BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037J22

Length=506
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009380029.1|  PREDICTED: proteasome subunit alpha type-6         194   1e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010274570.1|  PREDICTED: proteasome subunit alpha type-6         193   4e-58   Nelumbo nucifera [Indian lotus]
ref|XP_009631638.1|  PREDICTED: proteasome subunit alpha type-6         192   1e-57   Nicotiana tomentosiformis
ref|XP_006842706.1|  hypothetical protein AMTR_s00147p00090390          191   2e-57   Amborella trichopoda
ref|XP_009797939.1|  PREDICTED: proteasome subunit alpha type-6         191   2e-57   Nicotiana sylvestris
ref|XP_011098408.1|  PREDICTED: proteasome subunit alpha type-6         191   3e-57   Sesamum indicum [beniseed]
emb|CDP03072.1|  unnamed protein product                                191   4e-57   Coffea canephora [robusta coffee]
gb|EPS63192.1|  proteasome subunit alpha type-6                         190   5e-57   Genlisea aurea
gb|EYU19318.1|  hypothetical protein MIMGU_mgv1a012555mg                190   5e-57   Erythranthe guttata [common monkey flower]
ref|XP_004251692.1|  PREDICTED: proteasome subunit alpha type-6         190   6e-57   Solanum lycopersicum
ref|XP_010937324.1|  PREDICTED: proteasome subunit alpha type-6         189   1e-56   Elaeis guineensis
ref|XP_010269878.1|  PREDICTED: proteasome subunit alpha type-6-like    189   1e-56   Nelumbo nucifera [Indian lotus]
ref|XP_011099933.1|  PREDICTED: proteasome subunit alpha type-6-like    189   2e-56   Sesamum indicum [beniseed]
ref|XP_009404175.1|  PREDICTED: proteasome subunit alpha type-6-like    189   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008782714.1|  PREDICTED: proteasome subunit alpha type-6         188   3e-56   Phoenix dactylifera
ref|XP_002532723.1|  proteasome subunit alpha type, putative            187   8e-56   Ricinus communis
ref|XP_002516258.1|  proteasome subunit alpha type, putative            187   9e-56   Ricinus communis
gb|KJB65226.1|  hypothetical protein B456_010G089600                    186   2e-55   Gossypium raimondii
gb|ACJ11727.1|  20S proteasome subunit alpha-1                          186   2e-55   Gossypium hirsutum [American cotton]
ref|XP_008802476.1|  PREDICTED: proteasome subunit alpha type-6-like    186   2e-55   Phoenix dactylifera
ref|XP_006474717.1|  PREDICTED: proteasome subunit alpha type-6-l...    186   2e-55   
ref|XP_010939895.1|  PREDICTED: proteasome subunit alpha type-6-like    186   2e-55   Elaeis guineensis
ref|XP_010111992.1|  Proteasome subunit alpha type-6                    187   2e-55   
gb|KHG01950.1|  Proteasome subunit alpha type-6                         186   3e-55   Gossypium arboreum [tree cotton]
ref|XP_008462289.1|  PREDICTED: proteasome subunit alpha type-6         186   3e-55   Cucumis melo [Oriental melon]
ref|XP_006592586.1|  PREDICTED: proteasome subunit alpha type-6-like    186   3e-55   Glycine max [soybeans]
ref|XP_006474716.1|  PREDICTED: proteasome subunit alpha type-6-l...    186   3e-55   Citrus sinensis [apfelsine]
ref|XP_008342576.1|  PREDICTED: proteasome subunit alpha type-6-like    181   4e-55   
ref|XP_004303706.1|  PREDICTED: proteasome subunit alpha type-6         185   4e-55   Fragaria vesca subsp. vesca
ref|XP_010064020.1|  PREDICTED: proteasome subunit alpha type-6         185   5e-55   Eucalyptus grandis [rose gum]
ref|XP_002271929.1|  PREDICTED: proteasome subunit alpha type-6         185   6e-55   Vitis vinifera
ref|XP_007012615.1|  20S proteasome subunit PAA2 isoform 1              185   7e-55   Theobroma cacao [chocolate]
ref|NP_001238251.1|  proteasome subunit alpha type-6                    185   8e-55   
gb|KJB82988.1|  hypothetical protein B456_013G223200                    184   9e-55   Gossypium raimondii
gb|KJB82986.1|  hypothetical protein B456_013G223200                    184   1e-54   Gossypium raimondii
ref|XP_004141710.1|  PREDICTED: proteasome subunit alpha type-6-like    184   1e-54   Cucumis sativus [cucumbers]
ref|XP_006381605.1|  hypothetical protein POPTR_0006s14260g             184   1e-54   Populus trichocarpa [western balsam poplar]
gb|ABK95322.1|  unknown                                                 184   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011001657.1|  PREDICTED: proteasome subunit alpha type-6-like    184   2e-54   Populus euphratica
ref|XP_002323091.1|  Proteasome subunit alpha type 6-1 family pro...    184   2e-54   Populus trichocarpa [western balsam poplar]
ref|XP_004488480.1|  PREDICTED: proteasome subunit alpha type-6-l...    184   2e-54   Cicer arietinum [garbanzo]
ref|XP_007133143.1|  hypothetical protein PHAVU_011G155200g             183   3e-54   Phaseolus vulgaris [French bean]
gb|KDP45827.1|  hypothetical protein JCGZ_17434                         183   4e-54   Jatropha curcas
gb|KDP33929.1|  hypothetical protein JCGZ_07500                         183   4e-54   Jatropha curcas
ref|XP_007215872.1|  hypothetical protein PRUPE_ppa010523mg             182   6e-54   Prunus persica
ref|XP_008228175.1|  PREDICTED: proteasome subunit alpha type-6         182   6e-54   Prunus mume [ume]
gb|ACN66752.1|  PAA1                                                    182   7e-54   Carica papaya [mamon]
ref|XP_002308263.1|  Proteasome subunit alpha type 6-1 family pro...    182   7e-54   Populus trichocarpa [western balsam poplar]
gb|ADJ95344.1|  PAA1                                                    182   7e-54   Carica papaya [mamon]
ref|XP_011018964.1|  PREDICTED: proteasome subunit alpha type-6-like    182   7e-54   Populus euphratica
gb|AFK47610.1|  unknown                                                 182   7e-54   Lotus japonicus
gb|KDO64985.1|  hypothetical protein CISIN_1g025897mg                   179   9e-54   Citrus sinensis [apfelsine]
ref|XP_006426693.1|  hypothetical protein CICLE_v100263522mg            179   9e-54   
gb|AFK46380.1|  unknown                                                 182   9e-54   Lotus japonicus
gb|KJB65225.1|  hypothetical protein B456_010G089600                    182   1e-53   Gossypium raimondii
gb|ACU24622.1|  unknown                                                 182   1e-53   Glycine max [soybeans]
ref|XP_008391412.1|  PREDICTED: proteasome subunit alpha type-6         181   1e-53   Malus domestica [apple tree]
ref|XP_009344472.1|  PREDICTED: proteasome subunit alpha type-6         181   1e-53   Pyrus x bretschneideri [bai li]
gb|ACJ85916.1|  unknown                                                 181   2e-53   Medicago truncatula
gb|KDO64983.1|  hypothetical protein CISIN_1g025897mg                   179   2e-53   Citrus sinensis [apfelsine]
gb|KDO64982.1|  hypothetical protein CISIN_1g025897mg                   180   4e-53   Citrus sinensis [apfelsine]
gb|KJB82987.1|  hypothetical protein B456_013G223200                    180   6e-53   Gossypium raimondii
gb|KDO64977.1|  hypothetical protein CISIN_1g025897mg                   179   1e-52   Citrus sinensis [apfelsine]
ref|XP_006465892.1|  PREDICTED: proteasome subunit alpha type-6-like    179   1e-52   Citrus sinensis [apfelsine]
gb|ABK96399.1|  unknown                                                 179   2e-52   Populus trichocarpa x Populus deltoides
ref|XP_003595788.1|  Proteasome subunit alpha type                      179   2e-52   Medicago truncatula
ref|XP_006452821.1|  hypothetical protein CICLE_v10010323mg             177   4e-52   
ref|XP_010666851.1|  PREDICTED: proteasome subunit alpha type-6         177   4e-52   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK32243.1|  hypothetical protein AALP_AA6G216400                    177   5e-52   Arabis alpina [alpine rockcress]
ref|XP_010557672.1|  PREDICTED: proteasome subunit alpha type-6-B...    177   6e-52   Tarenaya hassleriana [spider flower]
gb|ACJ85912.1|  unknown                                                 177   8e-52   Medicago truncatula
gb|AFK46801.1|  unknown                                                 177   8e-52   Medicago truncatula
ref|NP_178641.1|  20S proteasome subunit PAA2                           176   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010533014.1|  PREDICTED: proteasome subunit alpha type-6-B...    175   4e-51   Tarenaya hassleriana [spider flower]
ref|XP_010450390.1|  PREDICTED: proteasome subunit alpha type-6-A       175   5e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006282775.1|  hypothetical protein CARUB_v10006215mg             174   7e-51   Capsella rubella
ref|XP_010435443.1|  PREDICTED: proteasome subunit alpha type-6-A...    174   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010541996.1|  PREDICTED: proteasome subunit alpha type-6-B       174   8e-51   Tarenaya hassleriana [spider flower]
ref|XP_010494382.1|  PREDICTED: proteasome subunit alpha type-6-B       174   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002870436.1|  hypothetical protein ARALYDRAFT_493620             173   2e-50   
gb|ABR17363.1|  unknown                                                 169   3e-50   Picea sitchensis
ref|XP_009136197.1|  PREDICTED: proteasome subunit alpha type-6-B...    172   5e-50   Brassica rapa
ref|NP_198409.1|  proteasome alpha subunit A1                           172   6e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAM12968.1|  multicatalytic endopeptidase complex alpha subuni...    172   6e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CAA74025.1|  multicatalytic endopeptidase complex, proteasome...    172   6e-50   Arabidopsis thaliana [mouse-ear cress]
emb|CDY50408.1|  BnaC03g45100D                                          172   7e-50   Brassica napus [oilseed rape]
ref|XP_009102355.1|  PREDICTED: proteasome subunit alpha type-6-B       172   8e-50   Brassica rapa
ref|XP_006396131.1|  hypothetical protein EUTSA_v10002649mg             171   1e-49   Eutrema salsugineum [saltwater cress]
