREDICTED: auxin response factor 2-like isof...  66.2    6e-16   
ref|XP_007043810.1|  Auxin response factor 2 isoform 2                68.9    6e-16   
gb|KDO51288.1|  hypothetical protein CISIN_1g004792mg                 68.6    6e-16   
ref|XP_010249209.1|  PREDICTED: auxin response factor 2-like isof...  66.2    6e-16   
ref|XP_008376148.1|  PREDICTED: auxin response factor 18 isoform X3   63.2    6e-16   
ref|XP_006580627.1|  PREDICTED: auxin response factor 2-like isof...  66.2    6e-16   
ref|XP_007043812.1|  Auxin response factor 2 isoform 4                68.9    6e-16   
ref|XP_010249208.1|  PREDICTED: auxin response factor 2-like isof...  66.2    6e-16   
ref|XP_007137862.1|  hypothetical protein PHAVU_009G161900g           65.5    6e-16   
ref|NP_001280753.1|  ADP-ribosylation factor 1                        63.2    6e-16   
ref|XP_009421471.1|  PREDICTED: auxin response factor 11-like         67.8    6e-16   
gb|KDO51286.1|  hypothetical protein CISIN_1g004792mg                 68.2    6e-16   
ref|XP_010912181.1|  PREDICTED: auxin response factor 11 isoform X2   68.6    6e-16   
gb|KDO51285.1|  hypothetical protein CISIN_1g004792mg                 68.2    6e-16   
gb|KDO51287.1|  hypothetical protein CISIN_1g004792mg                 68.2    6e-16   
ref|XP_007043811.1|  Auxin response factor 2 isoform 3                68.9    6e-16   
emb|CDP19763.1|  unnamed protein product                              68.9    7e-16   
ref|XP_002880250.1|  hypothetical protein ARALYDRAFT_904120           67.8    7e-16   
ref|XP_007159966.1|  hypothetical protein PHAVU_002G282200g           66.2    7e-16   
gb|KHG08457.1|  Auxin response factor 2 -like protein                 70.1    8e-16   
gb|KHN09718.1|  Auxin response factor 2                               67.4    8e-16   
gb|KJB40060.1|  hypothetical protein B456_007G044900                  69.7    8e-16   
gb|KJB40059.1|  hypothetical protein B456_007G044900                  69.7    8e-16   
gb|KJB40061.1|  hypothetical protein B456_007G044900                  70.1    8e-16   
ref|XP_011023162.1|  PREDICTED: auxin response factor 18 isoform X2   67.0    9e-16   
ref|XP_009403790.1|  PREDICTED: auxin response factor 24-like iso...  65.5    9e-16   
ref|XP_002456888.1|  hypothetical protein SORBIDRAFT_03g044630        72.0    9e-16   
ref|XP_006386630.1|  hypothetical protein POPTR_0002s17350g           67.0    9e-16   
ref|XP_010506661.1|  PREDICTED: auxin response factor 11              67.4    9e-16   
ref|XP_004172696.1|  PREDICTED: auxin response factor 2-like          68.2    9e-16   
ref|XP_004138020.1|  PREDICTED: auxin response factor 2-like          68.6    9e-16   



>ref|XP_006349280.1| PREDICTED: auxin response factor 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006349281.1| PREDICTED: auxin response factor 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006349282.1| PREDICTED: auxin response factor 1-like isoform X3 [Solanum tuberosum]
Length=654

 Score =   140 bits (353),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SSRWPDS+WRSLK              +SPW++E LV +TP   QPP
Sbjct  311  RFSGTIVGVGDNPSSRWPDSEWRSLKVHWDEPSSILRPDRVSPWDMEPLVAATPTNTQPP  370

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILKHL  203
            QRNKRARP+ LP  V E  ALG WKSP+DSP SFSYCD SRG D +PSPKL    K L
Sbjct  371  QRNKRARPSVLPSPVQELPALGMWKSPVDSPSSFSYCDPSRGRDLYPSPKLSSAAKGL  428


 Score = 95.5 bits (236),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTS+SEFIVSVNKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAISTGTLFSVFYKPRTSQSEFIVSVNKYLEARNHKLSVGMRFKMRFEGEEVPER  310



>ref|NP_001234871.1| auxin response factor 1 [Solanum lycopersicum]
 gb|ADJ10892.1| auxin response factor 1 [Solanum lycopersicum]
Length=654

 Score =   140 bits (353),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SSRWPDS+WRSLK              +SPW++E LV +TP   QPP
Sbjct  311  RFSGTIVGVGDNPSSRWPDSEWRSLKVHWDEPSSILRPDRVSPWDMEPLVAATPTNTQPP  370

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILKHL  203
            QRNKRARP+ LP  V E  ALG WKSP+DSP SFSYCD SRG D +PSPKL    K L
Sbjct  371  QRNKRARPSVLPSPVQELPALGMWKSPVDSPSSFSYCDPSRGRDLYPSPKLSSAAKGL  428


 Score = 94.4 bits (233),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTS+SEFIVSVNKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAIMTGTLFSVFYKPRTSQSEFIVSVNKYLEARNHKLSVGMRFKMRFEGEEVPER  310



>ref|XP_010323707.1| PREDICTED: auxin response factor 1 isoform X1 [Solanum lycopersicum]
Length=654

 Score =   140 bits (353),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 81/118 (69%), Gaps = 11/118 (9%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SSRWPDS+WRSLK              +SPW++E LV +TP   QPP
Sbjct  311  RFSGTIVGVGDNPSSRWPDSEWRSLKVHWDEPSSILRPDRVSPWDMEPLVAATPTNTQPP  370

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILKHL  203
            QRNKRARP+ LP  V E  ALG WKSP+DSP SFSYCD SRG D +PSPKL    K L
Sbjct  371  QRNKRARPSVLPSPVQELPALGMWKSPVDSPSSFSYCDPSRGRDLYPSPKLSSAAKGL  428


 Score = 94.4 bits (233),  Expect(2) = 9e-53, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTS+SEFIVSVNKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAIMTGTLFSVFYKPRTSQSEFIVSVNKYLEARNHKLSVGMRFKMRFEGEEVPER  310



>ref|XP_009627009.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
 ref|XP_009627014.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
 ref|XP_009627020.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
 ref|XP_009627027.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
Length=654

 Score =   138 bits (348),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 78/111 (70%), Gaps = 11/111 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV +NTSSRWPDS+WRSLK              +SPWEIE LVT+TP   QPP
Sbjct  310  RFSGTIVGVGENTSSRWPDSEWRSLKVHWDEPSSILRPDRVSPWEIEPLVTATPTNTQPP  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP  LP  V E  ALG WKSP DSP SF YCD SRG D +PSPKL
Sbjct  370  QRNKRARPQVLPSPVQELPALGMWKSPGDSPSSFPYCDPSRGRDLYPSPKL  420


 Score = 94.4 bits (233),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSV+Y+PRTS+SEFIVSVNKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  251  ATASHAISTGTLFSVYYKPRTSQSEFIVSVNKYLEARNHKLSVGMRFKMRFEGEEVPER  309



>ref|XP_009786487.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
 ref|XP_009786488.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
 ref|XP_009786489.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
 ref|XP_009786490.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
Length=653

 Score =   129 bits (324),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 77/111 (69%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV +NTSSRWPDS+WRSLK              +SPWEIE LVT+TP   QP 
Sbjct  310  RFSGTIVGVGENTSSRWPDSEWRSLKVHWDEPSSILRPDRVSPWEIEPLVTATPTNTQP-  368

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP+ LP  V E  ALG WKSP DSP SF YCD SRG D + SPKL
Sbjct  369  QRNKRARPSVLPSPVQELPALGMWKSPGDSPSSFPYCDPSRGRDLYASPKL  419


 Score = 94.4 bits (233),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSV+Y+PRTS+SEFIVSVNKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  251  ATASHAISTGTLFSVYYKPRTSQSEFIVSVNKYLEARNHKLSVGMRFKMRFEGEEVPER  309



>ref|XP_011087626.1| PREDICTED: auxin response factor 1-like [Sesamum indicum]
Length=665

 Score =   113 bits (283),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 72/111 (65%), Gaps = 11/111 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG  +N SSRWPDS+WRSLK             T+SPWEIE LV +TP   Q  
Sbjct  310  RFSGTIVGFVNNASSRWPDSEWRSLKVQWDEPSPILRPDTVSPWEIEPLVAATPPNSQNQ  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP  LP  + + S+LG WKSP DSP +F Y D SR  D + SPKL
Sbjct  370  QRNKRARPPALPSPMQDLSSLGMWKSPADSPSAFPYHDPSRVRDLYQSPKL  420


 Score =   100 bits (250),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+TRTLFSVFY+PRTSRSEFIVS+NKY+EAQNH LSVG    MRFEGEEVPER
Sbjct  251  ATASHAISTRTLFSVFYKPRTSRSEFIVSLNKYLEAQNHKLSVGMRFKMRFEGEEVPER  309



>emb|CDO97653.1| unnamed protein product [Coffea canephora]
Length=433

 Score =   115 bits (287),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 74/111 (67%), Gaps = 15/111 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV +NTSSRWPDS+WRSLK              +SPWEIE LV +TP    PP
Sbjct  82   RFSGTIVGVGENTSSRWPDSQWRSLKVQWDEPSSIVRPDRVSPWEIEPLVAATPPNPLPP  141

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP  LP ++ + S+LG WKS ++      YCDTSR  D +PSPKL
Sbjct  142  QRNKRARPPVLPLAMQDLSSLGVWKSSVEPL----YCDTSRSHDFYPSPKL  188


 Score = 97.4 bits (241),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFIVSVNKY+EAQ+H LSVGMR    FEGEEVPER
Sbjct  23   ATASHAISTGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMTFEGEEVPER  81



>ref|XP_002268348.2| PREDICTED: auxin response factor 1 isoform X1 [Vitis vinifera]
Length=678

 Score =   110 bits (276),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 72/118 (61%), Gaps = 13/118 (11%)
 Frame = -1

Query  523  RFSGTIVGVQD-NTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTST-PQTLQ  383
            RFSGTIVGV D NTSS W DS+WRSLK              +S WE+E LV +  P  LQ
Sbjct  311  RFSGTIVGVGDKNTSSGWADSEWRSLKVQWDEPASIFRPERVSAWELEPLVAAAAPTNLQ  370

Query  382  PPQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
            P QRNKRARP  LP +  + S LG WKS ++SP  F YCD  RG D +PSPK   I K
Sbjct  371  PAQRNKRARPPVLPSATPDLSVLGMWKSSVESPSGFPYCDPHRGRDLYPSPKFSSITK  428


 Score = 95.9 bits (237),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFIVS+NKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSEFIVSLNKYLEARNHKLSVGMRFKMRFEGEEVPER  310



>ref|XP_010657917.1| PREDICTED: auxin response factor 1 isoform X2 [Vitis vinifera]
 emb|CBI29640.3| unnamed protein product [Vitis vinifera]
Length=678

 Score =   110 bits (276),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 72/118 (61%), Gaps = 13/118 (11%)
 Frame = -1

Query  523  RFSGTIVGVQD-NTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTST-PQTLQ  383
            RFSGTIVGV D NTSS W DS+WRSLK              +S WE+E LV +  P  LQ
Sbjct  311  RFSGTIVGVGDKNTSSGWADSEWRSLKVQWDEPASIFRPERVSAWELEPLVAAAAPTNLQ  370

Query  382  PPQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
            P QRNKRARP  LP +  + S LG WKS ++SP  F YCD  RG D +PSPK   I K
Sbjct  371  PAQRNKRARPPVLPSATPDLSVLGMWKSSVESPSGFPYCDPHRGRDLYPSPKFSSITK  428


 Score = 95.9 bits (237),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFIVS+NKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSEFIVSLNKYLEARNHKLSVGMRFKMRFEGEEVPER  310



>ref|XP_010099783.1| Auxin response factor 1 [Morus notabilis]
 gb|EXB80401.1| Auxin response factor 1 [Morus notabilis]
Length=666

 Score =   112 bits (281),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 72/112 (64%), Gaps = 11/112 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN S  WP+S+WRSLK              +SPWE+E LV + P   QP 
Sbjct  303  RFSGTIVGVGDNASFGWPNSEWRSLKVQWDEPSSILRPDRVSPWELEPLVATPPPNSQPT  362

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLK  221
             RNKRARP+ LP   S+ S LGTWKSP++SP + SYCD  RG + +PSPK  
Sbjct  363  PRNKRARPSVLPSPSSDISVLGTWKSPLESPSTLSYCDPQRGQEPYPSPKFN  414


 Score = 93.6 bits (231),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  244  ATASHAISTGTLFSVFYKPRTSRSEFLVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  302



>ref|XP_011092260.1| PREDICTED: auxin response factor 1 isoform X1 [Sesamum indicum]
Length=667

 Score =   107 bits (266),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 70/111 (63%), Gaps = 11/111 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG++D +SSRWP+S+WRSLK              +SPWEIE LV   P TLQ  
Sbjct  310  RFSGTIVGIEDYSSSRWPNSEWRSLKVQWDEPSAILRPDRVSPWEIETLVGPPPPTLQTQ  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
             RNKRARP  LP  +   S+LG WKSP +SP +F Y D S G D + S KL
Sbjct  370  HRNKRARPTILPSPMQNLSSLGMWKSPAESPSAFRYRDLSHGRDPYQSLKL  420


 Score = 94.0 bits (232),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VS+NKY+EA+NH L VGMR    FEGEEVPER
Sbjct  251  ATASHAISTGTLFSVFYKPRTSRSEFVVSLNKYLEAKNHKLPVGMRFKMSFEGEEVPER  309



>ref|XP_008218645.1| PREDICTED: auxin response factor 1 [Prunus mume]
 ref|XP_008218646.1| PREDICTED: auxin response factor 1 [Prunus mume]
Length=678

 Score =   107 bits (268),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DNTS  W +S+WRSLK              +SPWE+E LV +TP   QP 
Sbjct  310  RFSGTIVGVCDNTSPGWANSEWRSLKVQWDEPSSILRPDRVSPWELEPLVATTPLNSQPA  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPK  227
             RNKRARP  LP    + SALG WKS ++SP +FSY D  RG D +PSPK
Sbjct  370  LRNKRARPPVLPSPSPDLSALGEWKSQVESPSAFSYSDPQRGRDIYPSPK  419


 Score = 92.8 bits (229),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEF+VSVNKY+EA +H LSVG    MRFEGEEVPER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFLVSVNKYLEAHSHKLSVGMRFKMRFEGEEVPER  309



>ref|XP_007225153.1| hypothetical protein PRUPE_ppa002394mg [Prunus persica]
 gb|EMJ26352.1| hypothetical protein PRUPE_ppa002394mg [Prunus persica]
Length=678

 Score =   107 bits (268),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DNTS  W +S+WRSLK              +SPWE+E LV +TP   QP 
Sbjct  310  RFSGTIVGVCDNTSPGWANSEWRSLKVQWDEPSSILRPDRVSPWELEPLVATTPLNSQPA  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPK  227
             RNKRARP  LP    + SALG WKS ++SP +FSY D  RG D +PSPK
Sbjct  370  LRNKRARPPVLPSPSPDLSALGEWKSQVESPSAFSYSDPQRGRDIYPSPK  419


 Score = 92.8 bits (229),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEF+VSVNKY+EA +H LSVG    MRFEGEEVPER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFLVSVNKYLEAHSHKLSVGMRFKMRFEGEEVPER  309



>ref|XP_011003708.1| PREDICTED: auxin response factor 1-like [Populus euphratica]
 ref|XP_011003709.1| PREDICTED: auxin response factor 1-like [Populus euphratica]
Length=660

 Score =   102 bits (255),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS+WRSLK              +SPW++E LV +TP   QP 
Sbjct  306  RFSGTIVGVGDNISSGWADSEWRSLKVHWDEPSSILRPERVSPWDLEPLVATTPSNSQPM  365

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
            QRNKR RP+ LP   ++ SALG WK  ++S  +FSY ++ RG D +PSP      K
Sbjct  366  QRNKRPRPSVLPSPTADLSALGMWKPSVES-SAFSYGESQRGRDPYPSPNFSTTAK  420


 Score = 97.1 bits (240),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFIV++NKYIEAQNH LSVG    MRFEGEEVPER
Sbjct  247  ATASHAISTGTLFSVFYKPRTSRSEFIVNLNKYIEAQNHKLSVGMRFKMRFEGEEVPER  305



>ref|XP_004300014.1| PREDICTED: auxin response factor 1 [Fragaria vesca subsp. vesca]
 ref|XP_011464939.1| PREDICTED: auxin response factor 1 [Fragaria vesca subsp. vesca]
Length=675

 Score =   108 bits (269),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DNTS  W +S+WRSLK              +SPWE+E LV +TP  LQP 
Sbjct  309  RFSGTIVGVGDNTSPGWSNSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVATTPLNLQPA  368

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPK  227
             RNKRAR   LP S  + S+LG WKS  +SP +FSY D  RG D +PSPK
Sbjct  369  LRNKRARAPVLPSSTPDLSSLGEWKSQAESPSAFSYNDPQRGRDLYPSPK  418


 Score = 91.7 bits (226),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTS+SEF+VSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  250  ATASHAIATGTLFSVFYKPRTSQSEFLVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  308



>ref|XP_008378943.1| PREDICTED: auxin response factor 1 [Malus domestica]
 ref|XP_008378944.1| PREDICTED: auxin response factor 1 [Malus domestica]
Length=677

 Score =   108 bits (270),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 71/110 (65%), Gaps = 11/110 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DNT+  W +S+WRSLK              +SPW++E LV +TPQ  QP 
Sbjct  310  RFSGTIVGVGDNTAPGWANSEWRSLKVQWDEPSSILRPDRVSPWDLEPLVATTPQNSQPA  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPK  227
             RNKRARP  LP    + SALG WKS  +SP +FSY D+ RG D +PSPK
Sbjct  370  LRNKRARPPVLPSPSPDLSALGEWKSKAESPXAFSYSDSQRGRDIYPSPK  419


 Score = 90.9 bits (224),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEF+VSVNKYIEA++  LSVG    MRFEGEEVPER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFLVSVNKYIEARSQKLSVGMRFKMRFEGEEVPER  309



>ref|XP_006385188.1| auxin response factor 1 family protein [Populus trichocarpa]
 gb|ERP62985.1| auxin response factor 1 family protein [Populus trichocarpa]
Length=660

 Score =   102 bits (254),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 70/116 (60%), Gaps = 12/116 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS+WRSLK              +SPW++E LV +TP   QP 
Sbjct  306  RFSGTIVGVGDNISSGWADSEWRSLKVHWDEPSSILRPERVSPWDLEPLVATTPSNSQPM  365

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
            QRNKR RP+ LP   +  SALG WK  ++S  +FSY ++ RG D +PSP      K
Sbjct  366  QRNKRPRPSVLPSPTANLSALGMWKPSVES-SAFSYGESQRGRDPYPSPNFSTTAK  420


 Score = 95.9 bits (237),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIV++NKYIEAQNH LSVG    MRFEGEEVPER
Sbjct  247  ATASHAIVTGTLFSVFYKPRTSRSEFIVNLNKYIEAQNHKLSVGMRFKMRFEGEEVPER  305



>ref|XP_009355376.1| PREDICTED: auxin response factor 1 [Pyrus x bretschneideri]
Length=677

 Score =   105 bits (263),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 70/110 (64%), Gaps = 11/110 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DNT+  W +S+WRSLK              +SPW++E LV + PQ  QP 
Sbjct  310  RFSGTIVGVGDNTAPGWANSEWRSLKVQWDEPSSILRPDRVSPWDLEPLVATAPQNSQPA  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPK  227
             RNKRARP  LP    + +ALG WKS  +SP +FSY D+ RG D +PSPK
Sbjct  370  LRNKRARPPVLPSPSPDLTALGEWKSKAESPSAFSYSDSQRGRDIYPSPK  419


 Score = 91.3 bits (225),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEF+VSVNKYIEA++  LSVG    MRFEGEEVPER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFLVSVNKYIEARSQKLSVGMRFKMRFEGEEVPER  309



>ref|XP_011028402.1| PREDICTED: auxin response factor 1 [Populus euphratica]
 ref|XP_011028403.1| PREDICTED: auxin response factor 1 [Populus euphratica]
 ref|XP_011028404.1| PREDICTED: auxin response factor 1 [Populus euphratica]
Length=662

 Score =   103 bits (257),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS WRSLK              +S WE+E LV +TP   QP 
Sbjct  311  RFSGTIVGVGDNISSGWADSDWRSLKVQWDEPSSIMRPERVSHWELEPLVATTPSNSQPV  370

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP  +P   ++ SALG WKSP++S  + SY D+ RG D + SP  
Sbjct  371  QRNKRARPYVIPSPTADLSALGMWKSPVES-SALSYGDSQRGRDLYSSPNF  420


 Score = 93.2 bits (230),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVS+NKY+E +NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEVRNHKLSVGMRFKMRFEGEEVPER  310



>ref|XP_006385086.1| hypothetical protein POPTR_0004s23770g [Populus trichocarpa]
 ref|XP_006385087.1| auxin response factor 1 family protein [Populus trichocarpa]
 gb|ERP62883.1| hypothetical protein POPTR_0004s23770g [Populus trichocarpa]
 gb|ERP62884.1| auxin response factor 1 family protein [Populus trichocarpa]
Length=662

 Score =   103 bits (257),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS WRSLK              +S WE+E LV +TP   QP 
Sbjct  311  RFSGTIVGVGDNISSGWADSDWRSLKVQWDEPSSIMRPERVSHWELEPLVATTPSNSQPV  370

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP  +P   ++ SALG WKSP++S  + SY D+ RG D + SP  
Sbjct  371  QRNKRARPYVIPSPTADLSALGMWKSPVES-SALSYGDSQRGRDLYSSPNF  420


 Score = 93.2 bits (230),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVS+NKY+E +NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEVRNHKLSVGMRFKMRFEGEEVPER  310



>gb|AIR95657.1| auxin response factor 1 family protein [Populus davidiana x Populus 
alba var. pyramidalis]
Length=660

 Score = 99.8 bits (247),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 55/116 (47%), Positives = 71/116 (61%), Gaps = 12/116 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV D+ SS W DS+WRSLK              +SPW++E LV +TP   QP 
Sbjct  306  RFSGTIVGVGDDISSGWADSEWRSLKIHWDEPSSILRPERVSPWDLEPLVATTPSNSQPM  365

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
            QRNKR RP+ LP   ++ SALG WK  ++S  +F+Y ++ RG D +PSP      K
Sbjct  366  QRNKRPRPSVLPSPTADLSALGIWKPSVES-SAFAYGESQRGRDPYPSPNFSTTAK  420


 Score = 96.7 bits (239),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIV++NKYIEAQNH LSVG    MRFEGEEVPER
Sbjct  247  ATASHAIATGTLFSVFYKPRTSRSEFIVNLNKYIEAQNHKLSVGMRFKMRFEGEEVPER  305



>ref|XP_010252371.1| PREDICTED: auxin response factor 1 [Nelumbo nucifera]
Length=681

 Score =   101 bits (252),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 68/109 (62%), Gaps = 12/109 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV +N S  W D++WRSLK              +SPWE+E LV + P T QP 
Sbjct  310  RFSGTIIGVGENASPWWADTEWRSLKVQWDEPSSIPRPDRVSPWELEPLVATAPSTSQPV  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSP  230
            QRNKRARP  LPP  S+ S  G WKSP++S  +FSY    RG D +PSP
Sbjct  370  QRNKRARPPVLPPPTSDVSVFGMWKSPVES-STFSYSGLHRGRDLYPSP  417


 Score = 94.0 bits (232),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFI+SVNKY+EA+NH LSVG    MRFEGEE PER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFIISVNKYLEARNHKLSVGMRFKMRFEGEEAPER  309



>ref|XP_003592874.1| Auxin response factor [Medicago truncatula]
 gb|AES63125.1| auxin response factor 2 [Medicago truncatula]
Length=671

 Score = 99.8 bits (247),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+DN SS W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  308  RFSGTIVGVEDNKSSVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSTPPANSQPT  367

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKR+RP  LP ++++ S  G WKSP DSP  F Y D   G D +PSP+ 
Sbjct  368  QRNKRSRPPILPSTMTDSSLQGIWKSPADSP-PFPYRDPQHGRDLYPSPRF  417


 Score = 95.1 bits (235),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFIVS+NKY+EA+NH LSVG    MRFEG+EVPER
Sbjct  249  ATASHAISTGTLFSVFYKPRTSRSEFIVSINKYLEARNHKLSVGMRFKMRFEGDEVPER  307



>gb|ABO80473.1| AUX/IAA protein; Transcriptional factor B3; Auxin response factor 
[Medicago truncatula]
Length=670

 Score = 99.8 bits (247),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 70/111 (63%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+DN SS W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  307  RFSGTIVGVEDNKSSVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSTPPANSQPT  366

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKR+RP  LP ++++ S  G WKSP DSP  F Y D   G D +PSP+ 
Sbjct  367  QRNKRSRPPILPSTMTDSSLQGIWKSPADSP-PFPYRDPQHGRDLYPSPRF  416


 Score = 95.1 bits (235),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFIVS+NKY+EA+NH LSVG    MRFEG+EVPER
Sbjct  248  ATASHAISTGTLFSVFYKPRTSRSEFIVSINKYLEARNHKLSVGMRFKMRFEGDEVPER  306



>ref|XP_007023118.1| Auxin response factor 1 isoform 1 [Theobroma cacao]
 gb|EOY25740.1| Auxin response factor 1 isoform 1 [Theobroma cacao]
Length=671

 Score =   103 bits (256),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 69/103 (67%), Gaps = 13/103 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTI+GV DN SS W DS+WRSLK              +SPWE+E LV T+T    QP
Sbjct  307  RFSGTIIGVGDNKSSGWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVVTNTSSNSQP  366

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRG  251
             QRNKRARP  LP   S+ S+LG WKSP++SP +FSYCD+ RG
Sbjct  367  AQRNKRARPPVLPTPSSDLSSLGMWKSPVESP-AFSYCDSQRG  408


 Score = 92.0 bits (227),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T ++FSVFY+PRTSRSEFIVSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  248  ATASHAIATGSMFSVFYKPRTSRSEFIVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  306



>ref|XP_007023119.1| Auxin response factor 1 isoform 2, partial [Theobroma cacao]
 gb|EOY25741.1| Auxin response factor 1 isoform 2, partial [Theobroma cacao]
Length=503

 Score =   102 bits (255),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 69/103 (67%), Gaps = 13/103 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALV-TSTPQTLQP  380
            RFSGTI+GV DN SS W DS+WRSLK              +SPWE+E LV T+T    QP
Sbjct  307  RFSGTIIGVGDNKSSGWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVVTNTSSNSQP  366

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRG  251
             QRNKRARP  LP   S+ S+LG WKSP++SP +FSYCD+ RG
Sbjct  367  AQRNKRARPPVLPTPSSDLSSLGMWKSPVESP-AFSYCDSQRG  408


 Score = 91.3 bits (225),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T ++FSVFY+PRTSRSEFIVSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  248  ATASHAIATGSMFSVFYKPRTSRSEFIVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  306



>ref|XP_006470822.1| PREDICTED: auxin response factor 1-like isoform X1 [Citrus sinensis]
 ref|XP_006470823.1| PREDICTED: auxin response factor 1-like isoform X2 [Citrus sinensis]
Length=688

 Score =   100 bits (250),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 71/112 (63%), Gaps = 13/112 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV D  SS WPDS+WRSLK              +S WE+E LV T+T    QP
Sbjct  314  RFSGTIVGVGDCRSSVWPDSEWRSLKVQWDEPSSILRPERVSSWELEPLVATTTTTNAQP  373