ref|XP_006649499.1|  PREDICTED: proteasome subunit alpha type-6-like    171   1e-49   Oryza brachyantha
emb|CDX93103.1|  BnaA03g38250D                                          172   1e-49   
ref|NP_001049162.1|  Os03g0180400                                       171   1e-49   
ref|XP_002465753.1|  hypothetical protein SORBIDRAFT_01g045210          171   2e-49   Sorghum bicolor [broomcorn]
gb|ABF94306.1|  Proteasome subunit alpha type 6, putative, expressed    171   3e-49   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001130062.1|  uncharacterized protein LOC100191154               170   3e-49   Zea mays [maize]
ref|XP_010441957.1|  PREDICTED: proteasome subunit alpha type-6-B...    170   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_004985490.1|  PREDICTED: proteasome subunit alpha type-6-like    170   4e-49   Setaria italica
gb|ACN33969.1|  unknown                                                 169   6e-49   Zea mays [maize]
ref|NP_001105138.1|  maize 20S proteasome alpha subunit                 169   8e-49   Zea mays [maize]
gb|AAC32054.1|  20S proteasome subunit PAA1                             169   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|ABK22399.1|  unknown                                                 169   1e-48   Picea sitchensis
gb|EMT09268.1|  Proteasome subunit alpha type-6                         169   1e-48   
ref|XP_003558667.1|  PREDICTED: proteasome subunit alpha type-6         168   2e-48   Brachypodium distachyon [annual false brome]
dbj|BAJ85935.1|  predicted protein                                      168   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001777426.1|  predicted protein                                  168   3e-48   
gb|AGO97077.1|  20S proteasome alpha                                    167   4e-48   Saccharum hybrid cultivar GT28
ref|XP_002989745.1|  hypothetical protein SELMODRAFT_272088             166   9e-48   Selaginella moellendorffii
ref|XP_001768229.1|  predicted protein                                  166   1e-47   
ref|XP_001782615.1|  predicted protein                                  164   9e-47   
ref|XP_001751730.1|  predicted protein                                  153   1e-42   
ref|NP_001150310.1|  proteasome subunit alpha type 6                    143   2e-38   Zea mays [maize]
ref|XP_005648429.1|  proteasome subunit alpha type-6                    142   4e-38   Coccomyxa subellipsoidea C-169
ref|XP_010136410.1|  PREDICTED: proteasome subunit alpha type-6 i...    136   7e-37   Buceros rhinoceros silvestris
gb|KHG04433.1|  Proteasome subunit alpha type-6                         137   9e-37   Gossypium arboreum [tree cotton]
ref|XP_006835408.1|  PREDICTED: proteasome subunit alpha type-6 i...    135   1e-36   Chrysochloris asiatica
ref|NP_989113.1|  proteasome subunit alpha type-6                       137   1e-36   Xenopus tropicalis [western clawed frog]
ref|XP_010169981.1|  PREDICTED: proteasome subunit alpha type-6         135   2e-36   Antrostomus carolinensis
ref|XP_009942435.1|  PREDICTED: proteasome subunit alpha type-6         135   2e-36   Opisthocomus hoazin [hoatzin]
ref|XP_009973400.1|  PREDICTED: proteasome subunit alpha type-6         135   2e-36   Tyto alba [Schleiereule]
ref|XP_005444182.1|  PREDICTED: proteasome subunit alpha type-6         134   3e-36   
ref|XP_010390621.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    134   3e-36   
gb|KFO90954.1|  Proteasome subunit alpha type-6                         136   3e-36   Buceros rhinoceros silvestris
ref|XP_006732282.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   3e-36   Leptonychotes weddellii
gb|EGW11727.1|  Proteasome subunit alpha type-6                         134   4e-36   Cricetulus griseus [Chinese hamsters]
ref|XP_008157204.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   7e-36   
ref|NP_001269161.1|  proteasome subunit alpha type-6 isoform b          133   8e-36   Homo sapiens [man]
gb|KFR01991.1|  Proteasome subunit alpha type-6                         135   9e-36   Opisthocomus hoazin [hoatzin]
gb|KFZ47806.1|  Proteasome subunit alpha type-6                         135   9e-36   Antrostomus carolinensis
gb|KFV43324.1|  Proteasome subunit alpha type-6                         134   1e-35   Tyto alba [Schleiereule]
gb|KFO63713.1|  Proteasome subunit alpha type-6                         134   1e-35   Corvus brachyrhynchos
ref|XP_005014711.1|  PREDICTED: proteasome subunit alpha type-6         134   1e-35   
ref|XP_006835407.1|  PREDICTED: proteasome subunit alpha type-6 i...    135   1e-35   Chrysochloris asiatica
gb|KFP89006.1|  Proteasome subunit alpha type-6                         134   1e-35   Apaloderma vittatum
gb|EMC83847.1|  Proteasome subunit alpha type-6                         134   1e-35   
ref|XP_005047359.1|  PREDICTED: proteasome subunit alpha type-6         134   2e-35   
ref|XP_009288678.1|  PREDICTED: proteasome subunit alpha type-6         134   2e-35   
ref|XP_004773397.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   2e-35   Mustela putorius furo [black ferret]
gb|KFQ31740.1|  Proteasome subunit alpha type-6                         134   2e-35   Merops nubicus
gb|KFQ96181.1|  Proteasome subunit alpha type-6                         134   2e-35   Nipponia nippon
ref|NP_001088418.1|  uncharacterized protein LOC495277                  134   2e-35   Xenopus laevis [clawed frog]
ref|NP_001264372.1|  proteasome subunit alpha type-6                    134   2e-35   Gallus gallus [bantam]
ref|XP_003971508.1|  PREDICTED: proteasome subunit alpha type-6-like    134   3e-35   Takifugu rubripes [tiger puffer]
ref|XP_003445487.1|  PREDICTED: proteasome subunit alpha type-6-like    134   3e-35   Oreochromis niloticus
emb|CAA43964.1|  macropain subunit iota                                 133   3e-35   Homo sapiens [man]
ref|XP_006515947.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   3e-35   
ref|XP_006240160.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   3e-35   Rattus norvegicus [brown rat]
ref|XP_002500811.1|  predicted protein                                  135   3e-35   Micromonas commoda
ref|XP_001691723.1|  20S proteasome alpha subunit A                     134   3e-35   Chlamydomonas reinhardtii
ref|XP_004681994.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   3e-35   
ref|XP_005243955.1|  PREDICTED: proteasome subunit alpha type-6         134   3e-35   
ref|XP_005158685.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   3e-35   
ref|XP_006258805.1|  PREDICTED: proteasome subunit alpha type-6         134   3e-35   Alligator mississippiensis
ref|XP_010631916.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   3e-35   Fukomys damarensis [Damara mole rat]
gb|EXX71316.1|  proteasome core particle subunit alpha 1                132   3e-35   Rhizophagus irregularis DAOM 197198w
ref|XP_009901279.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   4e-35   Picoides pubescens
ref|XP_005376981.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   4e-35   Chinchilla lanigera
ref|XP_005149366.1|  PREDICTED: proteasome subunit alpha type-6         134   4e-35   
ref|NP_001269163.1|  proteasome subunit alpha type-6 isoform c          133   4e-35   Homo sapiens [man]
ref|XP_004612218.1|  PREDICTED: proteasome subunit alpha type-6         132   4e-35   Sorex araneus [Eurasian shrew]
ref|XP_004270017.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   4e-35   
gb|KFZ52790.1|  Proteasome subunit alpha type-6                         133   4e-35   Podiceps cristatus
ref|XP_004436463.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   4e-35   
ref|XP_007464885.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   4e-35   Lipotes vexillifer [baiji]
ref|XP_537412.2|  PREDICTED: proteasome subunit alpha type-6 isof...    134   4e-35   Canis lupus familiaris [dogs]
ref|XP_002949740.1|  20S proteasome alpha subunit A                     134   4e-35   Volvox carteri f. nagariensis
ref|XP_004055136.1|  PREDICTED: proteasome subunit alpha type-6-like    133   4e-35   
ref|XP_010153543.1|  PREDICTED: proteasome subunit alpha type-6 i...    134   4e-35   Eurypyga helias
ref|NP_001232198.1|  putative proteasome subunit alpha type 6           134   4e-35   Taeniopygia guttata
ref|XP_007119013.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   4e-35   
ref|XP_005656350.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   4e-35   
gb|KHN46954.1|  Proteasome subunit alpha type-6                         138   5e-35   Glycine soja [wild soybean]
ref|XP_010744453.1|  PREDICTED: proteasome subunit alpha type-6         134   5e-35   
ref|XP_009317738.1|  PREDICTED: proteasome subunit alpha type-6         134   5e-35   Pygoscelis adeliae
emb|CAG00121.1|  unnamed protein product                                133   5e-35   Tetraodon nigroviridis
ref|XP_004584816.1|  PREDICTED: proteasome subunit alpha type-6         133   5e-35   Ochotona princeps [southern American pika]
ref|XP_010876681.1|  PREDICTED: proteasome subunit alpha type-6         133   6e-35   Esox lucius
ref|XP_006632201.1|  PREDICTED: proteasome subunit alpha type-6-like    133   6e-35   Lepisosteus oculatus
ref|XP_005285406.1|  PREDICTED: proteasome subunit alpha type-6 i...    131   6e-35   Chrysemys picta bellii
ref|XP_003440740.1|  PREDICTED: proteasome subunit alpha type-6-like    133   6e-35   Oreochromis niloticus
ref|XP_007660691.1|  PREDICTED: proteasome subunit alpha type-6 i...    131   7e-35   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_008300217.1|  PREDICTED: proteasome subunit alpha type-6         133   7e-35   Stegastes partitus
ref|XP_007253022.1|  PREDICTED: proteasome subunit alpha type-6-l...    133   7e-35   Astyanax mexicanus [blind cave fish]
ref|XP_004698589.1|  PREDICTED: proteasome subunit alpha type-6         133   8e-35   Echinops telfairi [lesser hedgehog tenrec]
dbj|BAE36518.1|  unnamed protein product                                133   8e-35   Mus musculus [mouse]
ref|NP_001086785.1|  proteasome alpha 6 subunit                         133   8e-35   Xenopus laevis [clawed frog]
gb|KFP76959.1|  Proteasome subunit alpha type-6                         132   8e-35   Acanthisitta chloris
ref|XP_008267725.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   9e-35   
ref|NP_001132918.1|  proteasome subunit alpha type-6                    133   9e-35   Ovis aries [domestic sheep]
ref|NP_036098.1|  proteasome subunit alpha type-6                       133   9e-35   Mus musculus [mouse]
ref|XP_004436462.1|  PREDICTED: proteasome subunit alpha type-6 i...    133   9e-35   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|NP_058979.1|  proteasome subunit alpha type-6                       133   9e-35   Rattus norvegicus [brown rat]
gb|EDL36728.1|  proteasome (prosome, macropain) subunit, alpha ty...    133   9e-35   Mus musculus [mouse]
ref|XP_001095366.1|  PREDICTED: proteasome subunit alpha type-6-l...    133   1e-34   
ref|XP_004542308.1|  PREDICTED: proteasome subunit alpha type-6-like    133   1e-34   Maylandia zebra
ref|XP_002824717.1|  PREDICTED: proteasome subunit alpha type-6 i...    132   1e-34   
gb|ACO08806.1|  Proteasome subunit alpha type 6                         132   1e-34   Oncorhynchus mykiss
ref|XP_004649175.1|  PREDICTED: proteasome subunit alpha type-6         132   1e-34   Jaculus jaculus
ref|XP_004093269.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    132   1e-34   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004470220.1|  PREDICTED: proteasome subunit alpha type-6         132   1e-34   Dasypus novemcinctus
gb|ACH70967.1|  proteasome (prosome, macropain) subunit, alpha ty...    132   1e-34   Salmo salar
ref|NP_001002589.1|  proteasome subunit alpha type-6                    132   1e-34   Danio rerio [leopard danio]
gb|ACO08382.1|  Proteasome subunit alpha type 6                         132   1e-34   Oncorhynchus mykiss
gb|ACI69778.1|  Proteasome subunit alpha type-6                         132   1e-34   Salmo salar
gb|ACO51961.1|  Proteasome subunit alpha type-6                         132   1e-34   Rana catesbeiana [bullfrog]
ref|XP_007180773.1|  PREDICTED: proteasome subunit alpha type-6         132   1e-34   Balaenoptera acutorostrata scammoni
ref|XP_004559366.1|  PREDICTED: proteasome subunit alpha type-6-like    132   2e-34   Maylandia zebra
gb|ESA18832.1|  hypothetical protein GLOINDRAFT_344383                  132   2e-34   
ref|XP_003059392.1|  predicted protein                                  132   2e-34   Micromonas pusilla CCMP1545
ref|XP_006117859.1|  PREDICTED: proteasome subunit alpha type-6         132   2e-34   
ref|XP_005965384.1|  PREDICTED: proteasome subunit alpha type-6-l...    133   2e-34   Pantholops hodgsonii [Tibetan antelope]
ref|XP_006172412.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    132   2e-34   Tupaia chinensis
ref|XP_004333676.1|  proteasome subunit alpha type6, putative           132   2e-34   Acanthamoeba castellanii str. Neff
ref|XP_003924255.1|  PREDICTED: proteasome subunit alpha type-6         133   2e-34   Saimiri boliviensis boliviensis
ref|XP_007530301.1|  PREDICTED: proteasome subunit alpha type-6         132   2e-34   Erinaceus europaeus [common hedgehog]
ref|XP_003756477.1|  PREDICTED: proteasome subunit alpha type-6         130   2e-34   
ref|XP_003079656.1|  20S proteasome alpha subunit A1 (ISS)              130   2e-34   
ref|NP_001031340.1|  20S proteasome subunit PAA2                        131   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005865030.1|  PREDICTED: proteasome subunit alpha type-6         132   2e-34   Myotis brandtii
ref|XP_004637142.1|  PREDICTED: proteasome subunit alpha type-6         131   3e-34   Octodon degus
ref|XP_006015430.1|  PREDICTED: proteasome subunit alpha type-6         134   3e-34   
gb|ABM86477.1|  proteasome (prosome, macropain) subunit, alpha ty...    131   3e-34   synthetic construct
ref|XP_005356606.1|  PREDICTED: proteasome subunit alpha type-6-like    131   4e-34   
ref|XP_006985315.1|  PREDICTED: proteasome subunit alpha type-6         131   4e-34   Peromyscus maniculatus bairdii
ref|XP_001418143.1|  predicted protein                                  131   4e-34   Ostreococcus lucimarinus CCE9901
ref|XP_001363110.1|  PREDICTED: proteasome subunit alpha type-6         131   5e-34   Monodelphis domestica
ref|XP_005562133.1|  PREDICTED: proteasome subunit alpha type-6-like    131   5e-34   
gb|ETI45522.1|  hypothetical protein F443_09944                         130   6e-34   Phytophthora parasitica P1569
emb|CDQ90937.1|  unnamed protein product                                130   6e-34   Oncorhynchus mykiss
ref|XP_005285405.1|  PREDICTED: proteasome subunit alpha type-6 i...    130   6e-34   Chrysemys picta bellii
ref|XP_007436765.1|  PREDICTED: proteasome subunit alpha type-6         130   7e-34   Python bivittatus
ref|XP_001640650.1|  predicted protein                                  130   7e-34   Nematostella vectensis
ref|XP_006065991.1|  PREDICTED: proteasome subunit alpha type-6-like    130   7e-34   
ref|XP_004653726.1|  PREDICTED: proteasome subunit alpha type-6-like    130   7e-34   
ref|XP_003471921.1|  PREDICTED: proteasome subunit alpha type-6         130   7e-34   Cavia porcellus [guinea pig]
pdb|4R3O|A  Chain A, Human Constitutive 20s Proteasome                  130   7e-34   Homo sapiens [man]
ref|XP_001511492.1|  PREDICTED: proteasome subunit alpha type-6 i...    130   7e-34   Ornithorhynchus anatinus [duck-billed platypus]
ref|XP_011396415.1|  Proteasome subunit alpha type-6                    129   8e-34   Auxenochlorella protothecoides
gb|ACI66289.1|  Proteasome subunit alpha type-6                         130   8e-34   Salmo salar
ref|XP_002902293.1|  proteasome subunit alpha type-6, putative          130   1e-33   Phytophthora infestans T30-4
ref|XP_010876973.1|  PREDICTED: proteasome subunit alpha type-6         130   1e-33   Esox lucius
ref|XP_005810950.1|  PREDICTED: proteasome subunit alpha type-6-like    130   1e-33   Xiphophorus maculatus
ref|NP_001279159.1|  proteasome (prosome, macropain) subunit, alp...    130   1e-33   Callorhinchus milii [Australian ghost shark]
ref|XP_008396439.1|  PREDICTED: proteasome subunit alpha type-6         130   1e-33   Poecilia reticulata
ref|XP_003216618.1|  PREDICTED: proteasome subunit alpha type-6         130   1e-33   Anolis carolinensis [Carolina anole]
ref|XP_009526410.1|  hypothetical protein PHYSODRAFT_285915             130   1e-33   Phytophthora sojae
ref|NP_001132944.1|  proteasome subunit alpha type-6                    130   1e-33   Sus scrofa [pigs]
emb|CEF98211.1|  Proteasome A-type subunit                              130   1e-33   Ostreococcus tauri
ref|XP_005989234.1|  PREDICTED: proteasome subunit alpha type-6         130   1e-33   Latimeria chalumnae
ref|XP_004083706.1|  PREDICTED: proteasome subunit alpha type-6         130   1e-33   Oryzias latipes [Japanese rice fish]
ref|XP_007569003.1|  PREDICTED: proteasome subunit alpha type-6         129   2e-33   Poecilia formosa
gb|AFK10987.1|  proteasome subunit alpha type-6-like protein            129   2e-33   Callorhinchus milii [Australian ghost shark]
ref|XP_008608969.1|  proteasome subunit alpha type-6                    129   2e-33   Saprolegnia diclina VS20
gb|ACQ58552.1|  Proteasome subunit alpha type-6                         129   2e-33   Anoplopoma fimbria
gb|ACH70968.1|  proteasome (prosome, macropain) subunit, alpha ty...    129   2e-33   Salmo salar
gb|ERE72543.1|  proteasome subunit alpha type-6-like protein            129   2e-33   Cricetulus griseus [Chinese hamsters]
emb|CDQ78135.1|  unnamed protein product                                129   2e-33   Oncorhynchus mykiss
gb|ETE73021.1|  Proteasome subunit alpha type-6                         130   3e-33   Ophiophagus hannah
ref|XP_008282309.1|  PREDICTED: proteasome subunit alpha type-6         129   3e-33   Stegastes partitus
ref|XP_008311014.1|  PREDICTED: proteasome subunit alpha type-6         129   3e-33   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_005798367.1|  PREDICTED: proteasome subunit alpha type-6-like    129   3e-33   Xiphophorus maculatus
ref|XP_005842332.1|  20S proteasome subunit alpha type 6                129   4e-33   Guillardia theta CCMP2712
ref|XP_004349345.1|  proteasome subunit iota                            129   4e-33   Capsaspora owczarzaki ATCC 30864
ref|XP_007576015.1|  PREDICTED: proteasome subunit alpha type-6         129   4e-33   Poecilia formosa
ref|XP_010768970.1|  PREDICTED: proteasome subunit alpha type-6-like    126   5e-33   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009579753.1|  PREDICTED: proteasome subunit alpha type-6 i...    126   6e-33   Fulmarus glacialis
gb|EIE83838.1|  hypothetical protein RO3G_08543                         127   9e-33   Rhizopus delemar RA 99-880
ref|XP_009811688.1|  PREDICTED: proteasome subunit alpha type-6 i...    125   9e-33   Gavia stellata
dbj|GAN03133.1|  proteasome subunit alpha type-6                        127   1e-32   Mucor ambiguus
emb|CEG74212.1|  Putative Proteasome subunit alpha type                 127   1e-32   Rhizopus microsporus
gb|ACM08640.1|  Proteasome subunit alpha type-6                         127   1e-32   Salmo salar
ref|XP_009482321.1|  PREDICTED: proteasome subunit alpha type-6 i...    125   1e-32   Pelecanus crispus
ref|XP_008398058.1|  PREDICTED: proteasome subunit alpha type-6         127   1e-32   Poecilia reticulata
ref|XP_010741287.1|  PREDICTED: proteasome subunit alpha type-6         127   1e-32   
gb|EPB88050.1|  proteasome subunit alpha type-6                         127   2e-32   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003740511.1|  PREDICTED: proteasome subunit alpha type-6-like    126   3e-32   Galendromus occidentalis