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
             QRNKR+RP  LP   ++ S LG WKS ++S  +FSYCD+ +G D +PSPK 
Sbjct  374  SQRNKRSRPPVLPSPAADISVLGMWKSHVES-SAFSYCDSPQGRDLYPSPKF  424


 Score = 93.2 bits (230),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFS+FY+PRTSRSEFIVSVNKY+EA+ H LSVGMR    FEGEEVPER
Sbjct  255  ATASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKRHKLSVGMRFKMTFEGEEVPER  313



>gb|KHN11044.1| Auxin response factor 1 [Glycine soja]
Length=669

 Score = 99.4 bits (246),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 12/108 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  305  RFSGTIVGVGDNKSSVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSTPPTNPQPS  364

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKR+RP  LP ++ + S  G WKSP++S   FSYCD   G D +PS
Sbjct  365  QRNKRSRPPILPSTMPDSSLQGVWKSPVESA-PFSYCDHQHGRDVYPS  411


 Score = 94.7 bits (234),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EAQ+H LSVG    MRFEG+EVPER
Sbjct  246  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPER  304



>ref|XP_004485416.1| PREDICTED: auxin response factor 1-like isoform X1 [Cicer arietinum]
 ref|XP_004485417.1| PREDICTED: auxin response factor 1-like isoform X2 [Cicer arietinum]
Length=670

 Score = 96.7 bits (239),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 69/111 (62%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+DN S  W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  307  RFSGTIVGVEDNKSPVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSTPPANSQPT  366

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKR+RP  LP ++ + S  G WKSP++SP  F Y D   G D +PSP+ 
Sbjct  367  QRNKRSRPPVLPSTMPDSSPQGIWKSPVESP-PFPYRDLQHGRDLYPSPRF  416


 Score = 95.5 bits (236),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFIVSVNKY+EA+NH LSVG    MRFEG+EVPER
Sbjct  248  ATASHAISTGTLFSVFYKPRTSRSEFIVSVNKYLEARNHKLSVGMRFKMRFEGDEVPER  306



>ref|XP_003540131.1| PREDICTED: auxin response factor 1-like [Glycine max]
Length=665

 Score = 99.4 bits (246),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 68/108 (63%), Gaps = 12/108 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  301  RFSGTIVGVGDNKSSVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSTPPTNPQPS  360

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKR+RP  LP ++ + S  G WKSP++S   FSYCD   G D +PS
Sbjct  361  QRNKRSRPPILPSTMPDSSLQGVWKSPVESA-PFSYCDHQHGRDVYPS  407


 Score = 92.4 bits (228),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EA++H LSVG    MRFEG+EVPER
Sbjct  242  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEARSHKLSVGMRFKMRFEGDEVPER  300



>ref|XP_006431443.1| hypothetical protein CICLE_v10000491mg [Citrus clementina]
 gb|ESR44683.1| hypothetical protein CICLE_v10000491mg [Citrus clementina]
Length=682

 Score = 98.6 bits (244),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 70/112 (63%), Gaps = 13/112 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV D  SS W DS+WRSLK              +S WE+E LV T+T    QP
Sbjct  314  RFSGTIVGVGDCRSSVWQDSEWRSLKVQWDEPSSILRPERVSSWELEPLVATTTTTNAQP  373

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
             QRNKR+RP  LP   ++ S LG WKS ++S  +FSYCD+ +G D +PSPK 
Sbjct  374  AQRNKRSRPPVLPSPAADISVLGMWKSHVES-SAFSYCDSPQGRDLYPSPKF  424


 Score = 93.2 bits (230),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFS+FY+PRTSRSEFIVSVNKY+EA+ H LSVGMR    FEGEEVPER
Sbjct  255  ATASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKRHKLSVGMRFKMTFEGEEVPER  313



>ref|XP_007153915.1| hypothetical protein PHAVU_003G075800g [Phaseolus vulgaris]
 gb|ESW25909.1| hypothetical protein PHAVU_003G075800g [Phaseolus vulgaris]
Length=653

 Score = 99.0 bits (245),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 68/111 (61%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN S  WPDS+WRSLK              +S WE+E  V++TP   QP 
Sbjct  310  RFSGTIVGVGDNKSLVWPDSEWRSLKVQWDEPLSILRPDRVSSWELEPHVSTTPANPQPT  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP  L  ++ + S  G WKSP++S  SFSYCD   G   +PSPK 
Sbjct  370  QRNKRARPLILTSTMPDSSLQGMWKSPVEST-SFSYCDPQHGRGLYPSPKF  419


 Score = 92.8 bits (229),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EA++H LSVG    MRFEG+E+PER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAKSHKLSVGMRFKMRFEGDEIPER  309



>gb|KHN40198.1| Auxin response factor 1 [Glycine soja]
Length=675

 Score = 97.8 bits (242),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 71/112 (63%), Gaps = 13/112 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDN-TSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQP  380
            RFSGTIVGV DN +SS WPDS+WRSLK              +S WE+E LV++T    QP
Sbjct  308  RFSGTIVGVGDNKSSSVWPDSEWRSLKVQWDEPSSILRPDRVSSWELEPLVSTTLANSQP  367

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
             QRNKRARP  LP ++ + S  G WKS ++S  SFSYCD  +G   +PSPK 
Sbjct  368  TQRNKRARPLILPSTMPDSSLQGIWKSSVEST-SFSYCDPQQGRGLYPSPKF  418


 Score = 92.8 bits (229),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+E Q+H LSVG    MRFEG+E+PER
Sbjct  249  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEVQSHKLSVGMRFKMRFEGDEIPER  307



>ref|XP_003528726.1| PREDICTED: auxin response factor 1-like [Glycine max]
Length=674

 Score = 97.8 bits (242),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 71/112 (63%), Gaps = 13/112 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDN-TSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQP  380
            RFSGTIVGV DN +SS WPDS+WRSLK              +S WE+E LV++T    QP
Sbjct  307  RFSGTIVGVGDNKSSSVWPDSEWRSLKVQWDEPSSILRPDRVSSWELEPLVSTTLANSQP  366

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
             QRNKRARP  LP ++ + S  G WKS ++S  SFSYCD  +G   +PSPK 
Sbjct  367  TQRNKRARPLILPSTMPDSSLQGIWKSSVEST-SFSYCDPQQGRGLYPSPKF  417


 Score = 92.8 bits (229),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+E Q+H LSVG    MRFEG+E+PER
Sbjct  248  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEVQSHKLSVGMRFKMRFEGDEIPER  306



>gb|KDP42510.1| hypothetical protein JCGZ_00307 [Jatropha curcas]
Length=680

 Score = 95.5 bits (236),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 49/59 (83%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EA+NH LSVG    MRFEGEEVPER
Sbjct  252  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEARNHKLSVGMRFKMRFEGEEVPER  310


 Score = 94.4 bits (233),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 63/104 (61%), Gaps = 12/104 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS+WRSLK              +SPWE+E L+ +TP   QP 
Sbjct  311  RFSGTIVGVGDNISSGWVDSEWRSLKVQWDEPSSILRPDRVSPWELEPLIATTPSNSQPV  370

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTD  245
            QRNKRARP+ LP   S+  A G WK P +S   FSY D+  G D
Sbjct  371  QRNKRARPSVLPSPTSDLPAFGMWKPPAES-SGFSYGDSQCGRD  413



>ref|XP_006470825.1| PREDICTED: auxin response factor 1-like isoform X4 [Citrus sinensis]
Length=650

 Score = 96.3 bits (238),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 69/109 (63%), Gaps = 13/109 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQT-LQP  380
            RFSGTIVGV D  SS WPDS+WRSLK              +S WE+E LV +T  T  QP
Sbjct  314  RFSGTIVGVGDCRSSVWPDSEWRSLKVQWDEPSSILRPERVSSWELEPLVATTTTTNAQP  373

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
             QRNKR+RP  LP   ++ S LG WKS ++S  +FSYCD+ +G D +PS
Sbjct  374  SQRNKRSRPPVLPSPAADISVLGMWKSHVES-SAFSYCDSPQGRDLYPS  421


 Score = 93.2 bits (230),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFS+FY+PRTSRSEFIVSVNKY+EA+ H LSVGMR    FEGEEVPER
Sbjct  255  ATASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKRHKLSVGMRFKMTFEGEEVPER  313



>ref|XP_010930543.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
 ref|XP_010930544.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
 ref|XP_010930545.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
Length=682

 Score = 95.5 bits (236),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 69/110 (63%), Gaps = 16/110 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D T SRW DS+WRSLK              +SPWE+E LV + P T QP 
Sbjct  311  RFSGTIIGVGDTTPSRWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVAAAPPTSQPA  370

Query  376  QRNKRARPANLPPSVS-EFS-ALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKRARP   PPS+  + S  LG WKSP++S Q+ S+    RG + +PS
Sbjct  371  QRNKRARP---PPSIMPDISPVLGLWKSPVESTQTLSFSGLQRGRELYPS  417


 Score = 93.6 bits (231),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T TLFSVFY+PRTSRSEFI+SVNKY+EA+NH LSVG    MRFEG+E PER
Sbjct  252  ATASHAVSTGTLFSVFYKPRTSRSEFIISVNKYLEAKNHKLSVGMRFKMRFEGDEAPER  310



>gb|EYU35034.1| hypothetical protein MIMGU_mgv1a003127mg [Erythranthe guttata]
Length=606

 Score =   101 bits (251),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 50/59 (85%), Positives = 54/59 (92%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+TRTLFSVFY+PRTSRSEFIVS+NKY+EAQNH LSVG    MRFEGEEVPER
Sbjct  200  ATASHAISTRTLFSVFYKPRTSRSEFIVSLNKYLEAQNHKLSVGMRFKMRFEGEEVPER  258


 Score = 87.8 bits (216),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 67/111 (60%), Gaps = 20/111 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV +N+SS W DS+WRSLK              +SPWEIE LV +TP   Q  
Sbjct  259  RFSGTIVGVGNNSSSCWTDSEWRSLKVQWDEPSSILRPDRVSPWEIEPLVAATPPNSQTQ  318

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKRARP  LP  + + S LG WKSP +SP SF      RG   + SPKL
Sbjct  319  QRNKRARPPVLPSPMQDLSPLGMWKSPSESP-SF------RGL--YQSPKL  360



>gb|KHG03459.1| Auxin response factor 1 -like protein [Gossypium arboreum]
Length=667

 Score = 96.7 bits (239),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 73/117 (62%), Gaps = 17/117 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV+DN SS W DS+WRSLK              +SPWE+E LV TS     QP
Sbjct  301  RFSGTIVGVEDNKSSAWADSEWRSLKVQWDEPSSIIRPDRVSPWELEPLVATSNSSISQP  360

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
             QRNKRARP  LP   S+ S+LG WKSP++SP  FSYCD  RG    PSPKL    K
Sbjct  361  AQRNKRARPPVLPSPSSDLSSLGIWKSPVESP--FSYCDAQRG---HPSPKLSSTAK  412


 Score = 92.0 bits (227),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++TR++FS+FY+PRTS SEFIVSVNK++EAQ+H LSVG    MRFEGEEVPER
Sbjct  242  ATASHALSTRSMFSIFYKPRTSLSEFIVSVNKFLEAQSHKLSVGMRFKMRFEGEEVPER  300



>ref|XP_006598778.1| PREDICTED: auxin response factor 1-like isoform X2 [Glycine max]
Length=639

 Score = 94.7 bits (234),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EAQ+H LSVG    MRFEG+EVPER
Sbjct  242  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPER  300


 Score = 94.0 bits (232),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+DN S  W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  301  RFSGTIVGVEDNKSLVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSNPPTNSQPS  360

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKR+RP  LP ++ + S  G WKSP++S   FSY D   G D +PS
Sbjct  361  QRNKRSRPPILPSTMLDSSLQGVWKSPVESA-PFSYRDHQHGRDVYPS  407



>ref|XP_006598779.1| PREDICTED: auxin response factor 1-like isoform X3 [Glycine max]
Length=616

 Score = 94.7 bits (234),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EAQ+H LSVG    MRFEG+EVPER
Sbjct  193  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPER  251


 Score = 94.0 bits (232),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+DN S  W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  252  RFSGTIVGVEDNKSLVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSNPPTNSQPS  311

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKR+RP  LP ++ + S  G WKSP++S   FSY D   G D +PS
Sbjct  312  QRNKRSRPPILPSTMLDSSLQGVWKSPVESA-PFSYRDHQHGRDVYPS  358



>ref|XP_003548301.1| PREDICTED: auxin response factor 1-like isoform X1 [Glycine max]
Length=665

 Score = 94.7 bits (234),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EAQ+H LSVG    MRFEG+EVPER
Sbjct  242  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPER  300


 Score = 94.0 bits (232),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+DN S  W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  301  RFSGTIVGVEDNKSLVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSNPPTNSQPS  360

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKR+RP  LP ++ + S  G WKSP++S   FSY D   G D +PS
Sbjct  361  QRNKRSRPPILPSTMLDSSLQGVWKSPVESA-PFSYRDHQHGRDVYPS  407



>ref|XP_002527835.1| Auxin response factor, putative [Ricinus communis]
 gb|EEF34538.1| Auxin response factor, putative [Ricinus communis]
Length=671

 Score = 94.4 bits (233),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 66/108 (61%), Gaps = 13/108 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W DS+WRSLK              +S WE+E LV +TP   QP 
Sbjct  303  RFSGTIVGVGDNVSSGWADSEWRSLKVQWDEPSSILRPDRVSSWELEPLVATTPSNSQPV  362

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKRARP+ L PS  + S+LG WK P     +FSY D  RG D +PS
Sbjct  363  QRNKRARPSVL-PSTPDISSLGMWK-PQTESTAFSYGDFQRGRDLYPS  408


 Score = 93.6 bits (231),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  244  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  302



>gb|KJB70781.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70782.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70783.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70784.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70785.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
Length=673

 Score = 96.3 bits (238),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/117 (56%), Positives = 73/117 (62%), Gaps = 17/117 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV+DN SS W DS+WRSLK              +SPWE+E LV TS     QP
Sbjct  307  RFSGTIVGVEDNKSSAWADSEWRSLKVQWDEPSSIIRPDRVSPWELEPLVATSNSSISQP  366

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
             QRNKRARP  LP   S+ S+LG WKSP++SP  FSYCD  RG    PSPKL    K
Sbjct  367  AQRNKRARPPVLPSPSSDLSSLGIWKSPVESP--FSYCDAQRGQ---PSPKLSSTAK  418


 Score = 91.7 bits (226),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++TR++FS+FY+PRTS SEFIVSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  248  ATASHALSTRSMFSIFYKPRTSLSEFIVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  306



>gb|ACX68650.3| auxin response factor [Dimocarpus longan]
Length=681

 Score = 96.7 bits (239),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 69/114 (61%), Gaps = 16/114 (14%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTST----PQTL  386
            FSG IVGV+DN +S WP+S+WRSLK              +S WE+E LV +T    P   
Sbjct  316  FSGIIVGVEDNKTSAWPNSEWRSLKVQWDEPSSILRPDRVSSWELEPLVANTTTPPPPNS  375

Query  385  QPPQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QP QRNKRARP  LP    + S LG WKSP++S Q+FSY D+  G D + SPK 
Sbjct  376  QPAQRNKRARPPVLPTPAPDLSVLGMWKSPVES-QAFSYSDSQHGRDLYLSPKF  428


 Score = 90.1 bits (222),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 45/58 (78%), Positives = 50/58 (86%), Gaps = 4/58 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPE  535
            ATASHAI T TLFS+FY+PRTSRSEFIVSVNKY+EA+ H LSVG    MRFEGEEVP+
Sbjct  256  ATASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEARKHKLSVGMRFKMRFEGEEVPD  313



>ref|XP_010912873.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
Length=727

 Score = 94.0 bits (232),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEFI+SVNKY+EA+NH LSVG    MRFEG+E PER
Sbjct  293  ATASHAISTGTLFSVFYKPRTSRSEFIISVNKYLEAKNHKLSVGMRFKMRFEGDEAPER  351


 Score = 92.4 bits (228),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 67/110 (61%), Gaps = 16/110 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D T SRW DS+WRSLK              +SPWE+E LV +T  T QP 
Sbjct  352  RFSGTIIGVGDTTPSRWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVAATTPTSQPA  411

Query  376  QRNKRARP---ANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFP  236
            QR+KRARP     + P +S  S  G WKSP++S Q+FS+    RG + +P
Sbjct  412  QRHKRARPLASTTIAPDIS--SMFGLWKSPVESTQTFSFSGLQRGRELYP  459



>ref|XP_008786460.1| PREDICTED: auxin response factor 7-like [Phoenix dactylifera]
Length=683

 Score = 93.6 bits (231),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T TLFSVFY+PRTSRSEFI+SVNKY+EA+NH LSVG    MRFEG+E PER
Sbjct  248  ATASHAVSTGTLFSVFYKPRTSRSEFIISVNKYLEAKNHKLSVGMRFKMRFEGDEAPER  306


 Score = 92.4 bits (228),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 66/109 (61%), Gaps = 16/109 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV + T SRW DS+WRSLK              +SPWE+E LV +TP T QP 
Sbjct  307  RFSGTIIGVGETTPSRWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVAATPPTSQPT  366

Query  376  QRNKRARPANLP---PSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHF  239
            QRNKRARP   P   P +S  S  G WKSP++S Q+ S+    RG D +
Sbjct  367  QRNKRARPPASPSITPDIS--SVFGLWKSPVESTQTLSFSGLQRGRDLY  413



>ref|XP_008795276.1| PREDICTED: auxin response factor 7-like isoform X1 [Phoenix dactylifera]
Length=686

 Score = 95.5 bits (236),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRSEFI+SVNKY+EA+NH LSVG    MRFEG+E PERS
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSEFIISVNKYLEAKNHKLSVGMRFKMRFEGDEAPERS  311

Query  528  CTDSV  514
             + ++
Sbjct  312  FSGTI  316


 Score = 89.0 bits (219),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 65/109 (60%), Gaps = 16/109 (15%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPPQ  374
            FSGTI+GV D+T SRW DS+WRSLK              +SPWE+E LV STPQ      
Sbjct  312  FSGTIIGVGDSTQSRWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVASTPQASHQTA  371

Query  373  RNKRARP---ANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFP  236
            R+KRARP     + P +S   A G WKSP++S Q+FS+    RG + +P
Sbjct  372  RHKRARPLASTTIMPDIS--PAFGLWKSPVESTQTFSFSGLQRGRELYP  418



>ref|XP_007148592.1| hypothetical protein PHAVU_006G221500g [Phaseolus vulgaris]
 gb|ESW20586.1| hypothetical protein PHAVU_006G221500g [Phaseolus vulgaris]
Length=664

 Score = 94.7 bits (234),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVSVNKY+EAQ+H LSVG    MRFEG+EVPER
Sbjct  242  ATASHAIATGTLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPER  300


 Score = 89.4 bits (220),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 66/111 (59%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DN SS W +S+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  301  RFSGTIVGVGDNKSSVWTNSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSTPPTNSQPS  360

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QRNKR+RP  LP ++ + S  G  KSP+DS   FSY D   G D +P  K 
Sbjct  361  QRNKRSRPHVLPSTMPDSSMQGVRKSPVDSA-PFSYRDHQHGRDIYPPAKF  410



>ref|XP_011092261.1| PREDICTED: auxin response factor 1 isoform X2 [Sesamum indicum]
Length=661

 Score = 94.0 bits (232),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VS+NKY+EA+NH L VGMR    FEGEEVPER
Sbjct  251  ATASHAISTGTLFSVFYKPRTSRSEFVVSLNKYLEAKNHKLPVGMRFKMSFEGEEVPER  309


 Score = 89.7 bits (221),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 65/111 (59%), Gaps = 17/111 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG++D +SSRWP+S+WRSLK              +SPWEIE LV   P TLQ  
Sbjct  310  RFSGTIVGIEDYSSSRWPNSEWRSLKVQWDEPSAILRPDRVSPWEIETLVGPPPPTLQTQ  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
             RNKRARP  LP  +   S+L       +SP +F Y D S G D + S KL
Sbjct  370  HRNKRARPTILPSPMQNLSSLA------ESPSAFRYRDLSHGRDPYQSLKL  414



>gb|KGN49710.1| hypothetical protein Csa_5G077780 [Cucumis sativus]
Length=678

 Score = 95.9 bits (237),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRS F+VS+NKY+EAQNH LSVG    MRFEGEEVPERS
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSTFLVSLNKYLEAQNHKLSVGMRFKMRFEGEEVPERS  311

Query  528  CTDSV  514
             + ++
Sbjct  312  FSGTI  316


 Score = 86.7 bits (213),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 12/110 (11%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPPQ  374
            FSGTIVG+ DN S  W +S+WRSLK              +S WE+E LV S P + QP Q
Sbjct  312  FSGTIVGLGDNASPGWANSEWRSLKVQWDEPSSILRPDKVSAWELEPLVASNPLSTQPTQ  371

Query  373  RNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            RNKR RP  LP S  + + LG WK  ++S  +FSY +  RG D + SPK 
Sbjct  372  RNKRPRPTVLPSSSPDATVLGGWKPTVES-STFSYAEPQRGRDLYSSPKF  420



>ref|XP_004142338.1| PREDICTED: auxin response factor 1-like [Cucumis sativus]
Length=739

 Score = 95.9 bits (237),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRS F+VS+NKY+EAQNH LSVG    MRFEGEEVPERS
Sbjct  313  ATASHAISTGTLFSVFYKPRTSRSTFLVSLNKYLEAQNHKLSVGMRFKMRFEGEEVPERS  372

Query  528  CTDSV  514
             + ++
Sbjct  373  FSGTI  377


 Score = 86.7 bits (213),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 64/110 (58%), Gaps = 12/110 (11%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPPQ  374
            FSGTIVG+ DN S  W +S+WRSLK              +S WE+E LV S P + QP Q
Sbjct  373  FSGTIVGLGDNASPGWANSEWRSLKVQWDEPSSILRPDKVSAWELEPLVASNPLSTQPTQ  432

Query  373  RNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            RNKR RP  LP S  + + LG WK  ++S  +FSY +  RG D + SPK 
Sbjct  433  RNKRPRPTVLPSSSPDATVLGGWKPTVES-STFSYAEPQRGRDLYSSPKF  481



>gb|AAZ81521.1| auxin response factor 1 [Gossypium barbadense]
Length=673

 Score = 90.9 bits (224),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 72/117 (62%), Gaps = 17/117 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV+ + SS W DS+WRSLK              +SPWE+E LV TS     QP
Sbjct  307  RFSGTIVGVEADKSSGWADSEWRSLKVQWDEPSSIIRPDRVSPWELEPLVATSNSSISQP  366

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
             QRNKRARP  LP   S+ S+LG WKSP++SP  FSYCD  RG    PSPKL    K
Sbjct  367  AQRNKRARPPVLPSPSSDLSSLGIWKSPVESP--FSYCDAQRGQ---PSPKLSSTAK  418


 Score = 89.0 bits (219),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATAS+A++TR++FS+FY+PRTS SEFIVSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  248  ATASYALSTRSMFSIFYKPRTSLSEFIVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  306



>gb|ADW11246.1| putative auxin response factor [Gossypium hirsutum]
Length=672

 Score = 90.9 bits (224),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/117 (54%), Positives = 72/117 (62%), Gaps = 17/117 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV+ + SS W DS+WRSLK              +SPWE+E LV TS     QP
Sbjct  307  RFSGTIVGVEADKSSGWADSEWRSLKVQWDEPSSIIRPDRVSPWELEPLVATSNSSISQP  366

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKLKRILK  209
             QRNKRARP  LP   S+ S+LG WKSP++SP  FSYCD  RG    PSPKL    K
Sbjct  367  AQRNKRARPPVLPSPSSDLSSLGIWKSPVESP--FSYCDAQRGQ---PSPKLSSTAK  418


 Score = 89.0 bits (219),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 53/59 (90%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATAS+A++TR++FS+FY+PRTS SEFIVSVNKY+EA++H LSVG    MRFEGEEVPER
Sbjct  248  ATASYALSTRSMFSIFYKPRTSLSEFIVSVNKYLEARSHKLSVGMRFKMRFEGEEVPER  306



>ref|XP_008460595.1| PREDICTED: auxin response factor 1 [Cucumis melo]
Length=675

 Score = 95.9 bits (237),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRS F+VS+NKY+EAQNH LSVG    MRFEGEEVPERS
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSTFLVSLNKYLEAQNHKLSVGMRFKMRFEGEEVPERS  311

Query  528  CTDSV  514
             + ++
Sbjct  312  FSGTI  316


 Score = 83.6 bits (205),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 63/110 (57%), Gaps = 12/110 (11%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPPQ  374
            FSGTIVG+ DN S  W +S+WRSLK              +S WE+E LV S P + QP Q
Sbjct  312  FSGTIVGLGDNASPGWANSEWRSLKVQWDEPSSILRPDKVSAWELEPLVASNPLSSQPTQ  371

Query  373  RNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            RNKR RP  LP S  + + LG WK  ++S  +FSY +  R  D + SPK 
Sbjct  372  RNKRPRPTVLPSSSPDATVLGGWKPTVES-SAFSYTEPQRARDLYSSPKF  420



>ref|XP_006470824.1| PREDICTED: auxin response factor 1-like isoform X3 [Citrus sinensis]
Length=678

 Score = 93.2 bits (230),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFS+FY+PRTSRSEFIVSVNKY+EA+ H LSVGMR    FEGEEVPER
Sbjct  255  ATASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKRHKLSVGMRFKMTFEGEEVPER  313


 Score = 85.5 bits (210),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 53/112 (47%), Positives = 64/112 (57%), Gaps = 23/112 (21%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV D  SS WPDS+WRSLK              +S WE+E LV T+T    QP
Sbjct  314  RFSGTIVGVGDCRSSVWPDSEWRSLKVQWDEPSSILRPERVSSWELEPLVATTTTTNAQP  373

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
             QRNKR+RP  LP   ++ S L           +FSYCD+ +G D +PSPK 
Sbjct  374  SQRNKRSRPPVLPSPAADISVL-----------AFSYCDSPQGRDLYPSPKF  414



>emb|CBA11999.1| putative auxin response factor 1 [Illicium parviflorum]
Length=684

 Score = 91.7 bits (226),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTS+SEFI+S+NKY+EA+NH LSVG    MRFEGE+ PER
Sbjct  251  ATASHAISTGTLFSVFYKPRTSQSEFIISLNKYLEAKNHKLSVGMRFKMRFEGEDAPER  309


 Score = 86.3 bits (212),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 62/109 (57%), Gaps = 12/109 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D  SSRW DS+WRSLK              +SPWE+E LV + P   QP 
Sbjct  310  RFSGTIIGVGDAVSSRWADSEWRSLKVQWDEPSSIPRPVRVSPWELEPLVAAVPSAPQPT  369

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCD-TSRGTDHFPS  233
             R+KRARP  L PS  +  A   WKS ID+  +FS+     RG D + S
Sbjct  370  PRSKRARPPALLPSTPDIPACSRWKSHIDAGSAFSHSSGLQRGLDLYSS  418



>gb|KHN39693.1| Auxin response factor 1 [Glycine soja]
Length=590

 Score = 93.6 bits (231),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 12/108 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+DN S  W DS+WRSLK              +SPWE+E LV++ P   QP 
Sbjct  226  RFSGTIVGVEDNKSLVWADSEWRSLKVQWDEPSSILRPDRVSPWELEPLVSNPPTNSQPS  285