ref|XP_005987929.1|  PREDICTED: proteasome subunit alpha type-6-l...    124   4e-32   Latimeria chalumnae
ref|XP_008881328.1|  hypothetical protein H310_15130                    126   4e-32   Aphanomyces invadans
ref|XP_004997606.1|  proteasome subunit alpha type-6                    125   5e-32   Salpingoeca rosetta
gb|EIE87129.1|  hypothetical protein RO3G_11840                         125   8e-32   Rhizopus delemar RA 99-880
ref|XP_010777538.1|  PREDICTED: proteasome subunit alpha type-6         125   8e-32   Notothenia coriiceps [yellowbelly rockcod]
emb|CDQ77351.1|  unnamed protein product                                125   8e-32   
ref|XP_009831249.1|  hypothetical protein H257_07425                    125   9e-32   
emb|CDH55409.1|  proteasome subunit alpha type-6                        125   1e-31   
emb|CDH55408.1|  proteasome subunit alpha type-6                        124   1e-31   
emb|CDS07623.1|  Putative Proteasome subunit alpha type                 124   1e-31   
ref|XP_010896959.1|  PREDICTED: proteasome subunit alpha type-6-l...    122   1e-31   
gb|ACI70015.1|  Proteasome subunit alpha type-6                         124   2e-31   
gb|EKC30164.1|  Proteasome subunit alpha type-6                         122   2e-31   
gb|ACM09335.1|  Proteasome subunit alpha type-6                         124   2e-31   
emb|CEP12966.1|  hypothetical protein                                   124   2e-31   
emb|CCA15401.1|  proteasome subunit alpha type6 putative                124   3e-31   
emb|CCI48184.1|  unnamed protein product                                124   3e-31   
emb|CDQ88726.1|  unnamed protein product                                124   3e-31   
ref|XP_005987928.1|  PREDICTED: proteasome subunit alpha type-6-l...    124   3e-31   
ref|XP_011414019.1|  PREDICTED: proteasome subunit alpha type-6-like    122   4e-31   
ref|XP_002741353.1|  PREDICTED: proteasome subunit alpha type-6-like    123   4e-31   
ref|XP_010896958.1|  PREDICTED: proteasome subunit alpha type-6-l...    122   9e-31   
ref|XP_008171406.1|  PREDICTED: proteasome subunit alpha type-6-l...    120   1e-30   
gb|EHB05850.1|  Proteasome subunit alpha type-6                         122   1e-30   
ref|XP_003730247.1|  PREDICTED: proteasome subunit alpha type-6-like    122   1e-30   
ref|XP_003388491.1|  PREDICTED: proteasome subunit alpha type-6-like    121   2e-30   
gb|EFA79004.1|  proteasome subunit alpha type 6                         121   2e-30   
ref|XP_008543695.1|  PREDICTED: proteasome subunit alpha type-6-like    121   3e-30   
ref|XP_005717620.1|  20S core proteasome subunit alpha 1                121   3e-30   
ref|XP_002113578.1|  hypothetical protein TRIADDRAFT_27191              121   3e-30   
ref|XP_005843942.1|  hypothetical protein CHLNCDRAFT_27583              121   3e-30   
gb|KIY96698.1|  20S proteasome subunit alpha 1                          122   4e-30   
ref|XP_011259025.1|  PREDICTED: proteasome subunit alpha type-6-like    120   4e-30   
ref|XP_002610620.1|  hypothetical protein BRAFLDRAFT_260512             120   4e-30   
ref|XP_005293216.1|  PREDICTED: proteasome subunit alpha type-6-l...    120   6e-30   
ref|XP_011314423.1|  PREDICTED: proteasome subunit alpha type-6-like    120   7e-30   
ref|XP_011329096.1|  PREDICTED: proteasome subunit alpha type-6-like    120   8e-30   
ref|XP_011151114.1|  PREDICTED: proteasome subunit alpha type-6-like    120   9e-30   
gb|KDD75255.1|  proteasome subunit protein                              120   1e-29   
ref|XP_006678757.1|  hypothetical protein BATDEDRAFT_88011              119   1e-29   
ref|XP_006627581.1|  PREDICTED: proteasome subunit alpha type-6-like    120   1e-29   
ref|XP_002411749.1|  proteasome subunit alpha type, putative            119   1e-29   
ref|XP_011054784.1|  PREDICTED: proteasome subunit alpha type-6-like    119   1e-29   
ref|XP_001749972.1|  hypothetical protein                               119   1e-29   
ref|XP_001607854.1|  PREDICTED: proteasome subunit alpha type-6-like    119   2e-29   
ref|XP_002427127.1|  proteasome subunit alpha type, putative            119   2e-29   
ref|XP_009019631.1|  hypothetical protein HELRODRAFT_106545             119   2e-29   
ref|XP_009063626.1|  hypothetical protein LOTGIDRAFT_229407             118   3e-29   
gb|ELU01128.1|  hypothetical protein CAPTEDRAFT_167909                  118   4e-29   
ref|XP_004355990.1|  proteasome subunit alpha type 6                    117   6e-29   
ref|XP_010136411.1|  PREDICTED: proteasome subunit alpha type-6 i...    115   7e-29   
ref|XP_011167410.1|  PREDICTED: proteasome subunit alpha type-6-like    117   7e-29   
ref|XP_007234010.1|  PREDICTED: proteasome subunit alpha type-6-like    117   9e-29   
gb|KFM81155.1|  Proteasome subunit alpha type-6                         117   9e-29   
gb|EFZ13292.1|  hypothetical protein SINV_14495                         117   1e-28   
gb|EFX71218.1|  proteasome subunit alpha type 6-like protein            117   1e-28   
ref|XP_007068323.1|  PREDICTED: proteasome subunit alpha type-6-like    117   1e-28   
ref|XP_006801196.1|  PREDICTED: proteasome subunit alpha type-6-l...    117   1e-28   
ref|NP_001187798.1|  proteasome subunit alpha type-6                    116   2e-28   
ref|XP_011494157.1|  PREDICTED: proteasome subunit alpha type-6-like    116   2e-28   
ref|XP_004075507.1|  PREDICTED: proteasome subunit alpha type-6-like    116   2e-28   
ref|XP_006128209.1|  PREDICTED: proteasome subunit alpha type-6-like    116   3e-28   
ref|XP_001263333.1|  proteasome subunit alpha type                      116   3e-28   
dbj|GAM19752.1|  hypothetical protein SAMD00019534_029270               115   4e-28   
ref|XP_754489.1|  proteasome component Prs2                             115   4e-28   
gb|EDP52622.1|  proteasome component Prs2, putative                     115   4e-28   
ref|XP_003449352.1|  PREDICTED: proteasome subunit alpha type-6-like    115   5e-28   
ref|XP_003286860.1|  proteasome subunit alpha type 6                    115   7e-28   
ref|XP_010282039.1|  PREDICTED: proteasome subunit alpha type-6 i...    112   8e-28   
ref|XP_006608469.1|  PREDICTED: proteasome subunit alpha type-6-like    114   9e-28   
ref|XP_003706429.1|  PREDICTED: proteasome subunit alpha type-6-like    114   9e-28   
ref|XP_007912348.1|  putative proteasome subunit alpha type 6 pro...    114   1e-27   
ref|XP_003697298.1|  PREDICTED: proteasome subunit alpha type-6-like    114   1e-27   
ref|XP_003393493.1|  PREDICTED: proteasome subunit alpha type-6-like    114   1e-27   
gb|EKV05944.1|  hypothetical protein PDIG_81410                         111   2e-27   
ref|XP_008993532.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    114   2e-27   
dbj|BAM18567.1|  proteasome alpha1 subunit                              114   2e-27   
ref|XP_005099053.1|  PREDICTED: proteasome subunit alpha type-6-like    114   2e-27   
gb|ELW50106.1|  Proteasome subunit alpha type-6                         111   2e-27   
ref|XP_009222727.1|  proteasome subunit alpha type-6                    113   2e-27   
ref|XP_010153544.1|  PREDICTED: proteasome subunit alpha type-6 i...    113   3e-27   
gb|KFU86810.1|  Proteasome subunit alpha type-6                         112   3e-27   
gb|KFP22449.1|  Proteasome subunit alpha type-6                         112   3e-27   
ref|XP_002366759.1|  proteasome subunit alpha type 6, putative          113   4e-27   
ref|XP_007513369.1|  predicted protein                                  112   5e-27   
gb|EFX02870.1|  proteasome subunit alpha type 6                         112   6e-27   
ref|XP_008884434.1|  proteasome subunit alpha1, putative                112   6e-27   
gb|KFW08632.1|  Proteasome subunit alpha type-6                         112   7e-27   
ref|XP_011112230.1|  hypothetical protein H072_6434                     108   7e-27   
ref|XP_668697.1|  20S proteasome alpha subunit A                        108   7e-27   
gb|ADO27866.1|  proteasome subunit alpha type-6                         112   8e-27   
ref|XP_007926644.1|  hypothetical protein MYCFIDRAFT_188442             112   8e-27   
gb|EME46261.1|  hypothetical protein DOTSEDRAFT_70305                   112   9e-27   
ref|XP_001436316.1|  hypothetical protein                               112   9e-27   
ref|XP_318387.2|  AGAP003935-PA                                         112   1e-26   
ref|XP_007253021.1|  PREDICTED: proteasome subunit alpha type-6-l...    112   1e-26   
ref|XP_001843247.1|  proteasome subunit alpha type 6                    112   1e-26   
gb|KFB46736.1|  AGAP003935-PA-like protein                              111   1e-26   
ref|XP_006571193.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    110   1e-26   
ref|XP_009209664.1|  PREDICTED: proteasome subunit alpha type-6 i...    110   1e-26   
ref|XP_003323788.2|  proteasome subunit alpha type-6                    111   1e-26   
gb|EOB05002.1|  Proteasome subunit alpha type-6                         110   2e-26   
gb|EQL00512.1|  proteasome subunit alpha type 6                         111   2e-26   
ref|XP_003138597.1|  proteasome subunit alpha type 6                    112   2e-26   
ref|XP_006696698.1|  hypothetical protein CTHT_0063920                  111   2e-26   
dbj|GAM85636.1|  hypothetical protein ANO11243_036430                   111   2e-26   
gb|ETN58251.1|  proteasome subunit alpha type 6                         111   2e-26   
ref|XP_007800866.1|  hypothetical protein EPUS_04061                    109   2e-26   
ref|XP_003717769.1|  proteasome subunit alpha type-6                    111   2e-26   
ref|XP_005703510.1|  20S proteasome subunit alpha 1                     111   2e-26   
ref|XP_007680618.1|  hypothetical protein BAUCODRAFT_126149             112   2e-26   
gb|ACO15186.1|  Proteasome subunit alpha type-6                         110   2e-26   
emb|CEJ93046.1|  Putative Proteasome subunit alpha type                 110   3e-26   
gb|EHJ78841.1|  proteasome subunit alpha type 6-A                       110   3e-26   
ref|XP_008307633.1|  PREDICTED: proteasome subunit alpha type-6-like    110   3e-26   
ref|XP_009209663.1|  PREDICTED: proteasome subunit alpha type-6 i...    110   3e-26   
gb|EPY79770.1|  Proteasome subunit alpha type 6 isoform 5-like pr...    111   3e-26   
ref|XP_001892613.1|  proteasome subunit alpha type 6                    110   3e-26   
ref|XP_007796832.1|  putative proteasome subunit alpha type 6 pro...    110   3e-26   
gb|KEZ38816.1|  hypothetical protein SAPIO_CDS10856                     110   4e-26   
gb|ACO12469.1|  Proteasome subunit alpha type-6                         110   4e-26   
emb|CBN08618.1|  proteasome (prosome, macropain) subunit, alpha t...    110   4e-26   
ref|XP_001796064.1|  hypothetical protein SNOG_05667                    110   4e-26   
emb|CDM30570.1|  Probable proteasome subunit alpha type-6               110   4e-26   
ref|XP_007688022.1|  hypothetical protein COCMIDRAFT_5367               110   4e-26   
gb|AGM32386.1|  proteasome subunit alpha type-6                         110   4e-26   
emb|CCX08004.1|  Similar to Probable proteasome subunit alpha typ...    110   5e-26   
ref|XP_002559377.1|  Pc13g09540                                         110   5e-26   
gb|KGO36960.1|  Proteasome A-type subunit                               110   5e-26   
ref|XP_001271130.1|  predicted protein                                  110   5e-26   
ref|XP_008024763.1|  hypothetical protein SETTUDRAFT_168966             108   6e-26   
ref|NP_001040459.1|  proteasome subunit alpha type 6-A                  109   6e-26   
gb|KGO72988.1|  Proteasome A-type subunit                               110   6e-26   
emb|CCF38339.1|  proteasome A-type and B-type                           109   7e-26   
gb|KDN66300.1|  putative proteasome A-type and B-type                   109   7e-26   
gb|KFA67907.1|  hypothetical protein S40285_04100                       109   8e-26   
ref|XP_002089534.1|  Prosalpha6                                         109   8e-26   
gb|EHK40697.1|  hypothetical protein TRIATDRAFT_301498                  109   9e-26   
ref|XP_008599361.1|  proteasome A-type and B-type                       109   9e-26   
gb|EWM25954.1|  proteasome subunit alpha type-6                         109   9e-26   
ref|XP_005856031.1|  20S proteasome subunit alpha 1                     109   1e-25   
gb|KFY37296.1|  hypothetical protein V495_07258                         109   1e-25   
gb|KEY66092.1|  hypothetical protein S7711_09211                        109   1e-25   
gb|KFA73659.1|  hypothetical protein S40288_07644                       109   1e-25   
gb|KGQ11560.1|  Proteasome subunit alpha type-6                         109   1e-25   
gb|EFQ28985.1|  proteasome A-type and B-type                            109   1e-25   
gb|KIW43338.1|  hypothetical protein PV06_04450                         108   1e-25   
ref|XP_642003.1|  proteasome subunit alpha type 6                       108   1e-25   
ref|XP_001654091.1|  AAEL009898-PA                                      108   1e-25   
ref|XP_002777858.1|  proteasome subunit alpha1, putative                108   2e-25   
gb|EHK16557.1|  hypothetical protein TRIVIDRAFT_75344                   108   2e-25   
tpe|CBF76587.1|  TPA: proteasome core alpha 1 component (Eurofung)      108   2e-25   
ref|XP_662473.1|  hypothetical protein AN4869.2                         108   2e-25   
ref|XP_007601883.1|  proteasome A-type and B-type                       108   2e-25   
ref|XP_011120711.1|  hypothetical protein AOL_s00075g98                 108   2e-25   
gb|AFK41141.1|  unknown                                                 103   2e-25   
gb|EWZ90275.1|  20S proteasome subunit alpha 1                          107   3e-25   
gb|KHN94324.1|  proteasome subunit alpha type 6                         108   3e-25   
ref|XP_005656349.1|  PREDICTED: proteasome subunit alpha type-6 i...    107   3e-25   
ref|XP_002143952.1|  proteasome component Prs2, putative                108   3e-25   
ref|XP_007295783.1|  proteasome subunit alpha type 6                    108   3e-25   
gb|EMF14550.1|  N-terminal nucleophile aminohydrolase                   108   3e-25   
gb|EKG12338.1|  Proteasome alpha-subunit conserved site                 108   3e-25   
ref|XP_006963196.1|  proteasome subunit alpha 6                         107   4e-25   
gb|KHN76026.1|  Proteasome subunit alpha type-6                         107   4e-25   
ref|XP_006665767.1|  proteasome subunit alpha type 6                    107   4e-25   
ref|XP_003303796.1|  hypothetical protein PTT_16156                     107   4e-25   
gb|KFX91072.1|  hypothetical protein V490_06088                         107   4e-25   
ref|NP_724614.1|  proteasome alpha1 subunit, isoform A                  107   4e-25   
gb|ERS99418.1|  hypothetical protein HMPREF1624_04618                   107   4e-25   
gb|KEF52629.1|  proteasome subunit alpha type-6                         105   5e-25   
gb|KIX01010.1|  hypothetical protein Z518_10076                         107   5e-25   
ref|XP_005762775.1|  hypothetical protein EMIHUDRAFT_446206             107   5e-25   
gb|AAD33944.1|AF144749_1  20S proteasome subunit alpha1                 107   5e-25   
gb|ABI13160.1|  putative proteasome alpha subunit                       107   5e-25   
gb|EWY90454.1|  20S proteasome subunit alpha 1                          107   5e-25   
gb|EWG40643.1|  20S proteasome subunit alpha 1                          107   5e-25   
ref|XP_003024134.1|  hypothetical protein TRV_01692                     107   5e-25   
ref|XP_003051118.1|  predicted protein                                  107   5e-25   
ref|XP_001931683.1|  proteasome subunit alpha type-6                    107   6e-25   
ref|XP_003015989.1|  hypothetical protein ARB_05386                     107   6e-25   
gb|KIL96483.1|  hypothetical protein FAVG1_01227                        107   6e-25   
emb|CAG06433.1|  unnamed protein product                                107   6e-25   
dbj|GAD99016.1|  predicted protein                                      108   6e-25   
emb|CCG84721.1|  protein of unknown function                            107   7e-25   
gb|KIV82702.1|  hypothetical protein PV11_04792                         107   7e-25   
emb|CCE29503.1|  probable SCL1-20S proteasome subunit YC7ALPHA/Y8...    107   7e-25   
gb|KFY28594.1|  hypothetical protein V493_02857                         107   8e-25   
ref|XP_011319207.1|  proteasome component C7-alpha                      107   8e-25   
gb|EGU87091.1|  hypothetical protein FOXB_02485                         107   8e-25   
emb|CEF75633.1|  unnamed protein product                                107   9e-25   
ref|XP_003177216.1|  proteasome subunit alpha type-6                    107   9e-25   
ref|XP_001960978.1|  GF11235                                            106   9e-25   
gb|EZF34225.1|  hypothetical protein H101_02239                         107   9e-25   
ref|XP_001361000.1|  GA15805                                            106   9e-25   
gb|ELR02822.1|  20S proteasome subunit alpha 1                          107   9e-25   
gb|KDB22734.1|  hypothetical protein H109_05356                         107   9e-25   
ref|XP_002841029.1|  hypothetical protein                               106   9e-25   
emb|CCJ29574.1|  unnamed protein product                                106   9e-25   
ref|XP_009255010.1|  hypothetical protein FPSE_03616                    106   1e-24   
ref|XP_004535732.1|  PREDICTED: proteasome subunit alpha type-6-l...    106   1e-24   
ref|XP_007281496.1|  proteasome subunit alpha type 6                    106   1e-24   
ref|XP_003857582.1|  proteasome core particle subunit alpha 1           106   1e-24   
gb|AFW89473.1|  hypothetical protein ZEAMMB73_334376                    105   1e-24   
ref|XP_002159995.1|  PREDICTED: proteasome subunit alpha type-6-like    106   1e-24   
gb|KDB16148.1|  proteasome subunit alpha type 6                         106   1e-24   
ref|XP_007756206.1|  proteasome subunit alpha type-6                    106   1e-24   
ref|XP_003844849.1|  similar to proteasome subunit alpha type-6         106   1e-24   
gb|KFY66093.1|  hypothetical protein V496_02185                         106   1e-24   
gb|EPZ36213.1|  Proteasome, subunit alpha/beta domain-containing ...    108   1e-24   
gb|KHJ35771.1|  putative proteasome subunit alpha type 6                106   1e-24   
gb|EZG02619.1|  hypothetical protein H106_07457                         106   1e-24   
gb|ENH81729.1|  proteasome subunit alpha type 6                         106   1e-24   
ref|XP_002004197.1|  GI19734                                            106   1e-24   
ref|XP_001970565.1|  GG10705                                            106   1e-24   
emb|CDJ67279.1|  proteasome subunit alpha type 6, putative              107   2e-24   
gb|KIY02732.1|  proteasome subunit alpha type-6                         106   2e-24   
ref|XP_007873808.1|  hypothetical protein PNEG_01835                    106   2e-24   
gb|EQB51932.1|  proteasome A-type and B-type                            106   2e-24   
ref|XP_001819832.1|  proteasome subunit alpha type-6                    106   2e-24   
gb|KIW74909.1|  hypothetical protein Z517_11680                         106   2e-24   
gb|KFY99093.1|  hypothetical protein V500_01465                         106   2e-24   
ref|XP_007719836.1|  proteasome subunit alpha type-6                    106   2e-24   
gb|KFY13879.1|  hypothetical protein V492_03002                         105   2e-24   
gb|KFH45227.1|  Proteasome subunit alpha-like protein                   105   2e-24   
ref|XP_001548586.1|  conserved hypothetical protein                     105   2e-24   