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QRNKR+RP  LP ++ + S  G WKSP++S   FSY D   G D +PS
Sbjct  286  QRNKRSRPPILPSTMLDSSLQGVWKSPVESA-PFSYRDHQHGRDVYPS  332


 Score = 81.3 bits (199),  Expect(2) = 6e-35, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 4/49 (8%)
 Frame = -2

Query  666  TLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            TLFSVFY+PRTSRSEFIVSVNKY+EAQ+H LSVG    MRFEG+EVPER
Sbjct  177  TLFSVFYKPRTSRSEFIVSVNKYLEAQSHKLSVGMRFKMRFEGDEVPER  225



>ref|XP_006470826.1| PREDICTED: auxin response factor 1-like isoform X5 [Citrus sinensis]
Length=640

 Score = 93.2 bits (230),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFS+FY+PRTSRSEFIVSVNKY+EA+ H LSVGMR    FEGEEVPER
Sbjct  255  ATASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKRHKLSVGMRFKMTFEGEEVPER  313


 Score = 80.9 bits (198),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 62/109 (57%), Gaps = 23/109 (21%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGV D  SS WPDS+WRSLK              +S WE+E LV T+T    QP
Sbjct  314  RFSGTIVGVGDCRSSVWPDSEWRSLKVQWDEPSSILRPERVSSWELEPLVATTTTTNAQP  373

Query  379  PQRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
             QRNKR+RP  LP   ++ S L           +FSYCD+ +G D +PS
Sbjct  374  SQRNKRSRPPVLPSPAADISVL-----------AFSYCDSPQGRDLYPS  411



>ref|XP_009416967.1| PREDICTED: auxin response factor 7-like, partial [Musa acuminata 
subsp. malaccensis]
Length=588

 Score = 86.3 bits (212),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T TLFSVFY+PRTSRSEFI+SVNKY+EA+N+  SVG    MRFEG+E PE+
Sbjct  251  ATASHALATGTLFSVFYKPRTSRSEFIISVNKYLEAKNNKFSVGMRFKMRFEGDEAPEQ  309


 Score = 84.3 bits (207),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 64/104 (62%), Gaps = 14/104 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D  SSRW DS+WRSLK              +SPWE+E L+T TP + QP 
Sbjct  310  RFSGTIIGV-DTASSRWKDSEWRSLKVQWDEPSSIPRPDRVSPWELEPLLTGTPNS-QPV  367

Query  376  QRNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSYCDTSRGT  248
            QRNKR RP+  P   S+ + A G WKSP +S ++FS     RGT
Sbjct  368  QRNKRTRPSASPTITSDITPAFGLWKSPAESTRTFSVSGLQRGT  411



>ref|XP_003575147.1| PREDICTED: auxin response factor 7-like [Brachypodium distachyon]
 ref|XP_010235548.1| PREDICTED: auxin response factor 7-like [Brachypodium distachyon]
Length=672

 Score = 90.5 bits (223),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+N+ +SVG    MRFEG+E PER
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNNKMSVGMRFKMRFEGDEAPER  304


 Score = 79.7 bits (195),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 60/108 (56%), Gaps = 12/108 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV   T+S W DS WRSLK              +SPWE+E LV ++ Q  QPP
Sbjct  305  RFSGTIIGVGSMTTSPWADSDWRSLKVQWDEPSAIPRPDRVSPWELEPLVATSIQPPQPP  364

Query  376  QRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFP  236
             RNKRARP   P    E     G WKSP +S Q+FS+    R  + +P
Sbjct  365  ARNKRARPPASPSIAPEHPPVFGLWKSPGESAQTFSFSGLQRTQELYP  412



>ref|XP_004975691.1| PREDICTED: auxin response factor 9-like [Setaria italica]
Length=663

 Score = 88.2 bits (217),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRS+FIVSVNKY+EA+   +SVG    MRFEG+E PER
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSDFIVSVNKYLEAKKQKISVGMRFKMRFEGDEAPER  310


 Score = 81.6 bits (200),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 62/112 (55%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTIV +      + S W DS WRSLK              +SPWE+E L  + PQ+ 
Sbjct  311  RFSGTIVDIGSLPAMSKSLWADSDWRSLKVQWDEPSSILRPDRISPWEVEPLDAANPQSP  370

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP RNKRARP   P  V+E  S  G WKSP DS ++ S+ +  R  + FPS
Sbjct  371  QPPLRNKRARPLASPSMVAELPSGFGLWKSPTDSARTLSFSEPQRARELFPS  422



>ref|XP_008347968.1| PREDICTED: auxin response factor 1-like [Malus domestica]
Length=399

 Score =   107 bits (268),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 71/110 (65%), Gaps = 11/110 (10%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV DNT+  W +S+WRSLK              +SPW++E LV +TPQ  QP 
Sbjct  87   RFSGTIVGVGDNTAPGWANSEWRSLKVQWDEPSSILRPDRVSPWDLEPLVATTPQNSQPA  146

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPK  227
             RNKRARP  LP    + SALG WKS  +SP +FSY D+ RG D +PSPK
Sbjct  147  LRNKRARPPVLPSPSPDLSALGEWKSKAESPLAFSYSDSQRGRDIYPSPK  196


 Score = 61.6 bits (148),  Expect(2) = 3e-33, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 4/53 (8%)
 Frame = -2

Query  678  INTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            I  + LF+     RTSRSEF+VSVNKYIEA++  LSVG    MRFEGEEVPER
Sbjct  34   IPDKILFAGSICARTSRSEFLVSVNKYIEARSQKLSVGMRFKMRFEGEEVPER  86



>ref|XP_009406475.1| PREDICTED: auxin response factor 7-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=542

 Score = 87.4 bits (215),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRS+FI+SVNKY+EA+N+  SVG    MRFEG+E PE+
Sbjct  111  ATASHAIATGTLFSVFYKPRTSRSDFIISVNKYLEAKNYKFSVGMRFNMRFEGDEAPEK  169


 Score = 80.1 bits (196),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 63/105 (60%), Gaps = 14/105 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV  +T+S+W  S+WR+LK             T+SPWE+E L+ + P T QP 
Sbjct  170  RFSGTIVGV--DTTSQWAGSEWRTLKVQWDEPSCIRRPDTVSPWELEPLLAAAPPTFQPV  227

Query  376  QRNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSYCDTSRGTD  245
            QRNKR RP+  P   S+ + A G WKS  +S Q+FS+     G +
Sbjct  228  QRNKRTRPSAAPAESSDLTPAFGLWKSTAESTQNFSFSGLQGGKE  272



>ref|XP_009406473.1| PREDICTED: auxin response factor 7-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score = 87.0 bits (214),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRS+FI+SVNKY+EA+N+  SVG    MRFEG+E PE+
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSDFIISVNKYLEAKNYKFSVGMRFNMRFEGDEAPEK  309


 Score = 80.1 bits (196),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 47/105 (45%), Positives = 63/105 (60%), Gaps = 14/105 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV  +T+S+W  S+WR+LK             T+SPWE+E L+ + P T QP 
Sbjct  310  RFSGTIVGV--DTTSQWAGSEWRTLKVQWDEPSCIRRPDTVSPWELEPLLAAAPPTFQPV  367

Query  376  QRNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSYCDTSRGTD  245
            QRNKR RP+  P   S+ + A G WKS  +S Q+FS+     G +
Sbjct  368  QRNKRTRPSAAPAESSDLTPAFGLWKSTAESTQNFSFSGLQGGKE  412



>ref|NP_849830.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AEE33613.1| auxin response factor 1 [Arabidopsis thaliana]
Length=662

 Score = 85.5 bits (210),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 80.9 bits (198),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  STP +  Q
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQ  366

Query  382  PPQRNKRARPANLP-PSVSEFSALGTWKSPIDSPQS  278
            PPQRNKR RP  LP P+       G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPSPATGPSGPDGVWKSPADTPSS  402



>gb|AAM91657.1| auxin response factor 1 [Arabidopsis thaliana]
Length=662

 Score = 85.5 bits (210),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 80.9 bits (198),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 59/96 (61%), Gaps = 14/96 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  STP +  Q
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQ  366

Query  382  PPQRNKRARPANLP-PSVSEFSALGTWKSPIDSPQS  278
            PPQRNKR RP  LP P+       G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPSPATGPSGPDGVWKSPADTPSS  402



>ref|XP_009103143.1| PREDICTED: auxin response factor 1 isoform X2 [Brassica rapa]
Length=662

 Score = 87.0 bits (214),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+N  L+VG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNQKLAVGMRFKMRFEGEEAPEK  306


 Score = 79.3 bits (194),  Expect(2) = 3e-32, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 58/95 (61%), Gaps = 13/95 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP    P
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSAHLP  366

Query  379  PQRNKRARPAN-LPPSVSEFSALGTWKSPIDSPQS  278
            PQRNKR RP   L P+ +  +  G WKSP D+P S
Sbjct  367  PQRNKRPRPPGLLSPTTAPSTPDGVWKSPADNPSS  401



>ref|XP_010682136.1| PREDICTED: auxin response factor 1 [Beta vulgaris subsp. vulgaris]
Length=659

 Score = 92.0 bits (227),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T TLFSVFY+PRTSRSEF+VSVNKY+EA++H LSVG    MRFEG+EVPER
Sbjct  247  ATAAHAIQTGTLFSVFYKPRTSRSEFLVSVNKYLEAKSHKLSVGMRFKMRFEGDEVPER  305


 Score = 72.8 bits (177),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 65/109 (60%), Gaps = 13/109 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV D +SS W +S+WRSLK              +SPWE+E LV +     QP 
Sbjct  306  RFSGTIVGVNDTSSSSWENSEWRSLKVQWDEPSSIVRPERVSPWELEPLVATNASNTQPT  365

Query  376  -QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
             QRNKR RPA +P S ++ SALG WKSP +SP + S  +  R  D F S
Sbjct  366  TQRNKRPRPAVMPSSATDLSALGIWKSPGESPVAAS-AEVERTRDQFSS  413



>ref|XP_009103121.1| PREDICTED: auxin response factor 1 isoform X1 [Brassica rapa]
 ref|XP_009103129.1| PREDICTED: auxin response factor 1 isoform X1 [Brassica rapa]
 ref|XP_009103136.1| PREDICTED: auxin response factor 1 isoform X1 [Brassica rapa]
 gb|AFD01292.1| auxin response factor 1 [Brassica rapa subsp. pekinensis]
Length=665

 Score = 87.0 bits (214),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+N  L+VG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNQKLAVGMRFKMRFEGEEAPEK  306


 Score = 77.8 bits (190),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 59/99 (60%), Gaps = 18/99 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP    P
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSAHLP  366

Query  379  PQRNKRARPANL-----PPSVSEFSALGTWKSPIDSPQS  278
            PQRNKR RP  L      PS +  +A G WKSP D+P S
Sbjct  367  PQRNKRPRPPGLLSPTTAPS-TPVTADGVWKSPADNPSS  404



>ref|XP_010414657.1| PREDICTED: auxin response factor 1-like isoform X2 [Camelina 
sativa]
Length=662

 Score = 85.5 bits (210),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 79.3 bits (194),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 60/96 (63%), Gaps = 14/96 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP +  Q
Sbjct  307  RFSGTIVGVQENNSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSA-LGTWKSPIDSPQS  278
            PPQRNKR RP  LP  +   SA  G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPTPIPGPSAPDGVWKSPADTPSS  402



>ref|NP_001185266.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AEE33615.1| auxin response factor 1 [Arabidopsis thaliana]
Length=660

 Score = 85.5 bits (210),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 79.3 bits (194),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 60/95 (63%), Gaps = 14/95 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  STP +  Q
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSALGTWKSPIDSPQS  278
            PPQRNKR RP  L PS +   + G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGL-PSPATGPSDGVWKSPADTPSS  400



>ref|XP_010511012.1| PREDICTED: auxin response factor 1 isoform X1 [Camelina sativa]
 ref|XP_010511013.1| PREDICTED: auxin response factor 1 isoform X1 [Camelina sativa]
Length=665

 Score = 85.1 bits (209),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 79.3 bits (194),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 61/99 (62%), Gaps = 17/99 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP +  Q
Sbjct  307  RFSGTIVGVQENNSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSV----SEFSALGTWKSPIDSPQS  278
            PPQRNKR RP  LP  +    ++ +  G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPTPIPCPSAQVTPDGVWKSPADTPSS  405



>ref|XP_010511014.1| PREDICTED: auxin response factor 1 isoform X2 [Camelina sativa]
Length=662

 Score = 85.1 bits (209),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 79.3 bits (194),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 60/96 (63%), Gaps = 14/96 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP +  Q
Sbjct  307  RFSGTIVGVQENNSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSAL-GTWKSPIDSPQS  278
            PPQRNKR RP  LP  +   SA  G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPTPIPCPSAQDGVWKSPADTPSS  402



>ref|XP_002888184.1| hypothetical protein ARALYDRAFT_475338 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64443.1| hypothetical protein ARALYDRAFT_475338 [Arabidopsis lyrata subsp. 
lyrata]
Length=665

 Score = 85.5 bits (210),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 79.0 bits (193),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 60/99 (61%), Gaps = 17/99 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  STP +  Q
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSA----LGTWKSPIDSPQS  278
            PPQRNKR RP  LP   +  SA     G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPSPTTGPSAPVTPDGVWKSPADTPSS  405



>ref|XP_010470201.1| PREDICTED: auxin response factor 1-like isoform X2 [Camelina 
sativa]
Length=663

 Score = 85.5 bits (210),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 79.0 bits (193),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 60/96 (63%), Gaps = 14/96 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP +  Q
Sbjct  307  RFSGTIVGVQENNSSVWLDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSA-LGTWKSPIDSPQS  278
            PPQRNKR RP  LP  +   SA  G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPTPIPGPSAPDGVWKSPADTPSS  402



>ref|XP_009379878.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009379879.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 85.9 bits (211),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PR SRSEF++S+NKY+EA+++ LSVG    MRFEG+E PER
Sbjct  248  ATASHAITTGTLFSVFYKPRASRSEFLISLNKYLEAKSYKLSVGMRFKMRFEGDETPER  306


 Score = 77.8 bits (190),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 61/103 (59%), Gaps = 12/103 (12%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIV V D  SS+W DS+WRSLK             ++SPWE+E LV +TP T QP 
Sbjct  307  RFSGTIVAVIDKVSSQWADSEWRSLKVQWDESSSIQRPDSVSPWELEPLVAATPPTSQPV  366

Query  376  QRNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSYCDTSRG  251
            QR KR RP      + E S A GTWK  +++ Q FS+  + RG
Sbjct  367  QRIKRTRPPASSVMLPEPSPAPGTWKFQVENSQMFSFSGSQRG  409



>ref|XP_010414655.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010414656.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
Length=665

 Score = 85.5 bits (210),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 78.2 bits (191),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 60/99 (61%), Gaps = 17/99 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP +  Q
Sbjct  307  RFSGTIVGVQENNSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSA----LGTWKSPIDSPQS  278
            PPQRNKR RP  LP  +   SA     G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPTPIPGPSAPVTPDGVWKSPADTPSS  405



>ref|XP_006300434.1| hypothetical protein CARUB_v10022415mg [Capsella rubella]
 gb|EOA33332.1| hypothetical protein CARUB_v10022415mg [Capsella rubella]
Length=665

 Score = 85.5 bits (210),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 77.8 bits (190),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 60/99 (61%), Gaps = 17/99 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  STP +  Q
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSALGT----WKSPIDSPQS  278
            PPQRNKR RP  LP   +  SA  T    WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPAPTTGPSAAVTPDSVWKSPADTPSS  405



>gb|ACN31160.1| unknown [Zea mays]
 gb|AFU81655.1| ARF-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW71834.1| auxin response factor 1 [Zea mays]
Length=677

 Score = 92.4 bits (228),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+NH +SVG    MRFEG+E PER
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKMSVGMRFKMRFEGDESPER  304


 Score = 70.9 bits (172),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 60/110 (55%), Gaps = 15/110 (14%)
 Frame = -1

Query  523  RFSGTIVGVQ---DNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+     N++S W +S+WRSLK              +SPWE+E L  + PQ  
Sbjct  305  RFSGTIIGMGCMPANSTSPWANSEWRSLKVQWDEPSAILRPDRVSPWEVEPLDRTNPQPP  364

Query  385  QPPQRNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSYCDTSRGTDHF  239
            QPP RNKRARP   P    E +   G WKSP +  Q+FS+    R  + +
Sbjct  365  QPPLRNKRARPPASPSIAPELAPVFGFWKSPAEPAQAFSFSGLQRTQELY  414



>ref|XP_008669376.1| PREDICTED: auxin response factor 9-like isoform X2 [Zea mays]
Length=618

 Score = 86.7 bits (213),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRS+FIVSVNKY+EA+   +SVG    MRFEG++ PER
Sbjct  253  ATASHAISTGTLFSVFYKPRTSRSDFIVSVNKYLEAKKQKISVGMRFKMRFEGDDAPER  311


 Score = 76.6 bits (187),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 60/111 (54%), Gaps = 15/111 (14%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS WRSLK              +SPWE+E L  + PQ+ 
Sbjct  312  RFSGTIIGIGSLPAMSKSLWADSDWRSLKVQWDEPSSILRPDRISPWEVEPLDAANPQSP  371

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFP  236
            QPP R KR RP   P  VSE  S  G WKSPI+S  + S+ +  R  + FP
Sbjct  372  QPPLRAKRPRPPASPCMVSELPSGFGLWKSPIESSCTLSFSEPQRARELFP  422



>ref|XP_010470197.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010470198.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010470199.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010470200.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
Length=666

 Score = 85.5 bits (210),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 77.8 bits (190),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 60/99 (61%), Gaps = 17/99 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  +TP +  Q
Sbjct  307  RFSGTIVGVQENNSSVWLDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSA----LGTWKSPIDSPQS  278
            PPQRNKR RP  LP  +   SA     G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPTPIPGPSAPVTPDGVWKSPADTPSS  405



>ref|NP_176184.1| auxin response factor 1 [Arabidopsis thaliana]
 ref|NP_001031208.1| auxin response factor 1 [Arabidopsis thaliana]
 sp|Q8L7G0.2|ARFA_ARATH RecName: Full=Auxin response factor 1 [Arabidopsis thaliana]
 gb|AAD39318.1|AC007258_7 auxin response factor 1 [Arabidopsis thaliana]
 gb|AAC49751.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AAO22577.1| auxin response factor 1 [Arabidopsis thaliana]
 dbj|BAH19896.1| AT1G59750 [Arabidopsis thaliana]
 gb|AEE33612.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AEE33614.1| auxin response factor 1 [Arabidopsis thaliana]
Length=665

 Score = 85.5 bits (210),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 77.4 bits (189),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 59/99 (60%), Gaps = 17/99 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  STP +  Q
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSQPQ  366

Query  382  PPQRNKRARPANLPPSVSEFSA----LGTWKSPIDSPQS  278
            PPQRNKR RP  LP   +  S      G WKSP D+P S
Sbjct  367  PPQRNKRPRPPGLPSPATGPSGPVTPDGVWKSPADTPSS  405



>ref|XP_008669375.1| PREDICTED: auxin response factor 9-like isoform X1 [Zea mays]
Length=661

 Score = 86.7 bits (213),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRS+FIVSVNKY+EA+   +SVG    MRFEG++ PER
Sbjct  253  ATASHAISTGTLFSVFYKPRTSRSDFIVSVNKYLEAKKQKISVGMRFKMRFEGDDAPER  311


 Score = 76.6 bits (187),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 60/111 (54%), Gaps = 15/111 (14%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS WRSLK              +SPWE+E L  + PQ+ 
Sbjct  312  RFSGTIIGIGSLPAMSKSLWADSDWRSLKVQWDEPSSILRPDRISPWEVEPLDAANPQSP  371

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFP  236
            QPP R KR RP   P  VSE  S  G WKSPI+S  + S+ +  R  + FP
Sbjct  372  QPPLRAKRPRPPASPCMVSELPSGFGLWKSPIESSCTLSFSEPQRARELFP  422



>ref|XP_010418847.1| PREDICTED: auxin response factor 1-like, partial [Camelina sativa]
Length=477

 Score = 85.5 bits (210),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  59   ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  117


 Score = 77.4 bits (189),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 60/99 (61%), Gaps = 17/99 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTST-PQTL-Q  383
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV +  P +  Q
Sbjct  118  RFSGTIVGVQENNSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNIPSSQPQ  177

Query  382  PPQRNKRARPANLPPSV----SEFSALGTWKSPIDSPQS  278
            PPQRNKR RP  LP  +    ++ +  G WKSP D+P S
Sbjct  178  PPQRNKRPRPPGLPTPIPCPSAQVTPDGVWKSPADTPSS  216



>gb|ADG43140.1| auxin response factor 6 [Zea mays]
 tpg|DAA37677.1| TPA: hypothetical protein ZEAMMB73_822305 [Zea mays]
Length=657

 Score = 86.7 bits (213),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRS+FIVSVNKY+EA+   +SVG    MRFEG++ PER
Sbjct  249  ATASHAISTGTLFSVFYKPRTSRSDFIVSVNKYLEAKKQKISVGMRFKMRFEGDDAPER  307


 Score = 76.6 bits (187),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 60/111 (54%), Gaps = 15/111 (14%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS WRSLK              +SPWE+E L  + PQ+ 
Sbjct  308  RFSGTIIGIGSLPAMSKSLWADSDWRSLKVQWDEPSSILRPDRISPWEVEPLDAANPQSP  367

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFP  236
            QPP R KR RP   P  VSE  S  G WKSPI+S  + S+ +  R  + FP
Sbjct  368  QPPLRAKRPRPPASPCMVSELPSGFGLWKSPIESSCTLSFSEPQRARELFP  418



>gb|EEC77345.1| hypothetical protein OsI_16025 [Oryza sativa Indica Group]
Length=660

 Score = 89.4 bits (220),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+   LSVG    MRFEG+E PER
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNLSVGMRFKMRFEGDEAPER  304


 Score = 73.9 bits (180),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 61/112 (54%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS W+SLK              +SPWE+E L  S PQ  
Sbjct  305  RFSGTIIGIGSVPAMSKSPWADSDWKSLKVQWDEPSAIVCPDRVSPWELEPLDASNPQPP  364

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP RNKRARP   P  V+E   + G WK P ++ Q+ S+ +  R  + FPS
Sbjct  365  QPPLRNKRARPPASPSVVAELPPSFGLWKPPSEAAQTLSFSEPQRAREIFPS  416



>ref|XP_002453992.1| hypothetical protein SORBIDRAFT_04g022830 [Sorghum bicolor]
 gb|EES06968.1| hypothetical protein SORBIDRAFT_04g022830 [Sorghum bicolor]
Length=672

 Score = 92.4 bits (228),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+NH +SVG    MRFEG+E PER
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKMSVGMRFKMRFEGDESPER  304


 Score = 70.5 bits (171),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 60/112 (54%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+     N++S W +S+WRSLK              +SPWE+E L  + PQ  
Sbjct  305  RFSGTIIGLGSMPANSTSPWANSEWRSLKVQWDEPSAILRPDRVSPWELEPLDATNPQPP  364

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP RNKRARP   P    E     G WKSP +  Q+FS+    R  + + S
Sbjct  365  QPPLRNKRARPPASPSIAPELPPVFGFWKSPAEPAQAFSFSGLQRTQELYHS  416



>emb|CAE04227.2| OSJNBa0064D20.11 [Oryza sativa Japonica Group]
 gb|EEE61062.1| hypothetical protein OsJ_14920 [Oryza sativa Japonica Group]
Length=669

 Score = 89.4 bits (220),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+   LSVG    MRFEG+E PER
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNLSVGMRFKMRFEGDEAPER  304


 Score = 73.6 bits (179),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 61/112 (54%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS W+SLK              +SPWE+E L  S PQ  
Sbjct  305  RFSGTIIGIGSVPAMSKSPWADSDWKSLKVQWDEPSAIVRPDRVSPWELEPLDASNPQPP  364

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP RNKRARP   P  V+E   + G WK P ++ Q+ S+ +  R  + FPS
Sbjct  365  QPPLRNKRARPPASPSVVAELPPSFGLWKPPSEAAQTLSFSEPQRAREIFPS  416



>ref|NP_001052879.1| Os04g0442000 [Oryza sativa Japonica Group]
 sp|Q0JCZ4.1|ARFI_ORYSJ RecName: Full=Auxin response factor 9 [Oryza sativa Japonica 
Group]
 dbj|BAF14793.1| Os04g0442000 [Oryza sativa Japonica Group]
Length=673

 Score = 89.0 bits (219),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+   LSVG    MRFEG+E PER
Sbjct  250  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNLSVGMRFKMRFEGDEAPER  308


 Score = 73.6 bits (179),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 61/112 (54%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS W+SLK              +SPWE+E L  S PQ  
Sbjct  309  RFSGTIIGIGSVPAMSKSPWADSDWKSLKVQWDEPSAIVRPDRVSPWELEPLDASNPQPP  368

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP RNKRARP   P  V+E   + G WK P ++ Q+ S+ +  R  + FPS
Sbjct  369  QPPLRNKRARPPASPSVVAELPPSFGLWKPPSEAAQTLSFSEPQRAREIFPS  420



>emb|CDY33603.1| BnaC01g28340D [Brassica napus]
Length=661

 Score = 87.0 bits (214),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+N  L+VG    MRFEGEE PE+
Sbjct  247  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNQKLAVGMRFKMRFEGEEAPEK  305


 Score = 75.9 bits (185),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 13/95 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQ-P  380
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV +   +   P
Sbjct  306  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTLSAHLP  365

Query  379  PQRNKRARPAN-LPPSVSEFSALGTWKSPIDSPQS  278
            PQRNKR RP   L P+ +  +  G WKSP D+P S
Sbjct  366  PQRNKRPRPPGLLSPTTAPSTPDGVWKSPADNPSS  400



>emb|CDY65065.1| BnaA01g35830D [Brassica napus]
Length=661

 Score = 87.0 bits (214),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+N  L+VG    MRFEGEE PE+
Sbjct  247  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNQKLAVGMRFKMRFEGEEAPEK  305


 Score = 75.5 bits (184),  Expect(2) = 4e-31, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 57/95 (60%), Gaps = 13/95 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQ-P  380
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV +   +   P
Sbjct  306  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANNTLSAHLP  365

Query  379  PQRNKRARPAN-LPPSVSEFSALGTWKSPIDSPQS  278
            PQRNKR RP   L P+ +  +  G WKSP D+P S
Sbjct  366  PQRNKRPRPPGLLSPTTAPSTPDGVWKSPADNPSS  400



>ref|XP_008795277.1| PREDICTED: auxin response factor 7-like isoform X2 [Phoenix dactylifera]
Length=670

 Score = 95.5 bits (236),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 47/65 (72%), Positives = 56/65 (86%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRSEFI+SVNKY+EA+NH LSVG    MRFEG+E PERS
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSEFIISVNKYLEAKNHKLSVGMRFKMRFEGDEAPERS  311

Query  528  CTDSV  514
             + ++
Sbjct  312  FSGTI  316


 Score = 66.6 bits (161),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 42/67 (63%), Gaps = 11/67 (16%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPPQ  374
            FSGTI+GV D+T SRW DS+WRSLK              +SPWE+E LV STPQ      
Sbjct  312  FSGTIIGVGDSTQSRWADSEWRSLKVQWDEPSSIPRPDRVSPWELEPLVASTPQASHQTA  371