>ref|XP_009380029.1| PREDICTED: proteasome subunit alpha type-6 [Musa acuminata subsp. 
malaccensis]
Length=246

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR +DP+FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRNDDPAFRVLSTEEIDEHLTAISERD  246



>ref|XP_010274570.1| PREDICTED: proteasome subunit alpha type-6 [Nelumbo nucifera]
Length=246

 Score =   193 bits (491),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEENGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+E+P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKENPVFRVLSTEEIDEHLTAISERD  246



>ref|XP_009631638.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana tomentosiformis]
Length=246

 Score =   192 bits (487),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVV++EDP FRVL+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKASEIEVGVVKKEDPVFRVLTTEEIDEHLTAISERD  246



>ref|XP_006842706.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
 gb|ERN04381.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
Length=246

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQT ISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTTISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+E+P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRRENPVFRVLSTEEIDEHLTAISERD  246



>ref|XP_009797939.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana sylvestris]
 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Nicotiana tabacum]
 emb|CAB39975.1| PRCI [Nicotiana tabacum]
Length=246

 Score =   191 bits (486),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVV++EDP FRVL+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKASEIEVGVVKKEDPIFRVLTTEEIDEHLTAISERD  246



>ref|XP_011098408.1| PREDICTED: proteasome subunit alpha type-6 [Sesamum indicum]
Length=246

 Score =   191 bits (485),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVVR++DP F+VLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKASEIEVGVVRKDDPVFKVLSTEEIDEHLTAISERD  246



>emb|CDP03072.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   191 bits (484),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG K+QEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  143  GIDEEAGPQLFKCDPAGHFFGHKATSAGAKDQEAINFLEKKMKNDPAFSYEETVQTAISA  202

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+E+P FRVLST EIDEHLTAISERD
Sbjct  203  LQSVLQEDFKANEIEVGVVRKENPIFRVLSTEEIDEHLTAISERD  247



>gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea]
Length=246

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG K+QEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGSKDQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVVR+EDP F+VLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKASEIEVGVVRKEDPVFKVLSTEEIDEHLTAISERD  246



>gb|EYU19318.1| hypothetical protein MIMGU_mgv1a012555mg [Erythranthe guttata]
Length=246

 Score =   190 bits (483),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG KEQEA+NFLEKKMKND AFSY++TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAVNFLEKKMKNDPAFSYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVVR+EDP F+VLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKASEIEVGVVRKEDPVFKVLSTDEIDEHLTAISERD  246



>ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6 [Solanum lycopersicum]
 ref|XP_006345264.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum tuberosum]
Length=246

 Score =   190 bits (483),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG KEQEAINFLEKKMKN+ AFSYE+TVQT ISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGSKEQEAINFLEKKMKNNPAFSYEETVQTTISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVVR+EDP FRVL+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKASEIEVGVVRKEDPVFRVLTTEEIDEHLTAISERD  246



>ref|XP_010937324.1| PREDICTED: proteasome subunit alpha type-6 [Elaeis guineensis]
Length=246

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA S+G+KEQEAINFLEKKMKND  FSYE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSSGLKEQEAINFLEKKMKNDPKFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR +DP FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTDDPVFRVLSTEEIDEHLTAISERD  246



>ref|XP_010269878.1| PREDICTED: proteasome subunit alpha type-6-like [Nelumbo nucifera]
Length=246

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA S G+KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEENGPQLFKCDPAGHFFGHKATSVGLKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+E+P FRVL T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKENPVFRVLPTEEIDEHLTAISERD  246



>ref|XP_011099933.1| PREDICTED: proteasome subunit alpha type-6-like [Sesamum indicum]
Length=246

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG KEQEAINFLEKKMKND AFS+++TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGGKEQEAINFLEKKMKNDPAFSFDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVVR+EDP F+VLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKASEIEVGVVRKEDPVFKVLSTEEIDEHLTAISERD  246



>ref|XP_009404175.1| PREDICTED: proteasome subunit alpha type-6-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   189 bits (480),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQ AISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDTVFRVLSTEEIDEHLTAISERD  246



>ref|XP_008782714.1| PREDICTED: proteasome subunit alpha type-6 [Phoenix dactylifera]
Length=246

 Score =   188 bits (478),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+ +DP FR LST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVKTDDPVFRGLSTEEIDEHLTAISERD  246



>ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   187 bits (475),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GP+L+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTENPVFRVLSTEEIDEHLTAISERD  246



>ref|XP_002516258.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF46260.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   187 bits (475),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDRAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR +D  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADDRVFRVLSTEEIDEHLTAISERD  246



>gb|KJB65226.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=246

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+ ++P+FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVKADNPAFRVLSTEEIDEHLTAISERD  246



>gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum]
Length=246

 Score =   186 bits (473),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+ ++P+FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVKADNPAFRVLSTEEIDEHLTAISERD  246



>ref|XP_008802476.1| PREDICTED: proteasome subunit alpha type-6-like [Phoenix dactylifera]
Length=246

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHFFGHKA SAGVKEQEAINFLEKKMKND  F YE+TVQTAISA
Sbjct  142  GIDEEKGPQLFKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPKFLYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSV+QEDFKA+EIE+GVVR ED  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVIQEDFKATEIEVGVVRTEDSVFRVLSTEEIDEHLTAISERD  246



>ref|XP_006474717.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Citrus 
sinensis]
 gb|KDO73882.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=244

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQTA+SA
Sbjct  140  GIDEEKGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTAVSA  199

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR +D  FRVLS+ EIDEHLTAISERD
Sbjct  200  LQSVLQEDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLTAISERD  244



>ref|XP_010939895.1| PREDICTED: proteasome subunit alpha type-6-like [Elaeis guineensis]
Length=246

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL KCDPAGHFFGHKA SAGVKEQEAINFLEKKMKND  FSY +TVQTAISA
Sbjct  142  GIDEEKGPQLLKCDPAGHFFGHKATSAGVKEQEAINFLEKKMKNDPKFSYGETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSV+QEDFKA+EIE+GVVR +DP FRVLST EIDEHLTAISERD
Sbjct  202  LQSVIQEDFKATEIEVGVVRTKDPVFRVLSTEEIDEHLTAISERD  246



>ref|XP_010111992.1| Proteasome subunit alpha type-6 [Morus notabilis]
 gb|EXC32303.1| Proteasome subunit alpha type-6 [Morus notabilis]
Length=299

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GP+L+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  195  GIDDEFGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTYEETVQTAISA  254

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVRQ++P FRVLST EIDEHLTAISERD
Sbjct  255  LQSVLQEDFKANEIEVGVVRQDNPVFRVLSTEEIDEHLTAISERD  299



>gb|KHG01950.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=246

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+  +P+FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVKANNPAFRVLSTEEIDEHLTAISERD  246



>ref|XP_008462289.1| PREDICTED: proteasome subunit alpha type-6 [Cucumis melo]
Length=246

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GP+L+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDDEYGPRLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FRVL+T E+DEHLTAISERD
Sbjct  202  LQSVLQEDFKANEIEVGVVRSENPIFRVLTTEEVDEHLTAISERD  246



>ref|XP_006592586.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max]
 gb|KHN16010.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=246

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMKND +F+YE+TVQTAISA
Sbjct  142  GIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKNDPSFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+E+P FRVL+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKENPEFRVLTTEEIDEHLTAISERD  246



>ref|XP_006474716.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Citrus 
sinensis]
 gb|KDO73881.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=246

 Score =   186 bits (472),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQTA+SA
Sbjct  142  GIDEEKGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTAVSA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR +D  FRVLS+ EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLTAISERD  246



>ref|XP_008342576.1| PREDICTED: proteasome subunit alpha type-6-like [Malus domestica]
Length=116

 Score =   181 bits (460),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKN+ +FSY++TVQT ISA
Sbjct  12   GIDEELGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNEPSFSYDETVQTCISA  71

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLTAISERD
Sbjct  72   LQSVLQEDFKATEIEVGVVVKENPVFRVLSTEEIDEHLTAISERD  116



>ref|XP_004303706.1| PREDICTED: proteasome subunit alpha type-6 [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   185 bits (470),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKND +F+Y++TVQTAISA
Sbjct  142  GVDEETGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNDPSFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV  E+P+FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVSMENPAFRVLSTEEIDEHLTAISERD  246



>ref|XP_010064020.1| PREDICTED: proteasome subunit alpha type-6 [Eucalyptus grandis]
 gb|KCW71315.1| hypothetical protein EUGRSUZ_F04398 [Eucalyptus grandis]
Length=246

 Score =   185 bits (470),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP+L+KCDPAGHFFGHKA SAG KEQEAINFLEKKMKND AFSY++TVQTAISA
Sbjct  142  GIDEEFGPRLYKCDPAGHFFGHKATSAGSKEQEAINFLEKKMKNDPAFSYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKANEIEVGVVRSDNPVFRVLSTEEIDEHLTAISERD  246



>ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 [Vitis vinifera]
 emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera]
 emb|CBI35851.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   185 bits (469),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSY++TVQTAISA
Sbjct  142  GIDDENGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFK +EIE+GVVR + P+FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKPNEIEVGVVRTDSPAFRVLSTEEIDEHLTAISERD  246



>ref|XP_007012615.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
 gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
Length=246

 Score =   185 bits (469),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+ ++P FR LST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVKADNPVFRALSTAEIDEHLTAISERD  246



>ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max]
 sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1; AltName: Full=Proteasome iota subunit [Glycine 
max]
 gb|AAC28135.1| proteasome IOTA subunit [Glycine max]
Length=246

 Score =   185 bits (469),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMKND +F+YE+TVQTAISA
Sbjct  142  GIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKNDPSFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+++P FRVL+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKDNPEFRVLTTDEIDEHLTAISERD  246



>gb|KJB82988.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=244

 Score =   184 bits (468),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  140  GIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAISA  199

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+ ++P FRV+ST EIDEHLTAISERD
Sbjct  200  LQSVLQEDFKATEIEVGVVKADNPVFRVMSTEEIDEHLTAISERD  244