Query  373  RNKRARP  353
            R+KRARP
Sbjct  372  RHKRARP  378



>ref|XP_010065238.1| PREDICTED: auxin response factor 1 isoform X1 [Eucalyptus grandis]
 ref|XP_010065239.1| PREDICTED: auxin response factor 1 isoform X1 [Eucalyptus grandis]
 gb|KCW62581.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=675

 Score = 87.8 bits (216),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVS+NKY+EA+ H LS+GMR    FEGEEV ER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEARAHKLSIGMRFKMKFEGEEVSER  309


 Score = 74.3 bits (181),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 62/112 (55%), Gaps = 14/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D+ SS W +S+WRSLK              +S WE+E LV + P   Q  
Sbjct  310  RFSGTIIGVGDSMSSGWTNSEWRSLKVQWDEPSSIMRPDRVSSWELEPLVVTAPSNSQQV  369

Query  376  QRNKRARPANLP-PSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QR KRARP  LP  SV E S  G  K+P +    F + D+ RG D + SPK 
Sbjct  370  QR-KRARPTVLPSSSVQELSVFGGPKAP-EYSSDFLHGDSQRGRDVYLSPKF  419



>gb|KCW62582.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=671

 Score = 87.8 bits (216),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVS+NKY+EA+ H LS+GMR    FEGEEV ER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEARAHKLSIGMRFKMKFEGEEVSER  309


 Score = 74.3 bits (181),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 62/112 (55%), Gaps = 14/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D+ SS W +S+WRSLK              +S WE+E LV + P   Q  
Sbjct  310  RFSGTIIGVGDSMSSGWTNSEWRSLKVQWDEPSSIMRPDRVSSWELEPLVVTAPSNSQQV  369

Query  376  QRNKRARPANLP-PSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QR KRARP  LP  SV E S  G  K+P +    F + D+ RG D + SPK 
Sbjct  370  QR-KRARPTVLPSSSVQELSVFGGPKAP-EYSSDFLHGDSQRGRDVYLSPKF  419



>gb|KCW62583.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=649

 Score = 87.4 bits (215),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVS+NKY+EA+ H LS+GMR    FEGEEV ER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEARAHKLSIGMRFKMKFEGEEVSER  309


 Score = 74.3 bits (181),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 62/112 (55%), Gaps = 14/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D+ SS W +S+WRSLK              +S WE+E LV + P   Q  
Sbjct  310  RFSGTIIGVGDSMSSGWTNSEWRSLKVQWDEPSSIMRPDRVSSWELEPLVVTAPSNSQQV  369

Query  376  QRNKRARPANLP-PSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QR KRARP  LP  SV E S  G  K+P +    F + D+ RG D + SPK 
Sbjct  370  QR-KRARPTVLPSSSVQELSVFGGPKAP-EYSSDFLHGDSQRGRDVYLSPKF  419



>ref|NP_001152338.1| LOC100285977 [Zea mays]
 gb|ACG47111.1| auxin response factor 1 [Zea mays]
Length=676

 Score = 92.4 bits (228),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+NH +SVG    MRFEG+E PER
Sbjct  245  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKMSVGMRFKMRFEGDESPER  303


 Score = 69.3 bits (168),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 59/110 (54%), Gaps = 15/110 (14%)
 Frame = -1

Query  523  RFSGTIVGVQ---DNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSG I+G+     N++S W +S+WRSLK              +SPWE+E L  + PQ  
Sbjct  304  RFSGIIIGMGCMPANSTSPWANSEWRSLKVQWDEPSAILRPDRVSPWEVEPLNRTNPQPP  363

Query  385  QPPQRNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSYCDTSRGTDHF  239
            QPP RNKRARP   P    E +   G WKSP +  Q+FS+    R  + +
Sbjct  364  QPPLRNKRARPPASPSIAPELAPVFGFWKSPAEPAQAFSFSGLQRTQELY  413



>ref|XP_010065240.1| PREDICTED: auxin response factor 1 isoform X2 [Eucalyptus grandis]
 gb|KCW62584.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=565

 Score = 87.4 bits (215),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI T TLFSVFY+PRTSRSEFIVS+NKY+EA+ H LS+GMR    FEGEEV ER
Sbjct  251  ATASHAIATGTLFSVFYKPRTSRSEFIVSLNKYLEARAHKLSIGMRFKMKFEGEEVSER  309


 Score = 74.3 bits (181),  Expect(2) = 7e-31, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 62/112 (55%), Gaps = 14/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+GV D+ SS W +S+WRSLK              +S WE+E LV + P   Q  
Sbjct  310  RFSGTIIGVGDSMSSGWTNSEWRSLKVQWDEPSSIMRPDRVSSWELEPLVVTAPSNSQQV  369

Query  376  QRNKRARPANLP-PSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPKL  224
            QR KRARP  LP  SV E S  G  K+P +    F + D+ RG D + SPK 
Sbjct  370  QR-KRARPTVLPSSSVQELSVFGGPKAP-EYSSDFLHGDSQRGRDVYLSPKF  419



>ref|XP_009404302.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404304.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404305.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score = 86.7 bits (213),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PR SRSEFI+S+NKYIEA++H  SVG    MRFEG++ PER
Sbjct  246  ATASHAITTGTLFSVFYKPRASRSEFIISLNKYIEAKSHKFSVGMRFKMRFEGDDTPER  304


 Score = 73.9 bits (180),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 64/111 (58%), Gaps = 12/111 (11%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG  D  SS+W DS+WRSLK             ++SPWE+E L+ + P + QP 
Sbjct  305  RFSGTIVGAIDKVSSQWADSEWRSLKVQWDEPSSTLRPDSVSPWELEPLIAAAPPSAQPV  364

Query  376  QRNKRAR-PANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPSPK  227
            QR KRAR PA+   +       G+WKS +++ Q FS+    RG + + S K
Sbjct  365  QRIKRARLPASPVGTPGPSPTPGSWKSQVETTQMFSFSGPQRGEEPYSSYK  415



>emb|CDY27291.1| BnaC04g18710D [Brassica napus]
Length=619

 Score = 87.4 bits (215),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+N  LSVG    MRFEGEE PE+
Sbjct  251  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNQKLSVGMRFKMRFEGEEAPEK  309


 Score = 72.8 bits (177),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 58/98 (59%), Gaps = 16/98 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQ-P  380
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E +V ++ ++   P
Sbjct  310  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDESSSVFRPERVSPWELEPIVANSMRSSHPP  369

Query  379  PQRNKRARPANLPPSVSE----FSALGTWKSPIDSPQS  278
            PQRNKR RP  LP   +      +A G WKSP  +P S
Sbjct  370  PQRNKRPRPPGLPSPTTAPSTPVTADGLWKSPAVNPSS  407



>ref|XP_004952778.1| PREDICTED: auxin response factor 7-like isoform X1 [Setaria italica]
 ref|XP_004952779.1| PREDICTED: auxin response factor 7-like isoform X2 [Setaria italica]
Length=673

 Score = 92.4 bits (228),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 52/59 (88%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+NH +SVG    MRFEG+E PER
Sbjct  247  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKMSVGMRFKMRFEGDESPER  305


 Score = 67.8 bits (164),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 58/112 (52%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+     N++S W DS WRSLK              +SPWE+E L  +  Q  
Sbjct  306  RFSGTIIGLGSMPANSTSPWADSDWRSLKVQWDEPSAVLRPDRVSPWELEPLDATNIQPP  365

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP RNKRARP   P    E   A G WKSP +   +FS+    R  + + S
Sbjct  366  QPPLRNKRARPPASPSIAPELPPAFGFWKSPAEPTHAFSFSGLQRTQELYHS  417



>ref|XP_006648743.1| PREDICTED: auxin response factor 7-like [Oryza brachyantha]
Length=674

 Score = 86.7 bits (213),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTS+SEF+VS+NKY+EA+N  +SVG    MRFEG+E PER
Sbjct  249  ATASHAISTGTLFSVFYKPRTSQSEFVVSLNKYLEAKNSKISVGMRFKMRFEGDEAPER  307


 Score = 73.2 bits (178),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 50/116 (43%), Positives = 59/116 (51%), Gaps = 25/116 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL-QP  380
            RFSGTI+GV    +S W +S WRSLK              +SPWE+E L  S  Q L QP
Sbjct  308  RFSGTIIGVGSMPTSPWANSDWRSLKVQWDEPSVVPRPDRVSPWELEPLAVSNTQPLPQP  367

Query  379  PQRNKRARP-------ANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            P RNKRARP         LPP        G WKSP +S Q FS+    R  + +PS
Sbjct  368  PARNKRARPPASNSIAPELPP------VFGLWKSPAESTQGFSFSGLQRTHELYPS  417



>ref|XP_006653437.1| PREDICTED: auxin response factor 9-like [Oryza brachyantha]
Length=673

 Score = 91.7 bits (226),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+TRTLFSVFY+PRTSRSEF+VSVNKY+EA+   LSVG    MRFEG+E PER
Sbjct  251  ATASHAISTRTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNLSVGMRFKMRFEGDEAPER  309


 Score = 66.2 bits (160),  Expect(2) = 8e-30, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 64/112 (57%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      ++S W DS W+SLK              +SPWE+E L T+ PQ  
Sbjct  310  RFSGTIIGIGSVPAMSTSPWADSDWKSLKVQWDEPSSIVRPDRISPWELEPLDTTNPQPP  369

Query  385  QPPQRNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP RNKRARP   P  VSE   + G WKSP ++ Q+ S+ +  R  + FPS
Sbjct  370  QPPLRNKRARPPASPSVVSELLPSFGLWKSPSEAAQTLSFSEPHRTREIFPS  421



>gb|EPS68815.1| auxin response factor 1 [Genlisea aurea]
Length=428

 Score = 88.6 bits (218),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PR+S+SEF++SVNKY++AQNH LSVG    MRFE EE PER
Sbjct  267  ATASHAITTGTLFSVFYKPRSSQSEFVISVNKYLDAQNHKLSVGMRFKMRFEAEEAPER  325


 Score = 68.2 bits (165),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 45/78 (58%), Gaps = 11/78 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF GTIVG++   S RWPDS+WRSLK              +SPWE+EA+  +TP T Q  
Sbjct  326  RFGGTIVGIEKGASPRWPDSEWRSLKVQWDEPSSTIRPDKISPWELEAVNAATPSTSQAQ  385

Query  376  QRNKRARPANLPPSVSEF  323
            QR KR RPA L   + E 
Sbjct  386  QRAKRTRPAVLCSPIQEL  403



>ref|NP_001047137.1| Os02g0557200 [Oryza sativa Japonica Group]
 sp|Q6YVY0.1|ARFG_ORYSJ RecName: Full=Auxin response factor 7 [Oryza sativa Japonica 
Group]
 dbj|BAD16420.1| putative auxin-responsive factor (ARF1) [Oryza sativa Japonica 
Group]
 dbj|BAF09051.1| Os02g0557200 [Oryza sativa Japonica Group]
 gb|EEE57194.1| hypothetical protein OsJ_07141 [Oryza sativa Japonica Group]
Length=678

 Score = 86.3 bits (212),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTS+SEF+VS NKY+EA+N  +SVG    MRFEG+E PER
Sbjct  252  ATASHAISTGTLFSVFYKPRTSQSEFVVSANKYLEAKNSKISVGMRFKMRFEGDEAPER  310


 Score = 69.7 bits (169),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 59/116 (51%), Gaps = 25/116 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQ-TLQP  380
            RFSGTI+GV   ++S W +S WRSLK              +SPWE+E L  S  Q + QP
Sbjct  311  RFSGTIIGVGSMSTSPWANSDWRSLKVQWDEPSVVPRPDRVSPWELEPLAVSNSQPSPQP  370

Query  379  PQRNKRARP-------ANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            P RNKRARP         LPP        G WKS  +S Q FS+    R  + +PS
Sbjct  371  PARNKRARPPASNSIAPELPP------VFGLWKSSAESTQGFSFSGLQRTQELYPS  420



>ref|XP_010548428.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548436.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548444.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548451.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548460.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548467.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
Length=654

 Score = 91.7 bits (226),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T T+FSVFY+PRTSRSEFIVSVN+Y+EA+NH LSVG    MRFEGEE PER
Sbjct  250  ATASHAMTTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNHKLSVGMRFKMRFEGEEAPER  308


 Score = 64.3 bits (155),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 54/96 (56%), Gaps = 25/96 (26%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK------GFTLSP-----WEIEAL--VTSTPQT-L  386
            RFSGTIVGV++N S+ W DS+WRSLK         L P     WEIE L  V + P T  
Sbjct  309  RFSGTIVGVKENKSTVWSDSEWRSLKVQWDETACVLRPERVSAWEIEPLVAVNTNPSTNS  368

Query  385  QPPQRNKRARPANLPPSVSEFSALGTWKSPIDSPQS  278
            QPPQRNKR+RP   PP        G WKS  ++  S
Sbjct  369  QPPQRNKRSRP---PP--------GMWKSSAETQSS  393



>gb|EEC73404.1| hypothetical protein OsI_07659 [Oryza sativa Indica Group]
Length=678

 Score = 86.3 bits (212),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTS+SEF+VS NKY+EA+N  +SVG    MRFEG+E PER
Sbjct  252  ATASHAISTGTLFSVFYKPRTSQSEFVVSANKYLEAKNSKISVGMRFKMRFEGDEAPER  310


 Score = 69.7 bits (169),  Expect(2) = 4e-29, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 59/116 (51%), Gaps = 25/116 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQ-TLQP  380
            RFSGTI+GV   ++S W +S WRSLK              +SPWE+E L  S  Q + QP
Sbjct  311  RFSGTIIGVGSMSTSPWANSDWRSLKVQWDEPSVVPRPDRVSPWELEPLAVSNSQPSPQP  370

Query  379  PQRNKRARP-------ANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            P RNKRARP         LPP        G WKS  +S Q FS+    R  + +PS
Sbjct  371  PARNKRARPPASSSIAPELPP------VFGLWKSSAESTQGFSFSGLQRTQELYPS  420



>emb|CBI16989.3| unnamed protein product [Vitis vinifera]
Length=643

 Score = 87.8 bits (216),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PR S SEFIVSVNKY+EA+NH +SVG    MRFEG+E PER
Sbjct  249  ATASHAITTGTLFSVFYKPRASPSEFIVSVNKYLEARNHKVSVGMRFKMRFEGDEAPER  307


 Score = 66.2 bits (160),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 48/83 (58%), Gaps = 14/83 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV D  SS W DS+WRSLK              +SPWE+E LVT TP T QP 
Sbjct  308  RFSGTIVGVGDTGSSGWTDSEWRSLKVQWDEPSSILRPERVSPWELEPLVTETPLTAQPM  367

Query  376  QRNKRARPANLP---PSVSEFSA  317
            QR+KR R   L    P +S F+ 
Sbjct  368  QRSKRPRSPVLSSPTPGLSAFAV  390



>ref|XP_002266947.1| PREDICTED: auxin response factor 1-like [Vitis vinifera]
Length=645

 Score = 87.8 bits (216),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI T TLFSVFY+PR S SEFIVSVNKY+EA+NH +SVG    MRFEG+E PER
Sbjct  251  ATASHAITTGTLFSVFYKPRASPSEFIVSVNKYLEARNHKVSVGMRFKMRFEGDEAPER  309


 Score = 66.2 bits (160),  Expect(2) = 1e-28, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 48/83 (58%), Gaps = 14/83 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV D  SS W DS+WRSLK              +SPWE+E LVT TP T QP 
Sbjct  310  RFSGTIVGVGDTGSSGWTDSEWRSLKVQWDEPSSILRPERVSPWELEPLVTETPLTAQPM  369

Query  376  QRNKRARPANLP---PSVSEFSA  317
            QR+KR R   L    P +S F+ 
Sbjct  370  QRSKRPRSPVLSSPTPGLSAFAV  392



>gb|ADG43148.1| auxin response factor 14 [Zea mays]
Length=672

 Score = 92.4 bits (228),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+NH +SVG    MRFEG+E PER 
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKVSVGMRFKMRFEGDESPERR  305

Query  528  CTDSV  514
             + ++
Sbjct  306  LSGTI  310


 Score = 58.5 bits (140),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 15/100 (15%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL  386
            R SGTI+G+     N++S W +S WRSL+              +SPWE+E L  + PQ  
Sbjct  305  RLSGTIIGLGSMPANSTSPWANSDWRSLRVQWDEPSAILRPDRVSPWELEPLDATNPQPP  364

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSY  269
            QP  RNKRARP  L     E     G  KSP +  Q+FS+
Sbjct  365  QPHLRNKRARPPALLSIAPELPQVFGFLKSPAEPAQAFSF  404



>ref|XP_010239942.1| PREDICTED: auxin response factor 9-like [Brachypodium distachyon]
Length=646

 Score = 83.6 bits (205),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+   +SVGMR    FEG+E  ER
Sbjct  252  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNMSVGMRFKMKFEGDEALER  310


 Score = 67.0 bits (162),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (54%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQDNT---SSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTIVG+       SS+W DS W+SLK              +S WE+E L ++ PQT 
Sbjct  311  RFSGTIVGMGSTPTMPSSQWADSDWKSLKVQWDEPSSILRPDRVSLWELEPLDSANPQTP  370

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            +PP RNKRAR    P  V +     G WKSP +  Q+ S+ +  R  + FP+
Sbjct  371  EPPLRNKRARALASPSVVPDLPPNFGLWKSPSEPSQTLSFSEPQRARELFPT  422



>ref|NP_001183800.1| hypothetical protein [Zea mays]
 gb|ACR38344.1| unknown [Zea mays]
 gb|AFT82693.1| ARF14 ARF type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW62635.1| hypothetical protein ZEAMMB73_114282 [Zea mays]
Length=511

 Score = 92.0 bits (227),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 55/65 (85%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+NH +SVG    MRFEG+E PER 
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKNHKVSVGMRFKMRFEGDESPERR  305

Query  528  CTDSV  514
             + ++
Sbjct  306  LSGTI  310


 Score = 58.5 bits (140),  Expect(2) = 1e-27, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 52/100 (52%), Gaps = 15/100 (15%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            R SGTI+G+     N++S W +S WRSL+              +SPWE+E L  + PQ  
Sbjct  305  RLSGTIIGLGSMPANSTSPWANSDWRSLRVQWDEPSAILRPDRVSPWELEPLDATNPQPP  364

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSY  269
            QP  RNKRARP  L     E     G  KSP +  Q+FS+
Sbjct  365  QPHLRNKRARPPALLSIAPELPQVFGFLKSPAEPAQAFSF  404



>ref|XP_009403719.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
Length=653

 Score = 77.8 bits (190),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 48/59 (81%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HA +T T FSVFY+PRT+RSEF++SVNKY+E +N  +S+G    MRFEG+E PE+
Sbjct  247  ATAAHAFSTGTRFSVFYKPRTNRSEFVISVNKYLEGKNKKISMGMRFKMRFEGDEAPEK  305


 Score = 68.6 bits (166),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 55/99 (56%), Gaps = 20/99 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+G+ D  +S W DS+WRSLK              +SPWE+  LV +T  T QP 
Sbjct  306  RFSGTIIGMGDTKTSIWADSEWRSLKVRWDEHSSIMRPDKVSPWELVPLVAATHLTSQPV  365

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDT  260
            QR+KRARP   P           WKSP ++ Q++S  +T
Sbjct  366  QRSKRARPPGSPE---------LWKSPEETTQNYSVSET  395



>emb|CAE02512.1| P0076O17.10 [Oryza sativa Japonica Group]
Length=1673

 Score = 88.2 bits (217),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 44/59 (75%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRSEF+VSVNKY+EA+   LSVG    MRFEG+E PER
Sbjct  246  ATASHAISTGTLFSVFYKPRTSRSEFVVSVNKYLEAKKQNLSVGMRFKMRFEGDEAPER  304


 Score = 57.8 bits (138),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 44/81 (54%), Gaps = 14/81 (17%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS W+SLK              +SPWE+E L  S PQ  
Sbjct  305  RFSGTIIGIGSVPAMSKSPWADSDWKSLKVQWDEPSAIVRPDRVSPWELEPLDASNPQPP  364

Query  385  QPPQRNKRARPANLPPSVSEF  323
            QPP RNKRARP   P  V+E 
Sbjct  365  QPPLRNKRARPPASPSVVAEL  385



>ref|XP_006392241.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
 ref|XP_006392242.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
 gb|ESQ29527.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
 gb|ESQ29528.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
Length=667

 Score = 87.8 bits (216),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+N  LSVGMR    FEGEE PE+
Sbjct  252  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKNQKLSVGMRFKMKFEGEEAPEK  310


 Score = 52.8 bits (125),  Expect(2) = 1e-24, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 51/94 (54%), Gaps = 14/94 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTP--QTL  386
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E LV  STP     
Sbjct  311  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPLVANSTPSSHPQ  370

Query  385  QPPQRNKRARPANLPPSVSEFSALGTWKSPIDSP  284
             PP+  +   P    P+    +  G WKSP D+P
Sbjct  371  PPPRNKRPRPPGLPSPTTGPPTPDGVWKSPADTP  404



>ref|XP_002446522.1| hypothetical protein SORBIDRAFT_06g017490 [Sorghum bicolor]
 gb|EES10850.1| hypothetical protein SORBIDRAFT_06g017490 [Sorghum bicolor]
Length=661

 Score = 87.8 bits (216),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 50/59 (85%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTSRS+FIVSVNKY+EA+   +SVG    MRFEG+E PER
Sbjct  253  ATASHAISTGTLFSVFYKPRTSRSDFIVSVNKYLEAKKQKISVGMRFKMRFEGDEAPER  311


 Score = 51.6 bits (122),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 61/112 (54%), Gaps = 15/112 (13%)
 Frame = -1

Query  523  RFSGTIVGVQD---NTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      + S W DS WRSLK              +SPWE+E L  + PQ+ 
Sbjct  312  RFSGTIIGIGSLPAMSKSLWADSDWRSLKVQWDEPSSILRPDRISPWEVEPLDAANPQSP  371

Query  385  QPPQRNKRARPANLPPSVSEF-SALGTWKSPIDSPQSFSYCDTSRGTDHFPS  233
            QPP R KR RP   P  VSE  S  G WKSP +S ++ S+ +  R  + FPS
Sbjct  372  QPPPRPKRPRPPASPCMVSELPSGFGLWKSPTESSRTLSFSEPQRARELFPS  423



>ref|XP_010100721.1| Auxin response factor 18 [Morus notabilis]
 gb|EXB83883.1| Auxin response factor 18 [Morus notabilis]
Length=695

 Score = 72.4 bits (176),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 5/65 (8%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HAI T+T+F V+Y+PRT+  +F+V VNKYIEA +H  SVG    MRFEGE+ PER 
Sbjct  253  ATAAHAITTQTIFIVYYKPRTNH-QFLVGVNKYIEAVSHNFSVGMRFKMRFEGEDSPERR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 63.9 bits (154),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 46/75 (61%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D +SS+W DSKWRSLK             T+SPWEIE  V S P  + QP
Sbjct  311  RFTGTIVGVGD-SSSQWKDSKWRSLKVQWDEHATIQRPDTVSPWEIEPFVASNPLNITQP  369

Query  379  PQRNKRARPANLPPS  335
              +NKR RP  +P S
Sbjct  370  APKNKRPRPVEIPSS  384



>ref|XP_009764747.1| PREDICTED: auxin response factor 9-like isoform X1 [Nicotiana 
sylvestris]
Length=665

 Score = 72.4 bits (176),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+TLF V+Y+PRT  S+FI+ +NKY+E   H  SVGMR    FEGEE PER 
Sbjct  253  ATASHAVTTQTLFVVYYKPRT--SQFIIGLNKYLETVKHGYSVGMRFKMQFEGEESPERR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 63.5 bits (153),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 54/97 (56%), Gaps = 18/97 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG++D  SS+W DS WRSLK              +SPWEIE  V S P  L PP
Sbjct  310  RFTGTIVGIED-LSSQWKDSTWRSLKVQWDEPASISRPDRVSPWEIEPFVASVPNPLVPP  368

Query  376  Q--RNKRARPANLPPSVSEFS---ALGTWKSPIDSPQ  281
               +NKR RP ++   +SE +   A   W   IDSPQ
Sbjct  369  MAGKNKRHRP-HIETKISEPASSVASAVWNPSIDSPQ  404



>ref|XP_009764748.1| PREDICTED: auxin response factor 9-like isoform X2 [Nicotiana 
sylvestris]
Length=654

 Score = 72.0 bits (175),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+TLF V+Y+PRT  S+FI+ +NKY+E   H  SVGMR    FEGEE PER 
Sbjct  253  ATASHAVTTQTLFVVYYKPRT--SQFIIGLNKYLETVKHGYSVGMRFKMQFEGEESPERR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 63.5 bits (153),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 54/97 (56%), Gaps = 18/97 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG++D  SS+W DS WRSLK              +SPWEIE  V S P  L PP
Sbjct  310  RFTGTIVGIED-LSSQWKDSTWRSLKVQWDEPASISRPDRVSPWEIEPFVASVPNPLVPP  368

Query  376  Q--RNKRARPANLPPSVSEFS---ALGTWKSPIDSPQ  281
               +NKR RP ++   +SE +   A   W   IDSPQ
Sbjct  369  MAGKNKRHRP-HIETKISEPASSVASAVWNPSIDSPQ  404



>ref|XP_004172315.1| PREDICTED: auxin response factor 1-like, partial [Cucumis sativus]
Length=335

 Score = 96.3 bits (238),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 56/65 (86%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLFSVFY+PRTSRS F+VS+NKY+EAQNH LSVG    MRFEGEEVPERS
Sbjct  251  ATASHAISTGTLFSVFYKPRTSRSTFLVSLNKYLEAQNHKLSVGMRFKMRFEGEEVPERS  310

Query  528  CTDSV  514
             + ++
Sbjct  311  FSGTI  315


 Score = 39.3 bits (90),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 0/25 (0%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLK  446
            FSGTIVG+ DN S  W +S+WRSLK
Sbjct  311  FSGTIVGLGDNASPGWANSEWRSLK  335



>pdb|4LDY|A Chain A, Crystal Structure Of The Dna Binding Domain Of The G245a 
Mutant Of Arabidopsis Thaliana Auxin Reponse Factor 1
 pdb|4LDY|B Chain B, Crystal Structure Of The Dna Binding Domain Of The G245a 
Mutant Of Arabidopsis Thaliana Auxin Reponse Factor 1
Length=362

 Score = 84.7 bits (208),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 49.7 bits (117),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 11/49 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEAL  410
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E L
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPL  355



>pdb|4LDX|A Chain A, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1 (arf1) In Complex With 
Protomor-like Sequence Er7
 pdb|4LDX|B Chain B, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1 (arf1) In Complex With 
Protomor-like Sequence Er7
Length=363

 Score = 84.7 bits (208),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 49.3 bits (116),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 11/49 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEAL  410
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E L
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPL  355



>pdb|4LDV|A Chain A, Crystal Structure Of The Dna Binding Domain Of A. Thailana 
Auxin Response Factor 1
 pdb|4LDW|A Chain A, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1, P21 Structure
 pdb|4LDW|B Chain B, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1, P21 Structure
Length=362

 Score = 84.7 bits (208),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HAI T T+FSVFY+PRTSRSEFIVSVN+Y+EA+   LSVG    MRFEGEE PE+
Sbjct  248  ATAAHAITTGTIFSVFYKPRTSRSEFIVSVNRYLEAKTQKLSVGMRFKMRFEGEEAPEK  306


 Score = 49.3 bits (116),  Expect(2) = 9e-23, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 31/49 (63%), Gaps = 11/49 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEAL  410
            RFSGTIVGVQ+N SS W DS+WRSLK              +SPWE+E L
Sbjct  307  RFSGTIVGVQENKSSVWHDSEWRSLKVQWDEPSSVFRPERVSPWELEPL  355



>ref|XP_010324454.1| PREDICTED: auxin response factor 12 isoform X1 [Solanum lycopersicum]
 ref|XP_010324455.1| PREDICTED: auxin response factor 12 isoform X1 [Solanum lycopersicum]
 ref|XP_010324456.1| PREDICTED: auxin response factor 12 isoform X1 [Solanum lycopersicum]
Length=685

 Score = 73.9 bits (180),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+ +NKY+EA  H  SVGMR    FEGEE+PE+ 
Sbjct  257  ATASHAVTTQTMFVVYYKPRT--SQFIIGLNKYLEAVKHRYSVGMRFKMKFEGEEIPEKR  314

Query  528  CTDSV  514
             T ++
Sbjct  315  FTGTI  319


 Score = 58.5 bits (140),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 48/88 (55%), Gaps = 16/88 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D +SS+W DSKWRSLK              +SPW+IE  V S    L PP
Sbjct  314  RFTGTIVGVED-SSSQWKDSKWRSLKVQWDEPASVPRPDRVSPWDIEPFVASVATPLVPP  372

Query  376  Q--RNKRARPANLPPSVSEF--SALGTW  305
               +NKR R  N P S      +AL  W
Sbjct  373  MGVKNKRHRAHNEPKSSEPVPAAALAAW  400



>ref|XP_009341874.1| PREDICTED: auxin response factor 9-like [Pyrus x bretschneideri]
Length=684

 Score = 72.4 bits (176),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  240  ATASHAVATQTLFVVYYKPRT--SQFIIGLNKYLEAVNNKFSVGMRFKMRFEGEDAPER  296


 Score = 60.1 bits (144),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 51/100 (51%), Gaps = 17/100 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG++D  S  W DSKWRSLK              +SPWEIE  V S   +L  P
Sbjct  297  RFSGTIVGLED-ISPHWADSKWRSLKVHWDESASIPRPDRVSPWEIEPFVASVIPSLPQP  355

Query  376  Q---RNKRARPANLPPSVSEFSALG--TWKSPIDSPQSFS  272
                +NKR RP    P++   S+ G  TW S +  P   S
Sbjct  356  SVVVKNKRPRPPTEIPALDAMSSTGSATWNSVLTQPHDLS  395



>ref|XP_010324457.1| PREDICTED: auxin response factor 12 isoform X2 [Solanum lycopersicum]
Length=683

 Score = 73.9 bits (180),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+ +NKY+EA  H  SVGMR    FEGEE+PE+ 
Sbjct  255  ATASHAVTTQTMFVVYYKPRT--SQFIIGLNKYLEAVKHRYSVGMRFKMKFEGEEIPEKR  312

Query  528  CTDSV  514
             T ++
Sbjct  313  FTGTI  317


 Score = 58.5 bits (140),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 48/88 (55%), Gaps = 16/88 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D +SS+W DSKWRSLK              +SPW+IE  V S    L PP
Sbjct  312  RFTGTIVGVED-SSSQWKDSKWRSLKVQWDEPASVPRPDRVSPWDIEPFVASVATPLVPP  370

Query  376  Q--RNKRARPANLPPSVSEF--SALGTW  305
               +NKR R  N P S      +AL  W
Sbjct  371  MGVKNKRHRAHNEPKSSEPVPAAALAAW  398



>ref|XP_009592767.1| PREDICTED: auxin response factor 9-like [Nicotiana tomentosiformis]
Length=669

 Score = 72.4 bits (176),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+TLF V+Y+PRT  S+FI+ +NKY+E   H  SVGMR    FEGEE PER 
Sbjct  253  ATASHAVTTQTLFVVYYKPRT--SQFIIGLNKYLETVKHGYSVGMRFKMQFEGEESPERR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 60.1 bits (144),  Expect(2) = 3e-22, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 52/97 (54%), Gaps = 18/97 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG++D  SS+W DS WRSLK              +SPWEIE  V S P  L PP
Sbjct  310  RFTGTIVGIED-LSSQWKDSTWRSLKVQWDEPASISRPDRVSPWEIEPFVVSVPNPLVPP  368

Query  376  Q--RNKRARPANLPPSVSEFS---ALGTWKSPIDSPQ  281
               +NKR RP +    +SE +   A   W    DSPQ
Sbjct  369  MAGKNKRHRPHS-EAKISEPASSIASAVWNPSTDSPQ  404



>ref|NP_001234602.1| auxin response factor 12 [Solanum lycopersicum]
 gb|ADP06660.1| auxin response factor 12 [Solanum lycopersicum]
Length=405

 Score = 74.3 bits (181),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+ +NKY+EA  H  SVGMR    FEGEE+PE+ 
Sbjct  257  ATASHAVTTQTMFVVYYKPRT--SQFIIGLNKYLEAVKHRYSVGMRFKMKFEGEEIPEKR  314

Query  528  CTDSV  514
             T ++
Sbjct  315  FTGTI  319


 Score = 57.8 bits (138),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 44/76 (58%), Gaps = 14/76 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D +SS+W DSKWRSLK              +SPW+IE  V S    L PP
Sbjct  314  RFTGTIVGVED-SSSQWKDSKWRSLKVQWDEPASVPRPDRVSPWDIEPFVASVATPLVPP  372

Query  376  Q--RNKRARPANLPPS  335
               +NKR R  N P S
Sbjct  373  MGVKNKRHRAHNEPKS  388



>ref|XP_006352241.1| PREDICTED: auxin response factor 9-like isoform X2 [Solanum tuberosum]
Length=683

 Score = 74.3 bits (181),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FIV +NKY+EA  H  SVGMR    FEGEE+PE+ 
Sbjct  256  ATASHAVTTQTMFVVYYKPRT--SQFIVGLNKYLEAVKHRYSVGMRFKMNFEGEEIPEKR  313

Query  528  CTDSV  514
             T ++
Sbjct  314  FTGTI  318


 Score = 57.8 bits (138),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 49/89 (55%), Gaps = 18/89 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D +SS+W DSKWRSLK              +SPW+IE  V S    L PP
Sbjct  313  RFTGTIVGVED-SSSQWKDSKWRSLKVQWDEPASVSRPDRVSPWDIEPFVASVATPLVPP  371

Query  376  Q--RNKRARPANLPPSVSE---FSALGTW  305
               +NKR R  N  P  SE    +AL  W
Sbjct  372  MGVKNKRHRAHN-EPKTSEPVPAAALAAW  399



>ref|XP_006352240.1| PREDICTED: auxin response factor 9-like isoform X1 [Solanum tuberosum]
Length=685

 Score = 74.3 bits (181),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FIV +NKY+EA  H  SVGMR    FEGEE+PE+ 
Sbjct  258  ATASHAVTTQTMFVVYYKPRT--SQFIVGLNKYLEAVKHRYSVGMRFKMNFEGEEIPEKR  315

Query  528  CTDSV  514
             T ++
Sbjct  316  FTGTI  320


 Score = 57.8 bits (138),  Expect(2) = 4e-22, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 49/89 (55%), Gaps = 18/89 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D +SS+W DSKWRSLK              +SPW+IE  V S    L PP
Sbjct  315  RFTGTIVGVED-SSSQWKDSKWRSLKVQWDEPASVSRPDRVSPWDIEPFVASVATPLVPP  373

Query  376  Q--RNKRARPANLPPSVSE---FSALGTW  305
               +NKR R  N  P  SE    +AL  W
Sbjct  374  MGVKNKRHRAHN-EPKTSEPVPAAALAAW  401



>ref|XP_006852604.1| hypothetical protein AMTR_s00021p00221770 [Amborella trichopoda]
 gb|ERN14071.1| hypothetical protein AMTR_s00021p00221770 [Amborella trichopoda]
Length=739

 Score = 73.9 bits (180),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATA+ AI+ ++LF+V+Y+PRTS S FI+ VNKY+EA NH LSVGMR    FEGE+  ER 
Sbjct  268  ATATRAISFQSLFTVYYKPRTSPSGFIIGVNKYLEAMNHRLSVGMRFKMKFEGEDTSERR  327

Query  528  CTDSV  514
             T ++
Sbjct  328  YTGTI  332


 Score = 57.8 bits (138),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 51/89 (57%), Gaps = 13/89 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            R++GTI+GV D  S  W DS+WRSLK              +SPWE+E +V+++P T    
Sbjct  327  RYTGTIIGVGD-VSPGWNDSQWRSLKVQWDESSAIRRPDRVSPWELEPIVSTSPLTTTIQ  385

Query  376  QRNKRARPANLPPSVSEFSALGTWKSPID  290
             RNKRAR  N+P S  E S LG  K+  D
Sbjct  386  PRNKRARLPNMPMS-RERSILGGCKNTTD  413



>emb|CBA12006.1| putative auxin response factor 2/1/9, partial [Cycas rumphii]
Length=775

 Score = 72.8 bits (177),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 45/59 (76%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T T+F+V+Y+PRTS S FI+   KY+EA N+  SVG    MRFEGEE PE+
Sbjct  142  ATASHAVSTHTMFTVYYKPRTSPSGFIIPYEKYMEAMNNNFSVGMRFKMRFEGEEAPEQ  200


 Score = 58.9 bits (141),  Expect(2) = 5e-22, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 46/85 (54%), Gaps = 12/85 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF GTI+G  D+   RWP SKWRSLK              +SPWEIE + T+   +  P 
Sbjct  201  RFIGTIIGTGDSDPVRWPGSKWRSLKVQWDEISVVARPERVSPWEIELIATAAALSPLPV  260

Query  376  QRNKRARPANLPPSVSEFSALGTWK  302
             RNKR R  NL PS    S LG++K
Sbjct  261  SRNKRPR-ENLLPSSPILSILGSFK  284



>ref|XP_010523815.1| PREDICTED: auxin response factor 18-like isoform X1 [Tarenaya 
hassleriana]
Length=618

 Score = 78.6 bits (192),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+NTRTLF VFY+PR   S+FI+ VNKY+EA  H  SVG    MRFEGEE PER 
Sbjct  254  ATASHAVNTRTLFVVFYKPRI--SQFIIGVNKYMEAVKHGFSVGMRFRMRFEGEESPERI  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 52.8 bits (125),  Expect(2) = 6e-22, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 14/81 (17%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQT--LQP  380
            F+GTIVG+ D  S +WP SKWRSL+              +SPWEIE  + S+P     QP
Sbjct  312  FTGTIVGIGD-LSPQWPASKWRSLQTQWDEPASVQRPGKVSPWEIEPFLPSSPMATPAQP  370

Query  379  PQRNKRARPANLPPSVSEFSA  317
              + KR+RP + P SV++ +A
Sbjct  371  QLKCKRSRPVDSPISVTDITA  391



>gb|KDO86503.1| hypothetical protein CISIN_1g005368mg [Citrus sinensis]
Length=664

 Score = 72.0 bits (175),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  252  ATAAHAVKTSTLFIVYYKPRT--SQFIIGLNKYLEAVHHCFSVGMRFKMRFEGEDSPERR  309

Query  528  CTDSV  514
             T ++
Sbjct  310  FTGTI  314


 Score = 59.3 bits (142),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S +WP SKWRSLK              +SPWEIE  V S P  L QP
Sbjct  309  RFTGTIVGVGD-FSEQWPGSKWRSLKIQWDEPATVQRPERVSPWEIEPFVASAPLNLAQP  367

Query  379  PQRNKRARPANLPPSVSEF  323
              ++KR R  ++P S S F
Sbjct  368  AVKSKRPRSIDIPASASAF  386



>ref|XP_006491296.1| PREDICTED: auxin response factor 18-like isoform X2 [Citrus sinensis]
Length=692

 Score = 72.0 bits (175),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  252  ATAAHAVKTSTLFIVYYKPRT--SQFIIGLNKYLEAVHHCFSVGMRFKMRFEGEDSPERR  309

Query  528  CTDSV  514
             T ++
Sbjct  310  FTGTI  314


 Score = 59.3 bits (142),  Expect(2) = 9e-22, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 45/79 (57%), Gaps = 13/79 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S +WP SKWRSLK              +SPWEIE  V S P  L QP
Sbjct  309  RFTGTIVGVGD-FSEQWPGSKWRSLKIQWDEPATVQRPERVSPWEIEPFVASAPLNLAQP  367

Query  379  PQRNKRARPANLPPSVSEF  323
              ++KR R  ++P S S F
Sbjct  368  AVKSKRPRSIDIPASASAF  386



>emb|CDP12183.1| unnamed protein product [Coffea canephora]
Length=693

 Score = 67.4 bits (163),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T TLF V+Y+PRT  S+FI+ +NKY+E+ N+   VG    MRFEGE+ PER
Sbjct  252  ATASHAVATGTLFVVYYKPRT--SQFIIGLNKYLESINNGFGVGMRFKMRFEGEDSPER  308


 Score = 63.2 bits (152),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 53/95 (56%), Gaps = 16/95 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S +W DSKWRSLK         T    +SPWEIE  V + P +L P 
Sbjct  309  RFSGTIVGVED-ISLQWKDSKWRSLKVQWDEPASITRPERVSPWEIEPFVAAVPTSLVPS  367

Query  376  --QRNKRARPAN--LPPSVSEFSALGTWKSPIDSP  284
               +NKR R  +  LPP  +  +A   W  P DSP
Sbjct  368  VTGKNKRLRSHSDLLPPESASSTASAVWNPPHDSP  402



>ref|XP_006343828.1| PREDICTED: auxin response factor 9-like [Solanum tuberosum]
Length=655

 Score = 72.8 bits (177),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT+  +FIVS+NKY+EA NH  SVGMR    FE EE P+R
Sbjct  252  ATASHAVTTQTLFVVYYKPRTT--QFIVSLNKYLEAVNHGYSVGMRFKMQFEAEENPDR  308


 Score = 57.4 bits (137),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 52/97 (54%), Gaps = 18/97 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF GTIVGV D+ SS+W DS WRSLK              +SPWEIE  V+S P  L PP
Sbjct  309  RFMGTIVGV-DDLSSQWKDSAWRSLKVRWDEPAAIARPDRVSPWEIEPYVSSIPNALVPP  367

Query  376  Q--RNKRARPANLPPSVSEFS---ALGTWKSPIDSPQ  281
               +NKR R  +    +SE +   A   W   +DSPQ
Sbjct  368  TAGKNKRHR-LHSEIKISEPASSIASAVWNPSLDSPQ  403



>ref|XP_008341793.1| PREDICTED: auxin response factor 9 [Malus domestica]
Length=683

 Score = 73.9 bits (180),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ TRTLF V+Y+PRT  S+FI+ +NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  240  ATASHAVATRTLFVVYYKPRT--SQFIIGLNKYLEAVNNKFSVGMRFKMRFEGEDAPER  296


 Score = 55.5 bits (132),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 49/92 (53%), Gaps = 16/92 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG++D  S  W DSKWRSLK              +SPWEIE  V S   +L  P
Sbjct  297  RFSGTIVGLED-ISPHWADSKWRSLKVHWDESASIPRPDRVSPWEIEPFVASVLPSLPQP  355

Query  376  Q--RNKRARPANLPPSVSEFSALGT--WKSPI  293
               +NKR RP    P++   S+ G+  W S +
Sbjct  356  AVVKNKRPRPPTEIPALDAMSSTGSAMWNSGL  387



>ref|XP_008233127.1| PREDICTED: auxin response factor 18-like [Prunus mume]
 ref|XP_008233128.1| PREDICTED: auxin response factor 18-like [Prunus mume]
Length=698

 Score = 74.7 bits (182),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ TRTLF V+Y+PRT  S+FI+ +NKY+EA N+  SVG    MRFEGEE PER 
Sbjct  251  ATASHALMTRTLFVVYYKPRT--SQFIIGLNKYLEAINNKFSVGMRFKMRFEGEESPERR  308

Query  528  CTDSV  514
             T ++
Sbjct  309  FTGTI  313


 Score = 54.3 bits (129),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  SS+W +SKWRSLK              +SPWEIE  V S P  L QP
Sbjct  308  RFTGTIVGVGD-LSSQWSESKWRSLKIQWDEHAAVQRPERVSPWEIEPFVASAPIHLAQP  366

Query  379  PQRNKRARPANLPPS  335
              ++KR RP  +  S
Sbjct  367  VVKSKRPRPVEISSS  381



>ref|XP_009358638.1| PREDICTED: auxin response factor 9 [Pyrus x bretschneideri]
Length=682

 Score = 73.9 bits (180),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  SVG    MRFEGE+VPER
Sbjct  240  ATASHALATQTLFVVYYKPRT--SQFIIGLNKYLEAVNNKFSVGIRFKMRFEGEDVPER  296


 Score = 55.1 bits (131),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 47/92 (51%), Gaps = 16/92 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF GTIVG++D  S  W DSKWRSLK              +SPWEIE  V S P +L  P
Sbjct  297  RFPGTIVGLED-VSPHWADSKWRSLKVHWDESASIPRPDKVSPWEIEPFVASVPPSLPQP  355

Query  376  Q--RNKRARPANLPPSVSEFS--ALGTWKSPI  293
               +NKR RP    P++   S  A   W S +
Sbjct  356  AVVKNKRPRPPTEIPALDAMSSTASAIWNSGL  387



>gb|EMT27061.1| Auxin response factor 9 [Aegilops tauschii]
Length=637

 Score = 81.6 bits (200),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 49/59 (83%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPER  532
            ATASHAI+T TLFSVFY+PRTS+SEF+VSVNKY+EA+   +SVGMR    FEG+E  ER
Sbjct  197  ATASHAISTGTLFSVFYKPRTSQSEFVVSVNKYLEAKKQNISVGMRFKMKFEGDEALER  255


 Score = 47.0 bits (110),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 65/125 (52%), Gaps = 27/125 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDN---TSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL  386
            RFSGTI+G+      ++S W DS W+SLK              +SPWE+E L  + PQ  
Sbjct  256  RFSGTIIGIGSTPTVSTSLWADSDWKSLKVQWDEPSSILRPDRVSPWELEPLDAANPQPP  315

Query  385  QPPQRNKRAR-PANLPPSVS---EF--SAL-----GTWKSPIDSPQSFSYCDTSRGTDHF  239
            QPP RNKR R PA+  PSVS   EF  S L     G WKSP +  Q+ S+ +  +    F
Sbjct  316  QPPLRNKRPRLPAS--PSVSIILEFYISKLVLFVSGLWKSPAEPSQTLSFSEPQQARGLF  373

Query  238  PSPKL  224
             + + 
Sbjct  374  TNSRF  378



>ref|XP_008239157.1| PREDICTED: auxin response factor 9 [Prunus mume]
Length=681

 Score = 71.6 bits (174),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  240  ATATHAVATQTLFVVYYKPRT--SQFIIGLNKYLEAVNNKFSVGMRFKMRFEGEDAPER  296


 Score = 57.4 bits (137),  Expect(2) = 4e-21, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 44/77 (57%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+G++D  SS W  SKWRSLK              +SPWEIE  V S P ++  P
Sbjct  297  RFSGTIIGLED-ISSHWSHSKWRSLKVHWDESASVPRPDRVSPWEIEPFVASIPASVPQP  355

Query  376  Q--RNKRARPANLPPSV  332
               +NKR RPA   P+V
Sbjct  356  SAVKNKRPRPAAEIPAV  372



>ref|XP_007210293.1| hypothetical protein PRUPE_ppa002617mg [Prunus persica]
 gb|EMJ11492.1| hypothetical protein PRUPE_ppa002617mg [Prunus persica]
Length=652

 Score = 72.4 bits (176),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER
Sbjct  240  ATATHAVATQTLFVVYYKPRT--SQFIIGVNKYLEAVNNKFSVGMRFKMRFEGEDAPER  296


 Score = 56.2 bits (134),  Expect(2) = 5e-21, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 44/77 (57%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+G++D  SS W  SKWRSLK              +SPWEIE  V S P ++  P
Sbjct  297  RFSGTIIGLED-ISSHWSHSKWRSLKVHWDESASVPRPDRVSPWEIEPFVASIPASVPQP  355

Query  376  Q--RNKRARPANLPPSV  332
               +NKR RPA   P++
Sbjct  356  SAVKNKRPRPAAEIPAL  372



>ref|XP_010055888.1| PREDICTED: auxin response factor 9-like [Eucalyptus grandis]
 gb|KCW72442.1| hypothetical protein EUGRSUZ_E00888 [Eucalyptus grandis]
Length=687

 Score = 73.2 bits (178),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  246  ATASHAVTTQTLFVVYYKPRT--SQFIISLNKYLEALNNKFTVGMRFKMRFEGEDSPER  302


 Score = 55.1 bits (131),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 17/110 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  S +W +S WRSLK              +SPWEIE  V S P  + Q 
Sbjct  303  RFSGTIVGVED-FSPQWDNSSWRSLKVHWDEHASIPRPDRVSPWEIEPFVASVPANIPQS  361

Query  379  PQRNKRARPANLPPSVSEFSALGTWKS---PIDSPQSFSYCDTSRGTDHF  239
              +NKR RP++  P+    +A   W S        +     D  + +DHF
Sbjct  362  TTKNKRPRPSSEVPA-DATAAPAIWNSGYTQTHDLKQLRVTDEGKSSDHF  410



>gb|KCW72443.1| hypothetical protein EUGRSUZ_E00888 [Eucalyptus grandis]
Length=621

 Score = 72.8 bits (177),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  246  ATASHAVTTQTLFVVYYKPRT--SQFIISLNKYLEALNNKFTVGMRFKMRFEGEDSPER  302


 Score = 55.1 bits (131),  Expect(2) = 8e-21, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 54/110 (49%), Gaps = 17/110 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  S +W +S WRSLK              +SPWEIE  V S P  + Q 
Sbjct  303  RFSGTIVGVED-FSPQWDNSSWRSLKVHWDEHASIPRPDRVSPWEIEPFVASVPANIPQS  361

Query  379  PQRNKRARPANLPPSVSEFSALGTWKS---PIDSPQSFSYCDTSRGTDHF  239
              +NKR RP++  P+    +A   W S        +     D  + +DHF
Sbjct  362  TTKNKRPRPSSEVPA-DATAAPAIWNSGYTQTHDLKQLRVTDEGKSSDHF  410



>ref|XP_006491295.1| PREDICTED: auxin response factor 18-like isoform X1 [Citrus sinensis]
 gb|KDO86502.1| hypothetical protein CISIN_1g005368mg [Citrus sinensis]
Length=699

 Score = 72.0 bits (175),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  252  ATAAHAVKTSTLFIVYYKPRT--SQFIIGLNKYLEAVHHCFSVGMRFKMRFEGEDSPERR  309

Query  528  CTDSV  514
             T ++
Sbjct  310  FTGTI  314


 Score = 55.8 bits (133),  Expect(2) = 9e-21, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S +WP SKWRSLK              +SPWEIE  V S P  L QP
Sbjct  309  RFTGTIVGVGD-FSEQWPGSKWRSLKIQWDEPATVQRPERVSPWEIEPFVASAPLNLAQP  367

Query  379  PQRNKRARPANLPPS  335
              ++KR R  ++P S
Sbjct  368  AVKSKRPRSIDIPAS  382



>ref|XP_002303662.2| hypothetical protein POPTR_0003s14200g [Populus trichocarpa]
 gb|EEE78641.2| hypothetical protein POPTR_0003s14200g [Populus trichocarpa]
Length=548

 Score = 72.4 bits (176),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T TLF V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  200  ATASHAISTLTLFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRFKMRFEGEDSPER  256


 Score = 55.1 bits (131),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 41/70 (59%), Gaps = 14/70 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE  V S P  L QP
Sbjct  257  RFSGTIVGVED-FSPHWNDSKWRSLKVQWDEPASISRPDRVSPWEIEPCVASVPANLSQP  315

Query  379  PQ-RNKRARP  353
             Q +NKR RP
Sbjct  316  VQPKNKRPRP  325



>ref|XP_006444823.1| hypothetical protein CICLE_v100191741mg, partial [Citrus clementina]
 gb|ESR58063.1| hypothetical protein CICLE_v100191741mg, partial [Citrus clementina]
Length=509

 Score = 71.2 bits (173),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  252  ATAAHAVKTSTLFIVYYKPRT--SQFIIGLNKYLEAVHHCFSVGMRFKMRFEGEDSPERR  309

Query  528  CTDSV  514
             T ++
Sbjct  310  FTGTI  314


 Score = 55.5 bits (132),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S +WP SKWRSLK              +SPWEIE  V S P  L QP
Sbjct  309  RFTGTIVGVGD-FSEQWPGSKWRSLKIQWDEPATVQRPERVSPWEIEPFVASAPLNLAQP  367

Query  379  PQRNKRARPANLPPS  335
              ++KR R  ++P S
Sbjct  368  AVKSKRPRSIDIPAS  382



>ref|XP_010053162.1| PREDICTED: auxin response factor 9-like [Eucalyptus grandis]
 gb|KCW77417.1| hypothetical protein EUGRSUZ_D01764 [Eucalyptus grandis]
Length=656

 Score = 73.6 bits (179),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  240  ATASHAVQTQTLFVVYYKPRT--SQFIISLNKYLEAVNNKFSVGMRFKMRFEGEDSPER  296


 Score = 53.1 bits (126),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 58/110 (53%), Gaps = 18/110 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  SS+W DSKWRSLK              +SPWEIE+ V S P ++ + 
Sbjct  297  RFSGTIVGVED-ISSQWTDSKWRSLKVQWDEHASVPRPDRVSPWEIESSVPSIPPSMTES  355

Query  379  PQRNKRAR-PANLPP---SVSEFSALGTWKSPIDSPQSFSYCDTSRGTDH  242
                KR R PA LP    + +    +G  +S  DS Q   + +  R  +H
Sbjct  356  AVAKKRPRPPAELPALDTAGATLHDVGLMQS-CDSTQPTVFIEGKRSDNH  404



>ref|XP_010523816.1| PREDICTED: auxin response factor 18-like isoform X2 [Tarenaya 
hassleriana]
Length=616

 Score = 78.6 bits (192),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+NTRTLF VFY+PR   S+FI+ VNKY+EA  H  SVG    MRFEGEE PER 
Sbjct  254  ATASHAVNTRTLFVVFYKPRI--SQFIIGVNKYMEAVKHGFSVGMRFRMRFEGEESPERI  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 48.1 bits (113),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 42/75 (56%), Gaps = 14/75 (19%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQT--LQP  380
            F+GTIVG+ D  S +WP SKWRSL+              +SPWEIE  + S+P     QP
Sbjct  312  FTGTIVGIGD-LSPQWPASKWRSLQTQWDEPASVQRPGKVSPWEIEPFLPSSPMATPAQP  370

Query  379  PQRNKRARPANLPPS  335
              + KR+RP + P S
Sbjct  371  QLKCKRSRPVDSPIS  385



>gb|EMT17168.1| Auxin response factor 4 [Aegilops tauschii]
Length=910

 Score = 77.4 bits (189),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HAINT+T+F+V+Y+PRTSRSEFI+  +KY+E+  +  S+G    MRFEGEE PE+ 
Sbjct  257  ATAWHAINTKTMFTVYYKPRTSRSEFIIPYDKYMESVKNIYSIGTRFKMRFEGEEAPEQR  316

Query  528  CTDSV  514
             T ++
Sbjct  317  FTGTI  321


 Score = 49.3 bits (116),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 50/96 (52%), Gaps = 17/96 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG  DN    WP+S WRSLK              +SPWEIE   +S P    P 
Sbjct  316  RFTGTIVG-SDNLDQLWPESSWRSLKVRWDESSTIPRPDRVSPWEIEP-ASSPPVNPLPI  373