>gb|KJB82986.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=246

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG KEQEAINFLEKKMKND AF+YE+TVQTAISA
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+ ++P FRV+ST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVKADNPVFRVMSTEEIDEHLTAISERD  246



>ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 gb|KGN45477.1| hypothetical protein Csa_7G448880 [Cucumis sativus]
Length=246

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF+Y++TVQTAISA
Sbjct  142  GIDDEYGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FRVL+T E+DEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRSDNPIFRVLTTEEVDEHLTAISERD  246



>ref|XP_006381605.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
 ref|XP_011039970.1| PREDICTED: proteasome subunit alpha type-6 [Populus euphratica]
 gb|ERP59402.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
Length=246

 Score =   184 bits (468),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND A SYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPALSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTDNLVFRVLSTEEIDEHLTAISERD  246



>gb|ABK95322.1| unknown [Populus trichocarpa]
Length=246

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMKND A SYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLEKKMKNDPALSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTGDCVFRVLSTEEIDEHLTAISERD  246



>ref|XP_011001657.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
 ref|XP_011015647.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMKND A SYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLEKKMKNDPALSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTGDHVFRVLSTEEIDEHLTAISERD  246



>ref|XP_002323091.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|ABK93034.1| unknown [Populus trichocarpa]
 gb|EEF04852.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMKND A SYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLEKKMKNDPALSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTGDCVFRVLSTEEIDEHLTAISERD  246



>ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Cicer 
arietinum]
 ref|XP_004488481.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Cicer 
arietinum]
 ref|XP_004488482.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Cicer 
arietinum]
Length=246

 Score =   184 bits (466),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH++GHKA SAG+K+QEAINFLEKKMKND +F+YE+TVQTAISA
Sbjct  142  GIDDENGPQLYKCDPAGHYYGHKATSAGLKDQEAINFLEKKMKNDPSFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV++++P+FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVQKDNPAFRVLSTEEIDEHLTAISERD  246



>ref|XP_007133143.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
 gb|ESW05137.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
Length=246

 Score =   183 bits (465),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMK D AF+YE+TVQTAISA
Sbjct  142  GIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKGDPAFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+++P FRVL+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKDNPEFRVLTTEEIDEHLTAISERD  246



>gb|KDP45827.1| hypothetical protein JCGZ_17434 [Jatropha curcas]
Length=246

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQS+LQEDFKA+EIE+GVVR +   FRVL T EIDEHLTAISERD
Sbjct  202  LQSILQEDFKATEIEVGVVRADSRVFRVLPTEEIDEHLTAISERD  246



>gb|KDP33929.1| hypothetical protein JCGZ_07500 [Jatropha curcas]
Length=246

 Score =   183 bits (464),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHFYGHKATSAGLKEQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQS+LQEDFKA+EIE+GVVR ++  FRVL T EIDEHLTAISERD
Sbjct  202  LQSILQEDFKATEIEVGVVRADNRVFRVLPTEEIDEHLTAISERD  246



>ref|XP_007215872.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
 gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
Length=246

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKND  F+Y++TVQTAISA
Sbjct  142  GIDEEFGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNDPLFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKANEIEVGVVVKENPVFRVLSTDEIDEHLTAISERD  246



>ref|XP_008228175.1| PREDICTED: proteasome subunit alpha type-6 [Prunus mume]
Length=246

 Score =   182 bits (463),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKND  F+Y++TVQTAISA
Sbjct  142  GIDEEFGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNDPLFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKANEIEVGVVVKENPVFRVLSTEEIDEHLTAISERD  246



>gb|ACN66752.1| PAA1 [Carica papaya]
Length=246

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAG F+GHKA SAG K+QEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEEEGPQLFKCDPAGFFYGHKATSAGSKDQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P F VLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTENPVFHVLSTEEIDEHLTAISERD  246



>ref|XP_002308263.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|EEE91786.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKND + SYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNDPSLSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTGDRIFRVLSTEEIDEHLTAISERD  246



>gb|ADJ95344.1| PAA1 [Carica papaya]
Length=246

 Score =   182 bits (463),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAG F+GHKA SAG K+QEAINFLEKKMKND AFSYE+TVQTAISA
Sbjct  142  GIDEEEGPQLFKCDPAGFFYGHKATSAGSKDQEAINFLEKKMKNDPAFSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P F VLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTENPVFHVLSTEEIDEHLTAISERD  246



>ref|XP_011018964.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKND + SYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNDPSLSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR  D  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRTGDRIFRVLSTEEIDEHLTAISERD  246



>gb|AFK47610.1| unknown [Lotus japonicus]
Length=246

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E G QL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMKND +F+YE+TVQTAISA
Sbjct  142  GIDDENGAQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKNDPSFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+++P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKDNPEFRVLSTDEIDEHLTAISERD  246



>gb|KDO64985.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=164

 Score =   179 bits (455),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
             I EE GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF++++TVQTAIS 
Sbjct  60   SIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAIST  119

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  120  LQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  164



>ref|XP_006426693.1| hypothetical protein CICLE_v100263522mg, partial [Citrus clementina]
 gb|ESR39933.1| hypothetical protein CICLE_v100263522mg, partial [Citrus clementina]
Length=161

 Score =   179 bits (454),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
             I EE GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF++++TVQTAIS 
Sbjct  57   SIDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAIST  116

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  117  LQSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  161



>gb|AFK46380.1| unknown [Lotus japonicus]
Length=246

 Score =   182 bits (462),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E G QL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMKND +F+YE+TVQTAISA
Sbjct  142  GIDDENGAQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKNDPSFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+++P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKDNPEFRVLSTDEIDEHLTAISERD  246



>gb|KJB65225.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=247

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHK-AXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAIS  328
            GI EE GPQL+KCDPAGHF+GHK A SAG KEQEAINFLEKKMKND AF+YE+TVQTAIS
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKVATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAIS  201

Query  327  ALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            ALQSVLQEDFKA+EIE+GVV+ ++P+FRVLST EIDEHLTAISERD
Sbjct  202  ALQSVLQEDFKATEIEVGVVKADNPAFRVLSTEEIDEHLTAISERD  247



>gb|ACU24622.1| unknown [Glycine max]
Length=246

 Score =   182 bits (461),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E G QL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMKND +F+YE+TVQTAISA
Sbjct  142  GIDDEYGLQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKNDPSFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+E+P FRVL+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKENPEFRVLTTEEIDEHLTAISERD  246



>ref|XP_008391412.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=246

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKN+ +FSY++TVQT ISA
Sbjct  142  GIDEEVGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNEPSFSYDETVQTCISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVVKENPVFRVLSTEEIDEHLTAISERD  246



>ref|XP_009344472.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
 ref|XP_009344473.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
Length=246

 Score =   181 bits (460),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGH+FGHKA SAG+KEQEAINFLEKKMKN+ +FSY++TVQT ISA
Sbjct  142  GIDEELGPQLYKCDPAGHYFGHKATSAGLKEQEAINFLEKKMKNEPSFSYDETVQTCISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV +E+P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVVKENPVFRVLSTEEIDEHLTAISERD  246



>gb|ACJ85916.1| unknown [Medicago truncatula]
 gb|AFK46669.1| unknown [Medicago truncatula]
 gb|KEH19590.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
Length=246

 Score =   181 bits (460),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMKND +F+Y +TVQTAISA
Sbjct  142  GIDDELGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKNDPSFTYAETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV++++P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVQKDNPEFRVLSTDEIDEHLTAISERD  246



>gb|KDO64983.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64984.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=191

 Score =   179 bits (455),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            I EE GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF++++TVQTAIS L
Sbjct  88   IDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTL  147

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            QSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  148  QSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  191



>gb|KDO64982.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=225

 Score =   180 bits (456),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            I EE GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF++++TVQTAIS L
Sbjct  122  IDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTL  181

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            QSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  182  QSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  225



>gb|KJB82987.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=247

 Score =   180 bits (456),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 97/106 (92%), Gaps = 1/106 (1%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHK-AXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAIS  328
            GI EE GPQL+KCDPAGHF+GHK A SAG KEQEAINFLEKKMKND AF+YE+TVQTAIS
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKVATSAGSKEQEAINFLEKKMKNDPAFTYEETVQTAIS  201

Query  327  ALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            ALQSVLQEDFKA+EIE+GVV+ ++P FRV+ST EIDEHLTAISERD
Sbjct  202  ALQSVLQEDFKATEIEVGVVKADNPVFRVMSTEEIDEHLTAISERD  247



>gb|KDO64977.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=241

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            I EE GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF++++TVQTAIS L
Sbjct  138  IDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTL  197

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            QSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  198  QSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  241



>ref|XP_006465892.1| PREDICTED: proteasome subunit alpha type-6-like [Citrus sinensis]
 gb|KDO64976.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=246

 Score =   179 bits (454),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            I EE GP+LFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND AF++++TVQTAIS L
Sbjct  143  IDEECGPRLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPAFTFQETVQTAISTL  202

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            QSVLQEDFKASEIE+GVV +E+P FRVLS  EIDEHLTAISERD
Sbjct  203  QSVLQEDFKASEIEVGVVSKENPEFRVLSIEEIDEHLTAISERD  246



>gb|ABK96399.1| unknown [Populus trichocarpa x Populus deltoides]
Length=246

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+K DPAGHFFGHKA SAG+KEQEAINFLEKKMKND A SYE+TVQTAISA
Sbjct  142  GIDEENGPQLYKSDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPALSYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQE+FKA+EIE+GVVR ++  FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQENFKATEIEVGVVRTDNLVFRVLSTEEIDEHLTAISERD  246



>ref|XP_003595788.1| Proteasome subunit alpha type [Medicago truncatula]
 gb|AES66039.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
 gb|AFK48993.1| unknown [Medicago truncatula]
Length=246

 Score =   179 bits (453),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG K+QEAINFLEKKMKND +F+Y++TVQTAI+A
Sbjct  142  GIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLEKKMKNDPSFTYDETVQTAIAA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+++ P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVQKDKPEFRVLSTEEIDEHLTAISERD  246



>ref|XP_006452821.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
 gb|ESR66061.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
Length=235

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = -3

Query  486  GPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISALQSVLQ  307
            GPQL+KCDPAGHFFGHKA SAG+KEQEAINFLEKKMKND  FSYE+TVQTA+SALQSVLQ
Sbjct  137  GPQLYKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKNDPTFSYEETVQTAVSALQSVLQ  196