Query  376  QRNKRARPANLPPSVSEFSAL---GTWKSPIDSPQS  278
             R KR+RP N+PP+  E S     G  K+ +D  Q+
Sbjct  374  SRPKRSRP-NVPPASPESSVRTKEGATKADMDCAQA  408



>gb|KJB41550.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=637

 Score = 72.4 bits (176),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  199  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  256

Query  528  CTDSV  514
             T ++
Sbjct  257  FTGTI  261


 Score = 54.3 bits (129),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  256  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  314

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  315  IMCKRPRPVDIPASEITTSSAGS  337



>gb|KJB41546.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=588

 Score = 72.4 bits (176),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  243  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  300

Query  528  CTDSV  514
             T ++
Sbjct  301  FTGTI  305


 Score = 53.9 bits (128),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  300  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  358

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  359  IMCKRPRPVDIPASEITTSSAGS  381



>gb|EPS63285.1| auxin response factor 2, partial [Genlisea aurea]
Length=503

 Score = 70.9 bits (172),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATA HAI T+T+F+V+Y+PRTS +EFIV  ++Y+E+  +  SVGMR    FEGEE PE+ 
Sbjct  239  ATAWHAIQTKTMFTVYYKPRTSPTEFIVPFDRYMESVKNNYSVGMRFKMKFEGEEAPEQR  298

Query  528  CTDSV  514
             T ++
Sbjct  299  FTGTI  303


 Score = 55.5 bits (132),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG++D+ + RWP SKWR LK              +SPW IE  +T       P 
Sbjct  298  RFTGTIVGLEDSDAKRWPGSKWRCLKVRWDETLSVPRPERVSPWNIEHALTLPTLNPVPV  357

Query  376  QRNKRARPANLPPSVSEFSAL  314
             R KR RP+ L PS SE S L
Sbjct  358  ARTKRPRPSAL-PSFSESSVL  377



>gb|KJB41543.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=691

 Score = 72.0 bits (175),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  253  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 54.3 bits (129),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  310  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  368

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  369  IMCKRPRPVDIPASEITTSSAGS  391



>gb|KJB41551.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=439

 Score = 72.4 bits (176),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  94   ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  151

Query  528  CTDSV  514
             T ++
Sbjct  152  FTGTI  156


 Score = 53.9 bits (128),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  151  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  209

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  210  IMCKRPRPVDIPASEITTSSAGS  232



>gb|KJB41547.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=633

 Score = 72.0 bits (175),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  288  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  345

Query  528  CTDSV  514
             T ++
Sbjct  346  FTGTI  350


 Score = 54.3 bits (129),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  345  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  403

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  404  IMCKRPRPVDIPASEITTSSAGS  426



>ref|XP_006339724.1| PREDICTED: auxin response factor 9-like isoform X2 [Solanum tuberosum]
Length=705

 Score = 71.6 bits (174),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+T F V+Y+PRT  S+FIV +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  258  ATASHAITTQTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERR  315

Query  528  CTDSV  514
             T ++
Sbjct  316  FTGTI  320


 Score = 54.7 bits (130),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 13/77 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTST-PQTLQP  380
            RF+GTIVG  D  SS+W +SKWRSLK              +SPWEIE  V ST     QP
Sbjct  315  RFTGTIVGTGD-ISSQWSESKWRSLKIQWDEPASMVRPDRVSPWEIEPFVASTCVDVAQP  373

Query  379  PQRNKRARPANLPPSVS  329
              ++KR RP +LP +V+
Sbjct  374  GIKSKRPRPLDLPRTVA  390



>gb|KJB41549.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=721

 Score = 72.4 bits (176),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  253  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 53.9 bits (128),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  310  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  368

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  369  IMCKRPRPVDIPASEITTSSAGS  391



>dbj|BAK03995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=826

 Score = 76.3 bits (186),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HAINT+T+F+V+Y+PRTSRSEFI+  +KY E+  +  S+G    MRFEGEE PE+ 
Sbjct  258  ATAWHAINTKTMFTVYYKPRTSRSEFIIPYDKYTESVKNIYSIGTRFKMRFEGEEAPEQR  317

Query  528  CTDSV  514
             T ++
Sbjct  318  FTGTI  322


 Score = 50.1 bits (118),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 50/96 (52%), Gaps = 17/96 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG  DN    WP+S WRSLK              +SPWEIE   +S P    P 
Sbjct  317  RFTGTIVG-SDNLDQLWPESSWRSLKVRWDESSTIPRPDRVSPWEIEP-ASSPPVNPLPL  374

Query  376  QRNKRARPANLPPSVSEFSAL---GTWKSPIDSPQS  278
             R KR+RP N+PP+  E S     G  K+ +D  Q+
Sbjct  375  SRAKRSRP-NVPPASPESSVRTKEGATKADMDCAQA  409



>gb|KJB41548.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=599

 Score = 72.0 bits (175),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  254  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 53.9 bits (128),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  311  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  369

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  370  IMCKRPRPVDIPASEITTSSAGS  392



>gb|KJB41544.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
 gb|KJB41545.1| hypothetical protein B456_007G109500 [Gossypium raimondii]
Length=598

 Score = 72.0 bits (175),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  253  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 53.9 bits (128),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 43/83 (52%), Gaps = 12/83 (14%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S     QP 
Sbjct  310  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVASASTNAQPT  368

Query  376  QRNKRARPANLPPSVSEFSALGT  308
               KR RP ++P S    S+ G+
Sbjct  369  IMCKRPRPVDIPASEITTSSAGS  391



>ref|XP_010267580.1| PREDICTED: auxin response factor 18 [Nelumbo nucifera]
Length=684

 Score = 73.6 bits (179),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY++A N+  SVG    MRFEGE+ PER 
Sbjct  255  ATASHAVATQTLFIVYYKPRT--SQFIISLNKYLDAANNGFSVGMRFKMRFEGEDSPERR  312

Query  528  CTDSV  514
             T ++
Sbjct  313  FTGTI  317


 Score = 52.4 bits (124),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 15/75 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  SS W DSKWRSLK              +SPWEIE  V S P +L  P
Sbjct  312  RFTGTIVGVGD-VSSNWKDSKWRSLKVQWDETASIQRPERVSPWEIEPFVVSVPPSLTQP  370

Query  376  Q--RNKRARPA-NLP  341
               + K+ RP+ +LP
Sbjct  371  AAIKTKKLRPSVDLP  385



>ref|XP_010266558.1| PREDICTED: auxin response factor 9-like [Nelumbo nucifera]
Length=712

 Score = 72.8 bits (177),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY++A N+  SVG    MRFEGE+ PER 
Sbjct  260  ATASHAVATQTLFIVYYKPRT--SQFIISLNKYLDAVNNGFSVGMRFKMRFEGEDSPERR  317

Query  528  CTDSV  514
             T ++
Sbjct  318  FTGTI  322


 Score = 52.8 bits (125),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 41/75 (55%), Gaps = 14/75 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  SS W DSKWRSL+              +SPWEIE  V S P +L  P
Sbjct  317  RFTGTIVGVGD-ISSHWKDSKWRSLEVQWDEPASIHRPERVSPWEIEPFVASVPPSLTQP  375

Query  376  Q--RNKRARPANLPP  338
               +NK+ R    PP
Sbjct  376  MAVKNKKPRTTMDPP  390



>ref|XP_004300502.1| PREDICTED: auxin response factor 9 isoform X1 [Fragaria vesca 
subsp. vesca]
Length=677

 Score = 74.7 bits (182),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FIVS+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  256  ATASHAVATQTLFVVYYKPRT--SQFIVSLNKYLEAVNNKFSVGMRFKMRFEGEDAPER  312


 Score = 50.8 bits (120),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 39/72 (54%), Gaps = 12/72 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+G++D  S +W DSKWRSLK              +SPWEIE  V S P +L   
Sbjct  313  RFSGTIIGLED-ISPQWADSKWRSLKVQWDESASIPRPDRVSPWEIEPYVASIPASLSQS  371

Query  376  QRNKRARPANLP  341
               K  RP  +P
Sbjct  372  TVLKNKRPRLVP  383



>gb|KHG18665.1| Auxin response factor 18 -like protein [Gossypium arboreum]
Length=691

 Score = 69.7 bits (169),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+P TS  +FI+ VNKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  253  ATAAHAVTTHTLFVVYYKPSTS--QFIIGVNKYLEAINNGFSVGMRFKMRFEGEDSPERR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 56.2 bits (134),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 40/74 (54%), Gaps = 12/74 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S    LQP 
Sbjct  310  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPAAIQRPERVSPWEIEPFVDSASANLQPT  368

Query  376  QRNKRARPANLPPS  335
               KR RP ++P S
Sbjct  369  IMCKRPRPVDIPAS  382



>ref|XP_011465372.1| PREDICTED: auxin response factor 9 isoform X2 [Fragaria vesca 
subsp. vesca]
Length=675

 Score = 74.7 bits (182),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FIVS+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  254  ATASHAVATQTLFVVYYKPRT--SQFIVSLNKYLEAVNNKFSVGMRFKMRFEGEDAPER  310


 Score = 50.8 bits (120),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 39/72 (54%), Gaps = 12/72 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+G++D  S +W DSKWRSLK              +SPWEIE  V S P +L   
Sbjct  311  RFSGTIIGLED-ISPQWADSKWRSLKVQWDESASIPRPDRVSPWEIEPYVASIPASLSQS  369

Query  376  QRNKRARPANLP  341
               K  RP  +P
Sbjct  370  TVLKNKRPRLVP  381



>ref|XP_009797447.1| PREDICTED: auxin response factor 9-like [Nicotiana sylvestris]
Length=678

 Score = 74.3 bits (181),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  235  ATASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERR  292

Query  528  CTDSV  514
             T ++
Sbjct  293  FTGTI  297


 Score = 51.2 bits (121),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 40/73 (55%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTP-QTLQP  380
            RF+GTIVGV D  SS+W +SKWRSLK              +SPWEIE  V  T     QP
Sbjct  292  RFTGTIVGVGD-ISSQWSESKWRSLKIQWDEPASIVRPDRVSPWEIEPFVAPTSLDVAQP  350

Query  379  PQRNKRARPANLP  341
              + KR RP  LP
Sbjct  351  GIKIKRPRPLELP  363



>ref|XP_007220626.1| hypothetical protein PRUPE_ppa002230mg [Prunus persica]
 gb|EMJ21825.1| hypothetical protein PRUPE_ppa002230mg [Prunus persica]
Length=698

 Score = 74.7 bits (182),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ TRTLF V+Y+PRT  S+FI+ +NKY+EA N+  SVG    MRFEGEE PER 
Sbjct  251  ATASHALMTRTLFVVYYKPRT--SQFIIGLNKYLEAINNKFSVGMRFKMRFEGEESPERR  308

Query  528  CTDSV  514
             T ++
Sbjct  309  FTGTI  313


 Score = 50.8 bits (120),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 42/75 (56%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTP-QTLQP  380
            RF+GTIVGV D  SS+W +SKWRSLK              +S WEIE  V S P   +QP
Sbjct  308  RFTGTIVGVGD-LSSQWSESKWRSLKIQWDEHAAVQRPERVSFWEIEPFVASAPIHLVQP  366

Query  379  PQRNKRARPANLPPS  335
              ++KR RP  +  S
Sbjct  367  VVKSKRPRPVEISSS  381



>ref|XP_009375411.1| PREDICTED: auxin response factor 18 isoform X2 [Pyrus x bretschneideri]
 ref|XP_009336758.1| PREDICTED: auxin response factor 18 isoform X2 [Pyrus x bretschneideri]
Length=694

 Score = 69.7 bits (169),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+TLF V+ +PRT  S+FIV +NKY+EA N+  S+G    MRFEGEE PER 
Sbjct  251  ATASHALMTKTLFVVYSKPRT--SQFIVCLNKYLEAINNKFSLGMRFRMRFEGEESPERR  308

Query  528  CTDSV  514
             T ++
Sbjct  309  FTGTI  313


 Score = 55.8 bits (133),  Expect(2) = 4e-20, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 47/81 (58%), Gaps = 13/81 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIV V D  SS+W +SKWRSLK              +SPW+IE  V S P  L QP
Sbjct  308  RFTGTIVEVGD-LSSQWSESKWRSLKVQWDEHAAVQRPERVSPWDIELFVASAPLNLAQP  366

Query  379  PQRNKRARPANLPPSVSEFSA  317
              ++KR+RP  +  SV+  SA
Sbjct  367  VVKSKRSRPVEIASSVTTNSA  387



>gb|EMS58454.1| Auxin response factor 4 [Triticum urartu]
Length=766

 Score = 77.0 bits (188),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HAINT+T+F+V+Y+PRTSRSEFI+  +KY+E+  +  S+G    MRFEGEE PE+ 
Sbjct  197  ATAWHAINTKTMFTVYYKPRTSRSEFIIPYDKYMESVKNIYSIGTRFKMRFEGEEAPEQR  256

Query  528  CTDSV  514
             T ++
Sbjct  257  FTGTI  261


 Score = 47.8 bits (112),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 50/96 (52%), Gaps = 17/96 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG  DN    WP+S WRSLK              +SPWEIE   +S P    P 
Sbjct  256  RFTGTIVG-SDNLDQLWPESSWRSLKVRWDESSTIPRPDRVSPWEIEP-ASSPPVNPLPL  313

Query  376  QRNKRARPANLPPSVSEFSAL---GTWKSPIDSPQS  278
             R KR+RP N+PP+  E S     G  ++ +D  Q+
Sbjct  314  SRPKRSRP-NVPPASPESSVRTKEGATRADMDCAQA  348



>ref|XP_010327130.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
 ref|XP_010327133.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
 ref|XP_010327135.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
 ref|XP_010327139.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
Length=685

 Score = 71.6 bits (174),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+T F V+Y+PRT  S+FIV +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  235  ATASHAITTQTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERR  292

Query  528  CTDSV  514
             T ++
Sbjct  293  FTGTI  297


 Score = 53.1 bits (126),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 36/75 (48%), Positives = 43/75 (57%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTST-PQTLQP  380
            RF+GTIVG  D  SS+W +SKWRSLK              +SPWEIE  V ST     QP
Sbjct  292  RFTGTIVGTGD-ISSQWSESKWRSLKIQWDEPASMVRPDRVSPWEIEPFVASTCVDVAQP  350

Query  379  PQRNKRARPANLPPS  335
              ++KR RP +LP S
Sbjct  351  GIKSKRPRPLDLPRS  365



>ref|XP_006339723.1| PREDICTED: auxin response factor 9-like isoform X1 [Solanum tuberosum]
Length=708

 Score = 71.6 bits (174),  Expect(2) = 7e-20, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+T F V+Y+PRT  S+FIV +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  258  ATASHAITTQTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERR  315

Query  528  CTDSV  514
             T ++
Sbjct  316  FTGTI  320


 Score = 52.8 bits (125),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 42/73 (58%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTST-PQTLQP  380
            RF+GTIVG  D  SS+W +SKWRSLK              +SPWEIE  V ST     QP
Sbjct  315  RFTGTIVGTGD-ISSQWSESKWRSLKIQWDEPASMVRPDRVSPWEIEPFVASTCVDVAQP  373

Query  379  PQRNKRARPANLP  341
              ++KR RP +LP
Sbjct  374  GIKSKRPRPLDLP  386



>ref|XP_006339725.1| PREDICTED: auxin response factor 9-like isoform X3 [Solanum tuberosum]
Length=695

 Score = 71.6 bits (174),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+T F V+Y+PRT  S+FIV +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  245  ATASHAITTQTRFVVYYKPRT--SQFIVGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERR  302

Query  528  CTDSV  514
             T ++
Sbjct  303  FTGTI  307


 Score = 52.8 bits (125),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 42/73 (58%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTST-PQTLQP  380
            RF+GTIVG  D  SS+W +SKWRSLK              +SPWEIE  V ST     QP
Sbjct  302  RFTGTIVGTGD-ISSQWSESKWRSLKIQWDEPASMVRPDRVSPWEIEPFVASTCVDVAQP  360

Query  379  PQRNKRARPANLP  341
              ++KR RP +LP
Sbjct  361  GIKSKRPRPLDLP  373



>ref|XP_006439306.1| hypothetical protein CICLE_v10019131mg [Citrus clementina]
 gb|ESR52546.1| hypothetical protein CICLE_v10019131mg [Citrus clementina]
Length=690

 Score = 70.1 bits (170),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ P+R 
Sbjct  247  ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPDRR  304

Query  528  CTDSV  514
             + +V
Sbjct  305  FSGTV  309


 Score = 54.3 bits (129),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 15/76 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  304  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  362

Query  379  P-QRNKRAR-PANLPP  338
               +NKR R P  +PP
Sbjct  363  VLAKNKRPRLPMEVPP  378



>ref|XP_006439307.1| hypothetical protein CICLE_v10019131mg [Citrus clementina]
 gb|ESR52547.1| hypothetical protein CICLE_v10019131mg [Citrus clementina]
Length=643

 Score = 70.1 bits (170),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ P+R 
Sbjct  200  ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPDRR  257

Query  528  CTDSV  514
             + +V
Sbjct  258  FSGTV  262


 Score = 54.3 bits (129),  Expect(2) = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 45/76 (59%), Gaps = 15/76 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  257  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  315

Query  379  P-QRNKRAR-PANLPP  338
               +NKR R P  +PP
Sbjct  316  VLAKNKRPRLPMEVPP  331



>gb|KDO76598.1| hypothetical protein CISIN_1g005491mg [Citrus sinensis]
Length=537

 Score = 71.6 bits (174),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  94   ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPERR  151

Query  528  CTDSV  514
             + +V
Sbjct  152  FSGTV  156


 Score = 52.8 bits (125),  Expect(2) = 8e-20, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  151  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  209

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  210  VLAKNKRPRLSMEVPPLDLPSAAS  233



>gb|AFD01308.1| auxin response factor 9 [Brassica rapa subsp. pekinensis]
Length=629

 Score = 69.7 bits (169),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA HA  TR++F+V+Y+PRT  S+FI+S+NKY+EA ++  SVG    MRFEGE+ PER
Sbjct  239  ATACHATQTRSMFTVYYKPRT--SQFIISLNKYLEAMSNKFSVGIRFKMRFEGEDSPER  295


 Score = 54.3 bits (129),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 54/109 (50%), Gaps = 28/109 (26%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTS--TPQTLQ  383
            RFSGT+VGV+D  S+ W DS WR L+              +SPWEIE  VTS   P ++ 
Sbjct  296  RFSGTVVGVKD-CSTHWKDSNWRCLEVHWDEPASISRPDKVSPWEIEPFVTSENVPHSVM  354

Query  382  PPQRNKRARPANLPPSVSEFSALGT-----WKSPIDSPQSFSY-CDTSR  254
            P  +NKR      P   SE SALG      W S +     F+  C TS+
Sbjct  355  P--KNKR------PRHYSEVSALGKTASNLWSSALTQSHEFAQSCITSQ  395



>emb|CBA11996.1| putative auxin response factor 2 [Cabomba aquatica]
Length=782

 Score = 69.7 bits (169),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T T+F+V+Y+PRTS SEFIV   +Y+E+     S+G    MRFEGEE PE+ 
Sbjct  285  ATASHAIQTGTMFTVYYKPRTSPSEFIVPFAQYVESIKKNYSIGMRFKMRFEGEEAPEQR  344

Query  528  CTDSV  514
             T ++
Sbjct  345  FTGTI  349


 Score = 54.7 bits (130),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 44/81 (54%), Gaps = 12/81 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTI+G+ D  S+RWP+SKWR LK              +SPW+IE  +        P 
Sbjct  344  RFTGTIIGIGDVDSTRWPESKWRCLKVRWDEQTSVPRPDKISPWQIEPALAPIALNPLPV  403

Query  376  QRNKRARPANLPPSVSEFSAL  314
             R KR RP N+ P+  + SAL
Sbjct  404  SRTKRPRP-NILPTSPDVSAL  423



>gb|KDO76597.1| hypothetical protein CISIN_1g005491mg [Citrus sinensis]
Length=609

 Score = 71.2 bits (173),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  166  ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPERR  223

Query  528  CTDSV  514
             + +V
Sbjct  224  FSGTV  228


 Score = 52.8 bits (125),  Expect(2) = 9e-20, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  223  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  281

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  282  VLAKNKRPRLSMEVPPLDLPSAAS  305



>emb|CBA11993.1| putative auxin response factor 2 [Amborella trichopoda]
Length=737

 Score = 70.1 bits (170),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HA +T T+FSVFYRPRTS SEF++  ++Y+E+  +  S+G    MRFEGEE PE+ 
Sbjct  272  ATAMHAFSTGTMFSVFYRPRTSPSEFVIPYDQYMESVKNNYSIGMRFRMRFEGEETPEQR  331

Query  528  CTDSV  514
             T ++
Sbjct  332  FTGTI  336


 Score = 53.9 bits (128),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 44/81 (54%), Gaps = 13/81 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D  S+RWP SKWR LK              +SPW+IE   ++ P  + PP
Sbjct  331  RFTGTIVGVEDYDSNRWPASKWRCLKVQWDEQSSVERPLRVSPWKIEP--SAAPTAINPP  388

Query  376  QRNKRARPANLPPSVSEFSAL  314
               +  RP    PS S+ S L
Sbjct  389  PIPRAKRPRTNVPSPSDVSHL  409



>ref|XP_009590537.1| PREDICTED: auxin response factor 9 isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009590539.1| PREDICTED: auxin response factor 9 isoform X2 [Nicotiana tomentosiformis]
Length=671

 Score = 74.3 bits (181),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  235  ATASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERR  292

Query  528  CTDSV  514
             T ++
Sbjct  293  FTGTI  297


 Score = 49.7 bits (117),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 40/73 (55%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTP-QTLQP  380
            RF+GTIVGV D  SS+W +SKWRSLK              +SPWEIE  V  T     QP
Sbjct  292  RFTGTIVGVGD-ISSQWSESKWRSLKIQWDEPASIVRPDRVSPWEIEPSVAPTSIDVAQP  350

Query  379  PQRNKRARPANLP  341
              + KR RP  LP
Sbjct  351  GIKIKRPRPLELP  363



>gb|KDO76596.1| hypothetical protein CISIN_1g005491mg [Citrus sinensis]
Length=643

 Score = 71.2 bits (173),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  200  ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPERR  257

Query  528  CTDSV  514
             + +V
Sbjct  258  FSGTV  262


 Score = 52.8 bits (125),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  257  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  315

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  316  VLAKNKRPRLSMEVPPLDLPSAAS  339



>gb|KDO76595.1| hypothetical protein CISIN_1g005491mg [Citrus sinensis]
Length=690

 Score = 71.2 bits (173),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  247  ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPERR  304

Query  528  CTDSV  514
             + +V
Sbjct  305  FSGTV  309


 Score = 52.8 bits (125),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  304  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  362

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  363  VLAKNKRPRLSMEVPPLDLPSAAS  386



>ref|XP_002518850.1| hypothetical protein RCOM_1311830 [Ricinus communis]
 gb|EEF43383.1| hypothetical protein RCOM_1311830 [Ricinus communis]
Length=694

 Score = 73.2 bits (178),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  252  ATASHAVATQTLFVVYYKPRT--SQFIISLNKYLEAINNKFSVGMRFKMRFEGEDSPER  308


 Score = 50.8 bits (120),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 39/70 (56%), Gaps = 14/70 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  S  W DSKWR LK              +SPWEIE    S P  + QP
Sbjct  309  RFSGTIVGVED-FSPHWLDSKWRQLKVQWDEPASIPRPDKVSPWEIEPFSASAPSNISQP  367

Query  379  -PQRNKRARP  353
             P +NKR RP
Sbjct  368  VPLKNKRPRP  377



>ref|XP_009590536.1| PREDICTED: auxin response factor 11 isoform X1 [Nicotiana tomentosiformis]
Length=690

 Score = 74.3 bits (181),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  254  ATASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAVSHGFSVGMRFRMRFEGEDSPERR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 49.3 bits (116),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 40/73 (55%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTP-QTLQP  380
            RF+GTIVGV D  SS+W +SKWRSLK              +SPWEIE  V  T     QP
Sbjct  311  RFTGTIVGVGD-ISSQWSESKWRSLKIQWDEPASIVRPDRVSPWEIEPSVAPTSIDVAQP  369

Query  379  PQRNKRARPANLP  341
              + KR RP  LP
Sbjct  370  GIKIKRPRPLELP  382



>ref|XP_006368789.1| hypothetical protein POPTR_0001s10900g [Populus trichocarpa]
 gb|ERP65358.1| hypothetical protein POPTR_0001s10900g [Populus trichocarpa]
Length=610

 Score = 67.0 bits (162),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T TLF V+Y+PRT  S+FI+S+NKY+EA ++   VG    MRFEGE+ P+R
Sbjct  259  ATASHAVSTLTLFVVYYKPRT--SQFIISLNKYLEAVSNKFVVGMRFKMRFEGEDSPDR  315


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 40/70 (57%), Gaps = 14/70 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE  V S P  L  P
Sbjct  316  RFSGTIVGVED-FSPHWNDSKWRSLKVQWDEPAPIPRPDRVSPWEIEPCVASVPTNLSQP  374

Query  376  --QRNKRARP  353
              Q+NKR RP
Sbjct  375  VTQKNKRPRP  384



>ref|XP_010659520.1| PREDICTED: auxin response factor 9 [Vitis vinifera]
Length=684

 Score = 68.2 bits (165),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+ +NKY+EA ++  +VG    MRFEGE+ PER
Sbjct  243  ATASHAVATQTLFIVYYKPRT--SQFIIGLNKYLEAVSNGFAVGMRFKMRFEGEDSPER  299


 Score = 55.8 bits (133),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 53/112 (47%), Gaps = 19/112 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG +D  S  W DS+WRSLK              +SPWEIE  V+S PQ L PP
Sbjct  300  RFSGTIVGGED-FSPEWKDSEWRSLKVQWDEPASIPRPEKVSPWEIEHYVSSVPQGLAPP  358

Query  376  Q--RNKRARPANLP-PSVSEFSALGTWKSPI----DSPQSFSYCDTSRGTDH  242
               +NKR R    P P     +A   W   +    D  Q  S  +  R  +H
Sbjct  359  GVLKNKRPRSNESPVPETGSAAASAVWHLGLTQSHDLTQMSSTAEGKRSENH  410



>ref|XP_006476351.1| PREDICTED: auxin response factor 9-like isoform X2 [Citrus sinensis]
Length=690

 Score = 71.2 bits (173),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  247  ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPER  303


 Score = 52.8 bits (125),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  304  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  362

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  363  VLAKNKRPRLSMEVPPLDLPSAAS  386



>emb|CBI34510.3| unnamed protein product [Vitis vinifera]
Length=682

 Score = 68.2 bits (165),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T+TLF V+Y+PRT  S+FI+ +NKY+EA ++  +VG    MRFEGE+ PER
Sbjct  241  ATASHAVATQTLFIVYYKPRT--SQFIIGLNKYLEAVSNGFAVGMRFKMRFEGEDSPER  297


 Score = 55.8 bits (133),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 53/112 (47%), Gaps = 19/112 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVG +D  S  W DS+WRSLK              +SPWEIE  V+S PQ L PP
Sbjct  298  RFSGTIVGGED-FSPEWKDSEWRSLKVQWDEPASIPRPEKVSPWEIEHYVSSVPQGLAPP  356

Query  376  Q--RNKRARPANLP-PSVSEFSALGTWKSPI----DSPQSFSYCDTSRGTDH  242
               +NKR R    P P     +A   W   +    D  Q  S  +  R  +H
Sbjct  357  GVLKNKRPRSNESPVPETGSAAASAVWHLGLTQSHDLTQMSSTAEGKRSENH  408



>gb|KDO76593.1| hypothetical protein CISIN_1g005491mg [Citrus sinensis]
Length=684

 Score = 71.2 bits (173),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T+F V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  247  ATASHAVATQTMFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPERR  304

Query  528  CTDSV  514
             + +V
Sbjct  305  FSGTV  309


 Score = 52.4 bits (124),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  304  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  362

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  363  VLAKNKRPRLSMEVPPLDLPSAAS  386



>ref|XP_010661956.1| PREDICTED: auxin response factor 18 [Vitis vinifera]
Length=701

 Score = 73.9 bits (180),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  249  ATASHAVTTQTLFVVYYKPRT--SQFIISLNKYLEAVNYGFAVGMRFKMRFEGEDSPERR  306

Query  528  CTDSV  514
             T ++
Sbjct  307  FTGTI  311


 Score = 50.1 bits (118),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVG+ D  S +W +SKWRSLK              +S W+IE  V S    L QP
Sbjct  306  RFTGTIVGIGD-ISPQWSNSKWRSLKIQWDEPATIQRPERVSSWDIEPFVASASLNLTQP  364

Query  379  PQRNKRARPANLP  341
            P + KR RP +LP
Sbjct  365  PVKIKRPRPLDLP  377



>ref|XP_011022476.1| PREDICTED: auxin response factor 9-like [Populus euphratica]
Length=699

 Score = 70.9 bits (172),  Expect(2) = 1e-19, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI+T TLF V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  256  ATASHAISTLTLFVVYYKPRT--SQFIISLNKYLEAVNNKFAVGMRFKMRFEGEDSPERR  313

Query  528  CTDSV  514
             + ++
Sbjct  314  FSGTI  318


 Score = 53.1 bits (126),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 54/103 (52%), Gaps = 18/103 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE  V   P  L QP
Sbjct  313  RFSGTIVGVED-FSPYWNDSKWRSLKVQWDEPASISRPDRVSPWEIEPCVAQVPANLPQP  371

Query  379  PQ-RNKRARPANLPPSVSEFSALGTWKSPIDSPQSFSYCDTSR  254
             Q +NKR RP   P  +  F    T  +P +S  + S CD ++
Sbjct  372  VQPKNKRPRP---PIEIPAFDLSSTASTPWNSGLAQS-CDLTQ  410



>emb|CBI40565.3| unnamed protein product [Vitis vinifera]
Length=607

 Score = 73.9 bits (180),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+TLF V+Y+PRT  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PER 
Sbjct  249  ATASHAVTTQTLFVVYYKPRT--SQFIISLNKYLEAVNYGFAVGMRFKMRFEGEDSPERR  306

Query  528  CTDSV  514
             T ++
Sbjct  307  FTGTI  311


 Score = 49.7 bits (117),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVG+ D  S +W +SKWRSLK              +S W+IE  V S    L QP
Sbjct  306  RFTGTIVGIGD-ISPQWSNSKWRSLKIQWDEPATIQRPERVSSWDIEPFVASASLNLTQP  364

Query  379  PQRNKRARPANLP  341
            P + KR RP +LP
Sbjct  365  PVKIKRPRPLDLP  377



>ref|XP_002299455.2| hypothetical protein POPTR_0001s10900g [Populus trichocarpa]
 gb|EEE84260.2| hypothetical protein POPTR_0001s10900g [Populus trichocarpa]
Length=595

 Score = 67.0 bits (162),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T TLF V+Y+PRT  S+FI+S+NKY+EA ++   VG    MRFEGE+ P+R
Sbjct  259  ATASHAVSTLTLFVVYYKPRT--SQFIISLNKYLEAVSNKFVVGMRFKMRFEGEDSPDR  315


 Score = 56.6 bits (135),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 40/70 (57%), Gaps = 14/70 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE  V S P  L  P
Sbjct  316  RFSGTIVGVED-FSPHWNDSKWRSLKVQWDEPAPIPRPDRVSPWEIEPCVASVPTNLSQP  374

Query  376  --QRNKRARP  353
              Q+NKR RP
Sbjct  375  VTQKNKRPRP  384



>ref|XP_011093958.1| PREDICTED: auxin response factor 18-like [Sesamum indicum]
Length=696

 Score = 75.5 bits (184),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHAI T+TLF V+Y+PRT  S+FI+ +NKY+EA  H  SVG    MRFEGE+ PER 
Sbjct  251  ATASHAITTQTLFVVYYKPRT--SQFIIGLNKYLEAMQHGFSVGMRFKMRFEGEDSPERR  308

Query  528  CTDSV  514
             T ++
Sbjct  309  FTGTI  313


 Score = 48.1 bits (113),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 13/73 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  SS+W +S WRSLK              +SPW+IE  V S    + QP
Sbjct  308  RFTGTIVGVGD-FSSQWTNSTWRSLKVQWDEPASILRPERVSPWDIEPFVASASVDVPQP  366

Query  379  PQRNKRARPANLP  341
              + KR RP +LP
Sbjct  367  AIKIKRPRPLDLP  379



>gb|KJB18969.1| hypothetical protein B456_003G078000 [Gossypium raimondii]
Length=689

 Score = 71.2 bits (173),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  253  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPER  309


 Score = 52.0 bits (123),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 42/78 (54%), Gaps = 14/78 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE      P TL  P
Sbjct  310  RFSGTIVGVED-FSPYWKDSKWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  368

Query  376  --QRNKRARPANLPPSVS  329
               +NKR RP    P+++
Sbjct  369  VAAKNKRPRPTAEIPALA  386



>gb|KJB18966.1| hypothetical protein B456_003G078000 [Gossypium raimondii]
Length=691

 Score = 71.2 bits (173),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  255  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPER  311


 Score = 52.0 bits (123),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 42/78 (54%), Gaps = 14/78 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE      P TL  P
Sbjct  312  RFSGTIVGVED-FSPYWKDSKWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  370

Query  376  --QRNKRARPANLPPSVS  329
               +NKR RP    P+++
Sbjct  371  VAAKNKRPRPTAEIPALA  388



>ref|XP_011026848.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 9-like 
[Populus euphratica]
Length=705

 Score = 66.2 bits (160),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA++T TLF V+Y+PRT  S+FI+S+NKY+EA ++   VG    MRFEGE+ P+R 
Sbjct  263  ATASHAVSTLTLFVVYYKPRT--SQFIISLNKYLEAVSNKFVVGMRFKMRFEGEDSPDRR  320

Query  528  CTDSV  514
             + ++
Sbjct  321  FSGTI  325


 Score = 57.0 bits (136),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 40/70 (57%), Gaps = 14/70 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE  V S P  L  P
Sbjct  320  RFSGTIVGVED-FSPHWNDSKWRSLKVQWDEPAPIPRPDRVSPWEIEPCVASVPTNLSQP  378

Query  376  --QRNKRARP  353
              Q+NKR RP
Sbjct  379  VTQKNKRPRP  388



>gb|KJB18967.1| hypothetical protein B456_003G078000 [Gossypium raimondii]
Length=696

 Score = 71.6 bits (174),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  255  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPER  311


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE      P TL  P
Sbjct  312  RFSGTIVGVED-FSPYWKDSKWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  370

Query  376  --QRNKRARPANLPPSV  332
               +NKR RP    P++
Sbjct  371  VAAKNKRPRPTAEIPAL  387



>ref|XP_006855394.1| hypothetical protein AMTR_s00057p00141830 [Amborella trichopoda]
 gb|ERN16861.1| hypothetical protein AMTR_s00057p00141830 [Amborella trichopoda]
Length=734

 Score = 68.9 bits (167),  Expect(2) = 2e-19, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HA +T T+FSV+YRPRTS SEF++  ++Y+E+  +  S+G    MRFEGEE PE+ 
Sbjct  272  ATAMHAFSTGTMFSVYYRPRTSPSEFVIPYDQYMESVKNNYSIGMRFRMRFEGEETPEQR  331

Query  528  CTDSV  514
             T ++
Sbjct  332  FTGTI  336


 Score = 53.9 bits (128),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 44/81 (54%), Gaps = 13/81 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D  S+RWP SKWR LK              +SPW+IE   ++ P  + PP
Sbjct  331  RFTGTIVGVEDYDSNRWPASKWRCLKVQWDEQSSVERPLRVSPWKIEP--SAAPTAINPP  388

Query  376  QRNKRARPANLPPSVSEFSAL  314
               +  RP    PS S+ S L
Sbjct  389  PIPRAKRPRTNVPSPSDVSHL  409



>ref|XP_009137577.1| PREDICTED: auxin response factor 9 [Brassica rapa]
Length=610

 Score = 71.2 bits (173),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HA  TR++F+V+Y+PRTS  +FI+SVNKY+EA N   SVG    MRFEG++ PER 
Sbjct  236  ATACHATQTRSMFTVYYKPRTS--QFIISVNKYLEAMNSKFSVGMRFKMRFEGDDSPERR  293

Query  528  CTDSV  514
             + +V
Sbjct  294  FSGTV  298


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 53/111 (48%), Gaps = 33/111 (30%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSL-------KGFT----LSPWEIEALVTS--TPQTLQ  383
            RFSGT+VGVQD  S  W DSKWRSL         FT    +SPWE+E    S   PQ++ 
Sbjct  293  RFSGTVVGVQD-CSPHWKDSKWRSLIVNWDEPASFTRPDKVSPWEMEPFAASENVPQSV-  350

Query  382  PPQRNKRARPANLPPSVSEFSALGT-------WKSPIDSPQSFSY-CDTSR  254
                NKRAR  N      E SAL         W S +     F+  C TS+
Sbjct  351  ----NKRARHVN------EISALDVGVPSSNFWSSALTQSHEFAQSCITSQ  391



>ref|XP_006413489.1| hypothetical protein EUTSA_v10024554mg [Eutrema salsugineum]
 gb|ESQ54942.1| hypothetical protein EUTSA_v10024554mg [Eutrema salsugineum]
Length=707

 Score = 73.2 bits (178),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HA  TRT+F+V+Y+PRT  S+FI+S+NKY+EA  +  SVG    MRFEGE+ PERS
Sbjct  315  ATACHATQTRTMFTVYYKPRT--SQFIISLNKYLEAMTNKFSVGMRFKMRFEGEDSPERS  372

Query  528  CTDSV  514
             + +V
Sbjct  373  FSGTV  377


 Score = 49.7 bits (117),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 53/108 (49%), Gaps = 28/108 (26%)
 Frame = -1

Query  520  FSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTS--TPQTLQP  380
            FSGT+VG +D  S  W DSKWR L+              +SPWEIE  VTS   PQ++  
Sbjct  373  FSGTVVGGKD-CSPHWKDSKWRCLEVHWDEPASISRPDKVSPWEIEPFVTSENVPQSV--  429

Query  379  PQRNKRARPANLPPSVSEFSALGT-----WKSPIDSPQSFSY-CDTSR  254
              +NKR      P  VSE SALG      W S +     F+  C TS+
Sbjct  430  VLKNKR------PRQVSEVSALGITASNLWSSALTQSHEFAQSCITSQ  471



>gb|KJB18968.1| hypothetical protein B456_003G078000 [Gossypium raimondii]
Length=694

 Score = 71.2 bits (173),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  253  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPER  309


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE      P TL  P
Sbjct  310  RFSGTIVGVED-FSPYWKDSKWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  368

Query  376  --QRNKRARPANLPPSV  332
               +NKR RP    P++
Sbjct  369  VAAKNKRPRPTAEIPAL  385



>gb|KJB18971.1| hypothetical protein B456_003G078000 [Gossypium raimondii]
Length=623

 Score = 71.2 bits (173),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  228  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPER  284


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE      P TL  P
Sbjct  285  RFSGTIVGVED-FSPYWKDSKWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  343

Query  376  --QRNKRARPANLPPSV  332
               +NKR RP    P++
Sbjct  344  VAAKNKRPRPTAEIPAL  360



>gb|KJB18970.1| hypothetical protein B456_003G078000 [Gossypium raimondii]
Length=669

 Score = 71.2 bits (173),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +NKY+EA N+  +VG    MRFEGE+ PER
Sbjct  228  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALNNKFTVGMRFKMRFEGEDSPER  284


 Score = 51.6 bits (122),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE      P TL  P
Sbjct  285  RFSGTIVGVED-FSPYWKDSKWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  343

Query  376  --QRNKRARPANLPPSV  332
               +NKR RP    P++
Sbjct  344  VAAKNKRPRPTAEIPAL  360



>gb|AFD01307.1| auxin response factor 9-1 [Brassica rapa subsp. pekinensis]
Length=602

 Score = 67.4 bits (163),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HA  TR++F+V+Y+PRT  S+FI+S++KY+EA N   SVG    MRFEG++ PER 
Sbjct  230  ATACHATQTRSMFTVYYKPRT--SQFILSLHKYLEAMNSKFSVGMRFKMRFEGDDSPERR  287

Query  528  CTDSV  514
             + +V
Sbjct  288  FSGTV  292


 Score = 55.1 bits (131),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 54/109 (50%), Gaps = 31/109 (28%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSL-------KGFT----LSPWEIEALVTS--TPQTLQ  383
            RFSGT+VGVQD  S  W DSKWRSL         FT    +SPWE+E    S   PQ++ 
Sbjct  287  RFSGTVVGVQD-CSPHWKDSKWRSLIVNWDEPASFTRPDKVSPWEMEPFAASENVPQSV-  344

Query  382  PPQRNKRARPANLPPSVSEFSALGT-----WKSPIDSPQSFSY-CDTSR  254
                NKRAR  N      E SALG      W S +     F+  C TS+
Sbjct  345  ----NKRARHVN------EISALGVPSSNFWSSALTQSHEFAQSCITSQ  383



>gb|KDO76594.1| hypothetical protein CISIN_1g005491mg [Citrus sinensis]
Length=694

 Score = 70.1 bits (170),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 6/67 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPR--TSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPE  535
            ATASHA+ T+T+F V+Y+PR  T  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PE
Sbjct  247  ATASHAVATQTMFVVYYKPRIITRTSQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPE  306

Query  534  RSCTDSV  514
            R  + +V
Sbjct  307  RRFSGTV  313


 Score = 52.8 bits (125),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  308  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  366

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  367  VLAKNKRPRLSMEVPPLDLPSAAS  390



>ref|XP_002876640.1| hypothetical protein ARALYDRAFT_349241 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52899.1| hypothetical protein ARALYDRAFT_349241 [Arabidopsis lyrata subsp. 
lyrata]
Length=608

 Score = 72.8 bits (177),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/64 (61%), Positives = 45/64 (70%), Gaps = 6/64 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T T+F VFY+PR   S+FIV VNKY+EA  H  S+G    MRFEGEE PER 
Sbjct  252  ATASHAVRTTTIFVVFYKPRI--SQFIVGVNKYMEAIKHGFSLGTRFRMRFEGEESPERI  309

Query  528  CTDS  517
              DS
Sbjct  310  VLDS  313


 Score = 49.7 bits (117),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 17/80 (21%)
 Frame = -1

Query  529  LYRFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL-  386
            ++RF+GTIVG  D  SS+WP SKWRSL+              +SPWEIE  + ++P +  
Sbjct  318  VFRFTGTIVGTGD-LSSQWPASKWRSLQVQWDEPTTVQRPDKVSPWEIEPFLATSPISTP  376

Query  385  --QPPQRNKRARPANLPPSV  332
              QP  + KR+RP    PSV
Sbjct  377  AQQPQLKCKRSRPTE--PSV  394



>ref|XP_006598900.1| PREDICTED: auxin response factor 7-like isoform X1 [Glycine max]
 gb|KHN15923.1| Auxin response factor 7 [Glycine soja]
Length=716

 Score = 70.5 bits (171),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ TRT+F V+Y+PRT  S+FIV +NKY+EA N+  S+G    MRFEG++ PER
Sbjct  258  ATASHAVMTRTMFLVYYKPRT--SQFIVGLNKYLEAVNNKFSLGMRFKMRFEGDDSPER  314


 Score = 52.0 bits (123),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 23/104 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV D  S+ W +S+WRSLK              +S WEIE  V ST   + QP
Sbjct  315  RFSGTIVGVGD-VSAGWSNSQWRSLKVQWDEPATIPRPDRVSCWEIEPFVASTALNVTQP  373

Query  379  PQRNKRARPANLPPSVS----------EFSALGTWKSPIDSPQS  278
              + KR+RPA++  S +          E S LG   + + S ++
Sbjct  374  AVKGKRSRPADVSSSAASGFWYHGSSNELSQLGAATAEVQSKEN  417



>ref|XP_006476352.1| PREDICTED: auxin response factor 9-like isoform X3 [Citrus sinensis]
Length=688

 Score = 69.7 bits (169),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 6/67 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPR--TSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPE  535
            ATASHA+ T+T+F V+Y+PR  T  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PE
Sbjct  247  ATASHAVATQTMFVVYYKPRIITRTSQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPE  306

Query  534  RSCTDSV  514
            R  + +V
Sbjct  307  RRFSGTV  313


 Score = 52.8 bits (125),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  308  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  366

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  367  VLAKNKRPRLSMEVPPLDLPSAAS  390



>ref|XP_006598901.1| PREDICTED: auxin response factor 7-like isoform X2 [Glycine max]
Length=713

 Score = 70.5 bits (171),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ TRT+F V+Y+PRT  S+FIV +NKY+EA N+  S+G    MRFEG++ PER
Sbjct  258  ATASHAVMTRTMFLVYYKPRT--SQFIVGLNKYLEAVNNKFSLGMRFKMRFEGDDSPER  314


 Score = 52.0 bits (123),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 53/101 (52%), Gaps = 20/101 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV D  S+ W +S+WRSLK              +S WEIE  V ST   + QP
Sbjct  315  RFSGTIVGVGD-VSAGWSNSQWRSLKVQWDEPATIPRPDRVSCWEIEPFVASTALNVTQP  373

Query  379  PQRNKRARPANLPP-------SVSEFSALGTWKSPIDSPQS  278
              + KR+RPA++         S +E S LG   + + S ++
Sbjct  374  AVKGKRSRPADVSSSGFWYHGSSNELSQLGAATAEVQSKEN  414



>ref|XP_006476350.1| PREDICTED: auxin response factor 9-like isoform X1 [Citrus sinensis]
Length=694

 Score = 69.7 bits (169),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/67 (54%), Positives = 50/67 (75%), Gaps = 6/67 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPR--TSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPE  535
            ATASHA+ T+T+F V+Y+PR  T  S+FI+S+NKY+EA N+  +VG    MRFEGE+ PE
Sbjct  247  ATASHAVATQTMFVVYYKPRIITRTSQFIISLNKYLEAVNNKFAVGMRYKMRFEGEDSPE  306

Query  534  RSCTDSV  514
            R  + +V
Sbjct  307  RRFSGTV  313


 Score = 52.8 bits (125),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 47/84 (56%), Gaps = 20/84 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-------GFT----LSPWEIEALVTS-TPQTLQP  380
            RFSGT+VGV+D  S  W DSKWRSLK         T    +SPWEIE  V S TP  +QP
Sbjct  308  RFSGTVVGVED-FSPHWKDSKWRSLKVQWDEPASITRPDRVSPWEIEPFVASATPNLVQP  366

Query  379  P-QRNKRAR------PANLPPSVS  329
               +NKR R      P +LP + S
Sbjct  367  VLAKNKRPRLSMEVPPLDLPSAAS  390



>ref|XP_011082305.1| PREDICTED: auxin response factor 9 [Sesamum indicum]
Length=698

 Score = 69.3 bits (168),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 33/59 (56%), Positives = 44/59 (75%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ T T+F V+Y+PRT  S+FI+ +NKY+EA +H   +G    MRFEGE+ PER
Sbjct  256  ATASHAVITNTMFVVYYKPRT--SQFIIGLNKYLEAMDHEFGIGMRFKMRFEGEDSPER  312


 Score = 53.1 bits (126),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 37/69 (54%), Gaps = 13/69 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  S  W +SKWRSLK              +SPWEIE  V S P  L QP
Sbjct  313  RFSGTIVGVED-ISPHWKESKWRSLKVQWDEPASIPRPERVSPWEIEPFVASVPTALVQP  371

Query  379  PQRNKRARP  353
            P      RP
Sbjct  372  PTIKHHKRP  380



>ref|NP_001031706.1| auxin response factor 9 [Arabidopsis thaliana]
 gb|AEE84836.1| auxin response factor 9 [Arabidopsis thaliana]
Length=636

 Score = 68.9 bits (167),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HA  T+T+F V+Y+PRTS  +FI+S+NKY+EA ++  SVG    MRFEGE+ PER 
Sbjct  240  ATARHATQTKTMFIVYYKPRTS--QFIISLNKYLEAMSNKFSVGMRFKMRFEGEDSPERR  297

Query  528  CTDSV  514
             + +V
Sbjct  298  YSGTV  302


 Score = 53.5 bits (127),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 51/107 (48%), Gaps = 24/107 (22%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            R+SGT++GV+D  S  W DSKWR L+              +SPWEIE  V S        
Sbjct  297  RYSGTVIGVKD-CSPHWKDSKWRCLEVHWDEPASISRPNKVSPWEIEPFVNSENVPKSVM  355

Query  376  QRNKRARPANLPPSVSEFSALGT-----WKSPIDSPQSFSY-CDTSR  254
             +NKR      P  VSE SALG      W S +  P  F+  C TS+
Sbjct  356  LKNKR------PRQVSEVSALGITASNLWSSVLTQPHEFAQSCITSQ  396



>ref|XP_007051523.1| Auxin response factor 11 isoform 2 [Theobroma cacao]
 gb|EOX95680.1| Auxin response factor 11 isoform 2 [Theobroma cacao]
Length=643

 Score = 69.7 bits (169),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ PER 
Sbjct  254  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDSPERR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 52.4 bits (124),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 35/75 (47%), Positives = 42/75 (56%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S    L QP
Sbjct  311  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPATIQRPERVSPWEIEPFVPSASINLVQP  369

Query  379  PQRNKRARPANLPPS  335
              ++KR RP ++P S
Sbjct  370  AVKSKRPRPVDIPAS  384



>ref|XP_007051522.1| Auxin response factor 11 isoform 1 [Theobroma cacao]
 gb|EOX95679.1| Auxin response factor 11 isoform 1 [Theobroma cacao]
Length=923

 Score = 70.1 bits (170),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 47/65 (72%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ PER 
Sbjct  291  ATAAHAVTTHTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDSPERR  348

Query  528  CTDSV  514
             T ++
Sbjct  349  FTGTI  353


 Score = 52.4 bits (124),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 44/75 (59%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALV-TSTPQTLQP  380
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V +++   +QP
Sbjct  348  RFTGTIVGVGD-ISPHWSESKWRSLKIQWDEPATIQRPERVSPWEIEPFVPSASINLVQP  406

Query  379  PQRNKRARPANLPPS  335
              ++KR RP ++P S
Sbjct  407  AVKSKRPRPVDIPAS  421



>ref|XP_002527834.1| Auxin response factor, putative [Ricinus communis]
 gb|EEF34537.1| Auxin response factor, putative [Ricinus communis]
Length=620

 Score = 81.6 bits (200),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 46/57 (81%), Gaps = 4/57 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVP  538
            A AS+AI+T +LF VFY PRTSRSEFIVSVNKYIEA+NH   +G    MRFEGEEVP
Sbjct  273  AVASYAISTGSLFCVFYEPRTSRSEFIVSVNKYIEARNHKFCIGMRFLMRFEGEEVP  329


 Score = 40.8 bits (94),  Expect(2) = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 53/121 (44%), Gaps = 39/121 (32%)
 Frame = -1

Query  529  LYRFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQ  383
            + R +GTIV ++  TS RWPDS+WR  K              +SPWE+E + +S+    Q
Sbjct  330  IERINGTIVSME--TSPRWPDSEWRCFKVRWDEPSLIVHPERVSPWEMENISSSS----Q  383

Query  382  PPQRNKRAR-----PANLPPS----------------VSEFSALGTWKSPIDSPQSFSYC  266
            P  R KR+R        + PS                +S+    G W  P + P  FS C
Sbjct  384  PVPRTKRSRSSSPGAMEISPSSTQPGPRIKQLRSTVFLSQTPDFGMWIFPAEVP-GFSNC  442

Query  265  D  263
            D
Sbjct  443  D  443



>ref|XP_010538837.1| PREDICTED: auxin response factor 9-like [Tarenaya hassleriana]
Length=636

 Score = 71.6 bits (174),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HAI+T+T F+V+Y+PRTS  +FI+S+NKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  241  ATARHAIHTQTRFTVYYKPRTS--QFIISLNKYLEAMNNKFSVGMRFKMRFEGEDSPERR  298

Query  528  CTDSV  514
             + +V
Sbjct  299  FSGTV  303


 Score = 50.4 bits (119),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 50/109 (46%), Gaps = 26/109 (24%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLK-----------GFTLSPWEIEALVTSTPQTLQPP  377
            RFSGT+VGV+D  SS W DS+WR L+              +SPWEIE  V ST  T    
Sbjct  298  RFSGTVVGVKD-CSSHWKDSEWRCLRVQWDEPTSIQRHDNVSPWEIEPFVPSTNITQSVV  356

Query  376  QRNKRARPANLPPSVSEFSAL-------GTWKSPIDSPQSFSY-CDTSR  254
             +NKR R A      SE S L         W S +     F   C TS+
Sbjct  357  PKNKRPRQA------SEVSGLDLGSTRPNLWSSTLTQSHEFGQSCITSQ  399



>ref|XP_009375409.1| PREDICTED: auxin response factor 18 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375410.1| PREDICTED: auxin response factor 18 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336755.1| PREDICTED: auxin response factor 18 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009336757.1| PREDICTED: auxin response factor 18 isoform X1 [Pyrus x bretschneideri]
Length=695

 Score = 69.7 bits (169),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+TLF V+ +PRT  S+FIV +NKY+EA N+  S+G    MRFEGEE PER 
Sbjct  251  ATASHALMTKTLFVVYSKPRT--SQFIVCLNKYLEAINNKFSLGMRFRMRFEGEESPERR  308

Query  528  CTDSV  514
             T ++
Sbjct  309  FTGTI  313


 Score = 52.4 bits (124),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIV V D  SS+W +SKWRSLK              +SPW+IE  V S P  L QP
Sbjct  308  RFTGTIVEVGD-LSSQWSESKWRSLKVQWDEHAAVQRPERVSPWDIELFVASAPLNLAQP  366

Query  379  PQRNKRARPANLPPS  335
              ++KR+RP  +  S
Sbjct  367  VVKSKRSRPVEIASS  381



>ref|XP_011074533.1| PREDICTED: auxin response factor 9-like [Sesamum indicum]
 ref|XP_011074537.1| PREDICTED: auxin response factor 9-like [Sesamum indicum]
 ref|XP_011074547.1| PREDICTED: auxin response factor 9-like [Sesamum indicum]
 ref|XP_011074555.1| PREDICTED: auxin response factor 9-like [Sesamum indicum]
Length=629

 Score = 68.2 bits (165),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 44/59 (75%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA+ TRTLF V+Y+PRT  S+FI+ +NKY+EA +    VG    MRFEGE+ PER
Sbjct  255  ATASHAVLTRTLFVVYYKPRT--SQFIIGLNKYLEAVSRKFGVGMRFTMRFEGEDSPER  311


 Score = 53.9 bits (128),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 41/70 (59%), Gaps = 14/70 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE    S P +L QP
Sbjct  312  RFSGTIVGVED-ISPHWEDSKWRSLKVQWDEPASIPRPERVSPWEIEPFSVSVPTSLVQP  370

Query  379  P-QRNKRARP  353
            P  ++KR RP
Sbjct  371  PTMKHKRPRP  380



>gb|KDP25269.1| hypothetical protein JCGZ_20425 [Jatropha curcas]
Length=695

 Score = 71.6 bits (174),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 48/59 (81%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+S+NKY++A N+  +VG    MRFEGE+ PER
Sbjct  252  ATASHAVSTQTLFVVYYKPRT--SQFIISLNKYLDAVNNKFAVGMRFKMRFEGEDSPER  308


 Score = 50.4 bits (119),  Expect(2) = 4e-19, Method: Compositional matrix adjust.
 Identities = 33/70 (47%), Positives = 38/70 (54%), Gaps = 14/70 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWR LK              +SPWEIE    S P ++  P
Sbjct  309  RFSGTIVGVED-FSPHWVDSKWRHLKVQWDEPASIPRPDRVSPWEIEPFAASVPPSMTQP  367

Query  376  --QRNKRARP  353
               +NKR RP
Sbjct  368  VAVKNKRPRP  377



>gb|EPS70611.1| hypothetical protein M569_04145, partial [Genlisea aurea]
Length=338

 Score = 69.3 bits (168),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HAI T+TLF+VFY+PR S +EFIV  ++Y+E+  +  S+G    MRFEG+E PE+ 
Sbjct  95   ATAWHAIQTKTLFTVFYKPRISPAEFIVPYDQYMESVKNNYSIGMRFKMRFEGDEAPEQR  154

Query  528  CTDSV  514
             T ++
Sbjct  155  FTGTI  159


 Score = 52.4 bits (124),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 39/74 (53%), Gaps = 11/74 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV+D    RWPDSKWR LK              +SPW++E  ++       P 
Sbjct  154  RFTGTIVGVEDADPKRWPDSKWRCLKVRWDETSTFPRPERVSPWKVEPALSPPAMNPHPV  213

Query  376  QRNKRARPANLPPS  335
             R KR R + +P S
Sbjct  214  HRQKRPRSSIVPSS  227



>ref|XP_008811924.1| PREDICTED: auxin response factor 23-like [Phoenix dactylifera]
Length=866

 Score = 71.2 bits (173),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 4/59 (7%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA HA+NT T+F+V+Y+PRTS SEFIVS ++Y+E+  +  SVG    MRFEGEE PE+
Sbjct  283  ATAWHAVNTGTMFTVYYKPRTSPSEFIVSYDQYMESLKNNHSVGMRFKMRFEGEEAPEQ  341


 Score = 50.4 bits (119),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 40/74 (54%), Gaps = 11/74 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF GTIVG++D  S+RWP SKWR LK              +SPW+IE  +T  P    P 
Sbjct  342  RFIGTIVGIEDADSNRWPGSKWRCLKVRWDETSSISRPERVSPWKIEPALTPPPINPLPM  401

Query  376  QRNKRARPANLPPS  335
             R+KR R   +P S
Sbjct  402  PRSKRPRSNVVPCS  415



>emb|CDP08662.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 68.6 bits (166),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPERS  529
            ATASHAI T+TLF V+Y+PRT  S+FI+ +NKY+ A +H  S+GMR    FEGE+ PE+ 
Sbjct  261  ATASHAIITQTLFVVYYKPRT--SQFIIGLNKYLAAVSHGFSLGMRFKMKFEGEDSPEKR  318

Query  528  CTDSV  514
             T ++
Sbjct  319  FTGTI  323


 Score = 53.1 bits (126),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 14/76 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIE--ALVTSTPQTLQ  383
            RF+GTIVG+++  S +WPDS WRSLK              +SPWEIE  A+V+S     Q
Sbjct  318  RFTGTIVGLEE-VSPQWPDSPWRSLKIQWDEPASIKRPERVSPWEIEPFAVVSSADVAAQ  376

Query  382  PPQRNKRARPANLPPS  335
            P   +KR RP +LP S
Sbjct  377  PVPNSKRPRPLDLPTS  392



>gb|KEH22928.1| auxin response factor 2 [Medicago truncatula]
Length=680

 Score = 67.4 bits (163),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 34/58 (59%), Positives = 44/58 (76%), Gaps = 6/58 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVGMR----FEGEEVPE  535
            ATASHA+ T+TLF V+Y+PR S  +FI+SVNKY+EA N   SVGMR    F+G++ PE
Sbjct  240  ATASHAVATQTLFVVYYKPRMS--QFIISVNKYMEAINQKFSVGMRFKMSFDGDDSPE  295


 Score = 53.9 bits (128),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 46/79 (58%), Gaps = 16/79 (20%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RFSGTI+G Q++ SS W +SKWRSLK              +SPWEIE L+ S P ++QP 
Sbjct  299  RFSGTIIG-QEDISSHWLNSKWRSLKVQWDDPASIPRPDRISPWEIEPLMASVPTSIQPA  357

Query  376  -QRNKRARPANLPPSVSEF  323
              + KR R   LP  V +F
Sbjct  358  VAKYKRPR---LPSEVPDF  373



>ref|XP_008352781.1| PREDICTED: auxin response factor 18-like isoform X2 [Malus domestica]
Length=692

 Score = 69.7 bits (169),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+TLF V+ +PRT  S+FIV +NKY+EA N+  S+G    MRFEGEE PER 
Sbjct  251  ATASHALMTKTLFVVYSKPRT--SQFIVCLNKYLEAINNKFSLGMRFRMRFEGEESPERR  308

Query  528  CTDSV  514
             T ++
Sbjct  309  FTGTI  313


 Score = 52.0 bits (123),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 45/81 (56%), Gaps = 13/81 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIV V D  S +W +SKWRSLK              +SPW+IE  V S P  L QP
Sbjct  308  RFTGTIVEVGD-LSPQWXESKWRSLKVQWDEHAAVQRPERVSPWDIELFVASAPLNLAQP  366

Query  379  PQRNKRARPANLPPSVSEFSA  317
              ++KR RP  +  SV+  SA
Sbjct  367  VVKSKRPRPVEIASSVTTNSA  387



>emb|CDY10978.1| BnaA03g46370D [Brassica napus]
Length=625

 Score = 70.1 bits (170),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 46/59 (78%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATA HA  TR++F+V+Y+PRT  S+FI+S+NKY+EA ++  SVG    MRFEGE+ PER
Sbjct  233  ATACHATQTRSMFTVYYKPRT--SQFIISLNKYLEAMSNKFSVGIRFKMRFEGEDSPER  289


 Score = 51.6 bits (122),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 46/88 (52%), Gaps = 22/88 (25%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTS--TPQTLQ  383
            RFSGT+VGV+D  S+ W DS WR L+              +SPWEIE  VTS   P ++ 
Sbjct  290  RFSGTVVGVKD-CSTHWKDSNWRCLEVHWDEPASISRPDKVSPWEIEPFVTSENVPHSVM  348

Query  382  PPQRNKRARPANLPPSVSEFSALGTWKS  299
            P  +NKR      P   SE SAL   K+
Sbjct  349  P--KNKR------PRHYSEVSALDVGKT  368



>ref|XP_010942377.1| PREDICTED: auxin response factor 23-like [Elaeis guineensis]
 ref|XP_010942378.1| PREDICTED: auxin response factor 23-like [Elaeis guineensis]
Length=866

 Score = 69.3 bits (168),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HA+NT T+F+V+Y+PRTS S+FIV  ++Y+E+  +  S+G    MRFEGEE PE+ 
Sbjct  283  ATAWHAVNTGTMFTVYYKPRTSPSDFIVPCDQYMESLKNNHSIGMRFKMRFEGEEAPEQR  342

Query  528  CTDSV  514
             T ++
Sbjct  343  FTGTI  347


 Score = 52.0 bits (123),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 41/74 (55%), Gaps = 11/74 (15%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVG++D  S+RWP SKWR LK              +SPW+IE  +T  P    P 
Sbjct  342  RFTGTIVGIEDADSNRWPGSKWRCLKVRWDETSSIPRPERVSPWKIEPALTPPPINPLPM  401

Query  376  QRNKRARPANLPPS  335
             R+KR R   +P S
Sbjct  402  PRSKRPRSNVMPCS  415



>gb|KJB09639.1| hypothetical protein B456_001G153900 [Gossypium raimondii]
Length=639

 Score = 70.5 bits (171),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ P+R 
Sbjct  200  ATAAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRR  257

Query  528  CTDSV  514
             T ++
Sbjct  258  FTGTI  262


 Score = 50.8 bits (120),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 15/80 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWR+LK              +SPWEIE    S    L QP
Sbjct  257  RFTGTIVGVGD-FSPHWSESKWRTLKIQWDEPATIQRPERVSPWEIEPFAPSASINLVQP  315

Query  379  PQRNKRARPANLPPSVSEFS  320
              +NKR RP ++P  VSE +
Sbjct  316  AVKNKRPRPVDIP--VSEIT  333



>gb|KJB09635.1| hypothetical protein B456_001G153900 [Gossypium raimondii]
 gb|KJB09640.1| hypothetical protein B456_001G153900 [Gossypium raimondii]
 gb|KJB09641.1| hypothetical protein B456_001G153900 [Gossypium raimondii]
Length=693

 Score = 70.5 bits (171),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ P+R 
Sbjct  254  ATAAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 50.8 bits (120),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 15/80 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWR+LK              +SPWEIE    S    L QP
Sbjct  311  RFTGTIVGVGD-FSPHWSESKWRTLKIQWDEPATIQRPERVSPWEIEPFAPSASINLVQP  369

Query  379  PQRNKRARPANLPPSVSEFS  320
              +NKR RP ++P  VSE +
Sbjct  370  AVKNKRPRPVDIP--VSEIT  387



>ref|XP_008462117.1| PREDICTED: auxin response factor 18-like [Cucumis melo]
Length=660

 Score = 66.6 bits (161),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T F V+Y+PRT  S+FI+S+NKY+E   +   VG    MRFEGEE PER 
Sbjct  209  ATASHAVRTQTYFVVYYKPRT--SQFIISLNKYLETVKNGYEVGMRFKMRFEGEESPERR  266

Query  528  CTDSV  514
             T ++
Sbjct  267  FTGTI  271


 Score = 54.7 bits (130),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 13/74 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S +W DSKWRSLK              +SPWEIE  V S       P
Sbjct  266  RFTGTIVGVGD-MSPQWSDSKWRSLKIQWDEPATIQRPERVSPWEIEPFVPSASLNFTHP  324

Query  379  PQRNKRARPANLPP  338
              ++KRARP  +PP
Sbjct  325  AIKSKRARPVEIPP  338



>gb|KJB09636.1| hypothetical protein B456_001G153900 [Gossypium raimondii]
Length=577

 Score = 70.5 bits (171),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ P+R 
Sbjct  254  ATAAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 50.8 bits (120),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 41/75 (55%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWR+LK              +SPWEIE    S    L QP
Sbjct  311  RFTGTIVGVGD-FSPHWSESKWRTLKIQWDEPATIQRPERVSPWEIEPFAPSASINLVQP  369

Query  379  PQRNKRARPANLPPS  335
              +NKR RP ++P S
Sbjct  370  AVKNKRPRPVDIPVS  384



>ref|XP_010529651.1| PREDICTED: auxin response factor 9-like isoform X4 [Tarenaya 
hassleriana]
Length=638

 Score = 73.9 bits (180),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T+T F+V+Y+PRT  S+FIVS+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  243  ATASHAIHTQTRFTVYYKPRT--SQFIVSLNKYVEALNNKFSVGMRFKMRFEGEDSPER  299


 Score = 47.4 bits (111),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 53/112 (47%), Gaps = 19/112 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGT+VGV D  S  W DSKWR L+              +SPWEIE  V S+    Q  
Sbjct  300  RFSGTVVGVND-CSPHWIDSKWRCLEVQWDEPSSILRPDRVSPWEIEPFVPSSANIAQSV  358

Query  376  Q-RNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSY---CDTSR--GTDH  242
              +NKR R  N   S+   S A   W S +   QS  +   C TS+  G+ H
Sbjct  359  APKNKRPRQVNEVSSLDLGSPAPNLWSSTLTQSQSHVFAQSCITSQMSGSQH  410



>ref|XP_007040577.1| Auxin response factor 9 isoform 2 [Theobroma cacao]
 gb|EOY25078.1| Auxin response factor 9 isoform 2 [Theobroma cacao]
Length=693

 Score = 70.1 bits (170),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +N+Y+EA N+  +VG    MRFEGE+ PER
Sbjct  254  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNRYLEALNNKFAVGMRFKMRFEGEDSPER  310


 Score = 51.2 bits (121),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 42/78 (54%), Gaps = 14/78 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DS+WRSLK              +SPWEIE      P TL  P
Sbjct  311  RFSGTIVGVED-FSPHWKDSQWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  369

Query  376  --QRNKRARPANLPPSVS  329
               +NKR RP    P+++
Sbjct  370  LAAKNKRPRPPTEIPALA  387



>ref|XP_010529646.1| PREDICTED: auxin response factor 9-like isoform X1 [Tarenaya 
hassleriana]
Length=655

 Score = 73.9 bits (180),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T+T F+V+Y+PRT  S+FIVS+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  260  ATASHAIHTQTRFTVYYKPRT--SQFIVSLNKYVEALNNKFSVGMRFKMRFEGEDSPER  316


 Score = 47.4 bits (111),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 53/112 (47%), Gaps = 19/112 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGT+VGV D  S  W DSKWR L+              +SPWEIE  V S+    Q  
Sbjct  317  RFSGTVVGVND-CSPHWIDSKWRCLEVQWDEPSSILRPDRVSPWEIEPFVPSSANIAQSV  375

Query  376  Q-RNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSY---CDTSR--GTDH  242
              +NKR R  N   S+   S A   W S +   QS  +   C TS+  G+ H
Sbjct  376  APKNKRPRQVNEVSSLDLGSPAPNLWSSTLTQSQSHVFAQSCITSQMSGSQH  427



>ref|XP_004173327.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 9-like, 
partial [Cucumis sativus]
Length=590

 Score = 66.6 bits (161),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T F V+Y+PRT  S+FI+S+NKY+E   +   VG    MRFEGEE PER 
Sbjct  146  ATASHAVRTQTYFVVYYKPRT--SQFIISLNKYLETVKNGYEVGMRFKMRFEGEESPERR  203

Query  528  CTDSV  514
             T ++
Sbjct  204  FTGTI  208


 Score = 54.3 bits (129),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 13/74 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S +W DSKWRSLK              +SPWEIE  V S       P
Sbjct  203  RFTGTIVGVGD-MSPQWSDSKWRSLKIQWDEPATIQRPERVSPWEIEPFVPSASLNFTHP  261

Query  379  PQRNKRARPANLPP  338
              ++KRARP  +PP
Sbjct  262  AIKSKRARPVEIPP  275



>ref|XP_010529650.1| PREDICTED: auxin response factor 9-like isoform X3 [Tarenaya 
hassleriana]
Length=643

 Score = 73.9 bits (180),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T+T F+V+Y+PRT  S+FIVS+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  248  ATASHAIHTQTRFTVYYKPRT--SQFIVSLNKYVEALNNKFSVGMRFKMRFEGEDSPER  304


 Score = 47.4 bits (111),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 53/112 (47%), Gaps = 19/112 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGT+VGV D  S  W DSKWR L+              +SPWEIE  V S+    Q  
Sbjct  305  RFSGTVVGVND-CSPHWIDSKWRCLEVQWDEPSSILRPDRVSPWEIEPFVPSSANIAQSV  363

Query  376  Q-RNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSY---CDTSR--GTDH  242
              +NKR R  N   S+   S A   W S +   QS  +   C TS+  G+ H
Sbjct  364  APKNKRPRQVNEVSSLDLGSPAPNLWSSTLTQSQSHVFAQSCITSQMSGSQH  415



>ref|XP_004139643.1| PREDICTED: auxin response factor 18-like [Cucumis sativus]
 gb|KGN44547.1| hypothetical protein Csa_7G329330 [Cucumis sativus]
Length=693

 Score = 66.6 bits (161),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 46/65 (71%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T+T F V+Y+PRT  S+FI+S+NKY+E   +   VG    MRFEGEE PER 
Sbjct  249  ATASHAVRTQTYFVVYYKPRT--SQFIISLNKYLETVKNGYEVGMRFKMRFEGEESPERR  306

Query  528  CTDSV  514
             T ++
Sbjct  307  FTGTI  311


 Score = 54.3 bits (129),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 41/74 (55%), Gaps = 13/74 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S +W DSKWRSLK              +SPWEIE  V S       P
Sbjct  306  RFTGTIVGVGD-MSPQWSDSKWRSLKIQWDEPATIQRPERVSPWEIEPFVPSASLNFTHP  364

Query  379  PQRNKRARPANLPP  338
              ++KRARP  +PP
Sbjct  365  AIKSKRARPVEIPP  378



>gb|KHG01748.1| Auxin response factor 18 -like protein [Gossypium arboreum]
Length=693

 Score = 70.5 bits (171),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ P+R 
Sbjct  254  ATAAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 50.4 bits (119),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 15/80 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWR+LK              +SPWEIE    S    L QP
Sbjct  311  RFTGTIVGVGD-FSPHWSESKWRTLKIQWDEPATIQRPERVSPWEIEPFAPSASINLVQP  369

Query  379  PQRNKRARPANLPPSVSEFS  320
              +NKR RP ++P  VSE +
Sbjct  370  SVKNKRPRPVDIP--VSEIT  387



>ref|XP_010529649.1| PREDICTED: auxin response factor 9-like isoform X2 [Tarenaya 
hassleriana]
Length=650

 Score = 73.9 bits (180),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHAI+T+T F+V+Y+PRT  S+FIVS+NKY+EA N+  SVG    MRFEGE+ PER
Sbjct  255  ATASHAIHTQTRFTVYYKPRT--SQFIVSLNKYVEALNNKFSVGMRFKMRFEGEDSPER  311


 Score = 47.4 bits (111),  Expect(2) = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 53/112 (47%), Gaps = 19/112 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGT+VGV D  S  W DSKWR L+              +SPWEIE  V S+    Q  
Sbjct  312  RFSGTVVGVND-CSPHWIDSKWRCLEVQWDEPSSILRPDRVSPWEIEPFVPSSANIAQSV  370

Query  376  Q-RNKRARPANLPPSVSEFS-ALGTWKSPIDSPQSFSY---CDTSR--GTDH  242
              +NKR R  N   S+   S A   W S +   QS  +   C TS+  G+ H
Sbjct  371  APKNKRPRQVNEVSSLDLGSPAPNLWSSTLTQSQSHVFAQSCITSQMSGSQH  422



>gb|KJB09637.1| hypothetical protein B456_001G153900 [Gossypium raimondii]
Length=603

 Score = 70.1 bits (170),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ P+R 
Sbjct  254  ATAAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 50.8 bits (120),  Expect(2) = 8e-19, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 44/80 (55%), Gaps = 15/80 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWR+LK              +SPWEIE    S    L QP
Sbjct  311  RFTGTIVGVGD-FSPHWSESKWRTLKIQWDEPATIQRPERVSPWEIEPFAPSASINLVQP  369

Query  379  PQRNKRARPANLPPSVSEFS  320
              +NKR RP ++P  VSE +
Sbjct  370  AVKNKRPRPVDIP--VSEIT  387



>gb|KJB09638.1| hypothetical protein B456_001G153900 [Gossypium raimondii]
Length=412

 Score = 70.1 bits (170),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T+TLF V+Y+PRT  S+FI+ VNKY+EA  +  SVG    MRFEGE+ P+R 
Sbjct  254  ATAAHAVTTQTLFVVYYKPRT--SQFIIGVNKYLEAIKNGFSVGMRFKMRFEGEDTPDRR  311

Query  528  CTDSV  514
             T ++
Sbjct  312  FTGTI  316


 Score = 50.8 bits (120),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 41/75 (55%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWR+LK              +SPWEIE    S    L QP
Sbjct  311  RFTGTIVGVGD-FSPHWSESKWRTLKIQWDEPATIQRPERVSPWEIEPFAPSASINLVQP  369

Query  379  PQRNKRARPANLPPS  335
              +NKR RP ++P S
Sbjct  370  AVKNKRPRPVDIPVS  384



>ref|XP_007040576.1| Auxin response factor 9 isoform 1 [Theobroma cacao]
 gb|EOY25077.1| Auxin response factor 9 isoform 1 [Theobroma cacao]
Length=698

 Score = 70.1 bits (170),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +N+Y+EA N+  +VG    MRFEGE+ PER
Sbjct  254  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNRYLEALNNKFAVGMRFKMRFEGEDSPER  310


 Score = 50.4 bits (119),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DS+WRSLK              +SPWEIE      P TL  P
Sbjct  311  RFSGTIVGVED-FSPHWKDSQWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  369

Query  376  --QRNKRARPANLPPSV  332
               +NKR RP    P++
Sbjct  370  LAAKNKRPRPPTEIPAL  386



>ref|XP_006491297.1| PREDICTED: auxin response factor 18-like isoform X3 [Citrus sinensis]
 gb|KDO86504.1| hypothetical protein CISIN_1g005368mg [Citrus sinensis]
Length=687

 Score = 72.0 bits (175),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA+HA+ T TLF V+Y+PRT  S+FI+ +NKY+EA +H  SVG    MRFEGE+ PER 
Sbjct  252  ATAAHAVKTSTLFIVYYKPRT--SQFIIGLNKYLEAVHHCFSVGMRFKMRFEGEDSPERR  309

Query  528  CTDSV  514
             T ++
Sbjct  310  FTGTI  314


 Score = 48.9 bits (115),  Expect(2) = 9e-19, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 34/64 (53%), Gaps = 12/64 (19%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKG-----------FTLSPWEIEALVTSTPQTLQPP  377
            RF+GTIVGV D  S +WP SKWRSLK              +SPWEIE  V S P  L  P
Sbjct  309  RFTGTIVGVGD-FSEQWPGSKWRSLKIQWDEPATVQRPERVSPWEIEPFVASAPLNLAQP  367

Query  376  QRNK  365
               K
Sbjct  368  AVKK  371



>ref|XP_003564986.1| PREDICTED: auxin response factor 4-like [Brachypodium distachyon]
Length=814

 Score = 72.0 bits (175),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 49/65 (75%), Gaps = 4/65 (6%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATA HAINT+++F+V+Y+PRTS SEFI+  ++Y+E+  +  S+G    MRFEGEE PE+ 
Sbjct  251  ATAWHAINTKSMFTVYYKPRTSPSEFIIPYDQYMESVKNNYSIGVRFRMRFEGEEAPEQR  310

Query  528  CTDSV  514
             T ++
Sbjct  311  FTGTI  315


 Score = 48.9 bits (115),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 51/96 (53%), Gaps = 17/96 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RF+GTI+G  +N    WP+S WRSLK              +SPW+IE   +S P    P 
Sbjct  310  RFTGTIIG-SENLDPLWPESSWRSLKVRWDEPSTIPRPDRVSPWKIEP-ASSPPVNPLPL  367

Query  376  QRNKRARPANLPPSVSEFSAL---GTWKSPIDSPQS  278
             R KR RP N+PP+  E SAL   G  K  +DS Q+
Sbjct  368  SRVKRPRP-NVPPASPESSALTKEGATKVDVDSAQA  402



>ref|XP_007040578.1| Auxin response factor 9 isoform 3 [Theobroma cacao]
 gb|EOY25079.1| Auxin response factor 9 isoform 3 [Theobroma cacao]
Length=590

 Score = 70.1 bits (170),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +N+Y+EA N+  +VG    MRFEGE+ PER
Sbjct  254  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNRYLEALNNKFAVGMRFKMRFEGEDSPER  310


 Score = 50.4 bits (119),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DS+WRSLK              +SPWEIE      P TL  P
Sbjct  311  RFSGTIVGVED-FSPHWKDSQWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  369

Query  376  --QRNKRARPANLPPSV  332
               +NKR RP    P++
Sbjct  370  LAAKNKRPRPPTEIPAL  386



>gb|KHG11573.1| Auxin response factor 9 -like protein [Gossypium arboreum]
Length=694

 Score = 68.9 bits (167),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 47/59 (80%), Gaps = 6/59 (10%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPER  532
            ATASHA++T+TLF V+Y+PRT  S+FI+ +NKY+EA ++  +VG    MRFEGE+ PER
Sbjct  253  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNKYLEALSNKFTVGMRFKMRFEGEDSPER  309


 Score = 51.6 bits (122),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 46/91 (51%), Gaps = 15/91 (16%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DSKWRSLK              +SPWEIE      P TL  P
Sbjct  310  RFSGTIVGVED-FSPYWKDSKWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  368

Query  376  --QRNKRARP-ANLPPSVSEFSALGTWKSPI  293
               +NKR RP A +P      +A   W S +
Sbjct  369  VAAKNKRPRPTAEIPALDLSSTASAPWNSGV  399



>ref|XP_004306655.1| PREDICTED: auxin response factor 18 [Fragaria vesca subsp. vesca]
Length=684

 Score = 71.6 bits (174),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/65 (58%), Positives = 48/65 (74%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA+ T TLF V+Y+PRT  S+FIV +NKY+EA N+  SVG    MRFEGE+ PER 
Sbjct  252  ATASHAVMTSTLFVVYYKPRT--SQFIVGLNKYLEAINNKFSVGMRFKMRFEGEDSPERR  309

Query  528  CTDSV  514
             T ++
Sbjct  310  FTGTI  314


 Score = 48.9 bits (115),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 33/75 (44%), Positives = 40/75 (53%), Gaps = 13/75 (17%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTL-QP  380
            RF+GTIVGV D  S  W +SKWRSLK              +SPWEIE  V S P  L QP
Sbjct  309  RFTGTIVGVGD-LSPHWAESKWRSLKVQWDEHATVPRPDRVSPWEIEPFVASVPLNLAQP  367

Query  379  PQRNKRARPANLPPS  335
              ++KR +   +  S
Sbjct  368  VVKSKRPKTVEIASS  382



>ref|XP_007040579.1| Auxin response factor 9 isoform 4 [Theobroma cacao]
 gb|EOY25080.1| Auxin response factor 9 isoform 4 [Theobroma cacao]
Length=556

 Score = 70.1 bits (170),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 50/65 (77%), Gaps = 6/65 (9%)
 Frame = -2

Query  696  ATASHAINTRTLFSVFYRPRTSRSEFIVSVNKYIEAQNH*LSVG----MRFEGEEVPERS  529
            ATASHA++T+TLF V+Y+PRT  S+FI+ +N+Y+EA N+  +VG    MRFEGE+ PER 
Sbjct  254  ATASHAVSTQTLFVVYYKPRT--SQFIIGLNRYLEALNNKFAVGMRFKMRFEGEDSPERR  311

Query  528  CTDSV  514
             + ++
Sbjct  312  FSGTI  316


 Score = 50.4 bits (119),  Expect(2) = 1e-18, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 41/77 (53%), Gaps = 14/77 (18%)
 Frame = -1

Query  523  RFSGTIVGVQDNTSSRWPDSKWRSLKGF-----------TLSPWEIEALVTSTPQTLQPP  377
            RFSGTIVGV+D  S  W DS+WRSLK              +SPWEIE      P TL  P
Sbjct  311  RFSGTIVGVED-FSPHWKDSQWRSLKVQWDEPASIPRPDRVSPWEIEPFAAPIPPTLGQP  369

Query  376  --QRNKRARPANLPPSV  332
               +NKR RP    P++
Sbjct  370  LAAKNKRPRPPTEIPAL  386



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1185322056160