Query  306  EDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            EDFKA+EIE+GVVR +D  FRVLS+ EIDEHLTAISERD
Sbjct  197  EDFKATEIEVGVVRSDDRVFRVLSSEEIDEHLTAISERD  235



>ref|XP_010666851.1| PREDICTED: proteasome subunit alpha type-6 [Beta vulgaris subsp. 
vulgaris]
Length=246

 Score =   177 bits (450),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP LFKCDPAGHF+GHKA SAG K+QEAINFLEKKMKND AFSY++TVQTAISA
Sbjct  142  GIDEERGPLLFKCDPAGHFYGHKATSAGAKDQEAINFLEKKMKNDPAFSYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+  +P+FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVQVGNPAFRGLTTEEIDEHLTAISERD  246



>gb|KFK32243.1| hypothetical protein AALP_AA6G216400 [Arabis alpina]
Length=246

 Score =   177 bits (450),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPVFRALTTEEIDEHLTAISERD  246



>ref|XP_010557672.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
 ref|XP_010557673.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   177 bits (449),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA SAGVKEQEAINFLEKKMK++  F+Y +TVQTAISA
Sbjct  142  GIDEEKGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLEKKMKDNPTFTYNETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR + P+FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADSPAFRALTTEEIDEHLTAISERD  246



>gb|ACJ85912.1| unknown [Medicago truncatula]
Length=246

 Score =   177 bits (449),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG K+QEAINFLEKKMKND +F+Y++TVQTAI+A
Sbjct  142  GIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLEKKMKNDPSFTYDETVQTAIAA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+++ P FRVLST EIDEHLTAI ERD
Sbjct  202  LQSVLQEDFKATEIEVGVVQKDKPEFRVLSTEEIDEHLTAIGERD  246



>gb|AFK46801.1| unknown [Medicago truncatula]
Length=246

 Score =   177 bits (448),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG K+QEAINFLEKKMKND +F+Y++TVQTAI+A
Sbjct  142  GIDDENGPQLYKCDPAGHYFGHKATSAGSKDQEAINFLEKKMKNDPSFTYDETVQTAIAA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSV QEDFKA+EIE+GVV+++ P FRVLST EIDEHLTAISERD
Sbjct  202  LQSVFQEDFKATEIEVGVVQKDKPEFRVLSTEEIDEHLTAISERD  246



>ref|NP_178641.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 ref|XP_002883713.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O81147.1|PSA6B_ARATH RecName: Full=Proteasome subunit alpha type-6-B; AltName: Full=20S 
proteasome subunit alpha A-2; AltName: Full=Proteasome 
subunit alpha type-1 [Arabidopsis thaliana]
 gb|AAC32055.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AAC95161.1| 20S proteasome alpha subunit A2 (PAA2) [Arabidopsis thaliana]
 gb|AAK96583.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|AAN28768.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|EFH59972.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC05979.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=246

 Score =   176 bits (447),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR +DP FR L T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADDPLFRSLRTEEIDEHLTAISERD  246



>ref|XP_010533014.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   175 bits (444),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA S G+KEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEEKGPLLYKCDPAGHFYGHKATSVGMKEQEAINFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADNPVFRALTTEEIDEHLTAISERD  246



>ref|XP_010450390.1| PREDICTED: proteasome subunit alpha type-6-A [Camelina sativa]
Length=246

 Score =   175 bits (443),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + AF++++TVQTAISA
Sbjct  142  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTFDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPLFRALTTEEIDEHLTAISERD  246



>ref|XP_006282775.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
 gb|EOA15673.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
Length=246

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + AF++++TVQTAISA
Sbjct  142  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTFDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPLFRALTTEEIDEHLTAISERD  246



>ref|XP_010435443.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
 ref|XP_010440739.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
Length=246

 Score =   174 bits (442),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + AF++ +TVQTAISA
Sbjct  142  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTFNETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPLFRALTTEEIDEHLTAISERD  246



>ref|XP_010541996.1| PREDICTED: proteasome subunit alpha type-6-B [Tarenaya hassleriana]
Length=246

 Score =   174 bits (442),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA S G+KEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEEKGPLLYKCDPAGHFYGHKATSVGMKEQEAINFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR + P FR L+T EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADSPVFRALTTEEIDEHLTAISERD  246



>ref|XP_010494382.1| PREDICTED: proteasome subunit alpha type-6-B [Camelina sativa]
Length=246

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA SAGVKEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEERGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADNPIFRSLETEEIEEHLTAISERD  246



>ref|XP_002870436.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46695.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   173 bits (439),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + AF++++TVQTAISA
Sbjct  142  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTFDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTAISERD  246



>gb|ABR17363.1| unknown [Picea sitchensis]
Length=138

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHF G+KA +AGVKE EA++FLEKK+KN+   SYE+TVQTA+SA
Sbjct  34   GIDEESGPQLFKCDPAGHFVGYKATAAGVKESEAVSFLEKKLKNNPELSYEETVQTAVSA  93

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV ++ P FR LST EIDEHLTAISERD
Sbjct  94   LQSVLQEDFKATEIEVGVVTKDSPVFRTLSTDEIDEHLTAISERD  138



>ref|XP_009136197.1| PREDICTED: proteasome subunit alpha type-6-B-like [Brassica rapa]
Length=246

 Score =   172 bits (437),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADNPIFRCLETEEIEEHLTAISERD  246



>ref|NP_198409.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
 sp|O81146.2|PSA6A_ARATH RecName: Full=Proteasome subunit alpha type-6-A; AltName: Full=20S 
proteasome subunit alpha A-1; AltName: Full=Proteasome 
component 1; AltName: Full=Proteasome subunit alpha type-1 
[Arabidopsis thaliana]
 dbj|BAB09993.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 dbj|BAF00393.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AED93984.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
Length=246

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + +F++++TVQTAISA
Sbjct  142  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPSFTFDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTAISERD  246



>gb|AAM12968.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AAM47883.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
Length=246

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + +F++++TVQTAISA
Sbjct  142  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPSFTFDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTAISERD  246



>emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome component, alpha 
subunit [Arabidopsis thaliana]
Length=245

 Score =   172 bits (436),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + +F++++TVQTAISA
Sbjct  141  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPSFTFDETVQTAISA  200

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLTAISERD
Sbjct  201  LQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTAISERD  245



>emb|CDY50408.1| BnaC03g45100D [Brassica napus]
Length=244

 Score =   172 bits (435),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  140  GMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISA  199

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLTAISERD
Sbjct  200  LQSVLQEDFKATEIEVGVVRADNPIFRSLETEEIEEHLTAISERD  244



>ref|XP_009102355.1| PREDICTED: proteasome subunit alpha type-6-B [Brassica rapa]
 emb|CDY33398.1| BnaA07g04410D [Brassica napus]
 emb|CDY18045.1| BnaC07g04250D [Brassica napus]
Length=246

 Score =   172 bits (435),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADNPIFRSLETEEIEEHLTAISERD  246



>ref|XP_006396131.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
 gb|ESQ36910.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
Length=246

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV+ ++P FR L T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVKADNPIFRSLETEEIEEHLTAISERD  246



>ref|XP_006649499.1| PREDICTED: proteasome subunit alpha type-6-like [Oryza brachyantha]
Length=246

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  FSY++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPQFSYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLTAISERD  246



>emb|CDX93103.1| BnaA03g38250D [Brassica napus]
Length=263

 Score =   172 bits (435),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  159  GMDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAINFLEKKMKENPAFTYDETVQTAISA  218

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++P FR L T EI+EHLTAISERD
Sbjct  219  LQSVLQEDFKATEIEVGVVRADNPIFRCLETEEIEEHLTAISERD  263



>ref|NP_001049162.1| Os03g0180400 [Oryza sativa Japonica Group]
 sp|Q9LSU3.1|PSA6_ORYSJ RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Oryza sativa Japonica Group]
 dbj|BAA96829.1| alpha 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 gb|AAN65435.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|AAO13479.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|ABF94305.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11076.1| Os03g0180400 [Oryza sativa Japonica Group]
 gb|EAY88785.1| hypothetical protein OsI_10259 [Oryza sativa Indica Group]
 gb|EAZ25813.1| hypothetical protein OsJ_09653 [Oryza sativa Japonica Group]
 dbj|BAG94887.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87220.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   171 bits (434),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  FSYE+TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPQFSYEETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLTAISERD  246



>ref|XP_002465753.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
 gb|EER92751.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
Length=246

 Score =   171 bits (432),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  F+Y++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPKFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLTAISERD  246



>gb|ABF94306.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
Length=286

 Score =   171 bits (434),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  FSYE+TVQ AISA
Sbjct  182  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPQFSYEETVQIAISA  241

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLTAISERD
Sbjct  242  LQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLTAISERD  286



>ref|NP_001130062.1| uncharacterized protein LOC100191154 [Zea mays]
 gb|ACF78183.1| unknown [Zea mays]
 gb|ACG28463.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG40310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACL54338.1| unknown [Zea mays]
Length=246

 Score =   170 bits (431),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  F+Y++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPKFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+E+  FRVL+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEERLFRVLTTEEIDQHLTAISERD  246



>ref|XP_010441957.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X1 
[Camelina sativa]
 ref|XP_010441958.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X2 
[Camelina sativa]
Length=246

 Score =   170 bits (431),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA SAGVKEQEAINFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEERGPLLYKCDPAGHFYGHKATSAGVKEQEAINFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR ++  FR L T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRADNRIFRSLETEEIEEHLTAISERD  246



>ref|XP_004985490.1| PREDICTED: proteasome subunit alpha type-6-like [Setaria italica]
Length=246

 Score =   170 bits (430),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  F+Y++TVQ AISA
Sbjct  142  GYDEEKKAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPQFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLTAISERD  246



>gb|ACN33969.1| unknown [Zea mays]
 tpg|DAA43695.1| TPA: proteasome subunit alpha type [Zea mays]
Length=246

 Score =   169 bits (429),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  F+Y++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPKFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLTAISERD  246



>ref|NP_001105138.1| maize 20S proteasome alpha subunit [Zea mays]
 emb|CAC19494.1| maize 20S proteasome alpha subunit [Zea mays]
Length=246

 Score =   169 bits (429),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  F+Y++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPKFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR++D  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKDDRVFRALTTEEIDQHLTAISERD  246



>gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana]
Length=246

 Score =   169 bits (428),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLE++MK + +F++++TVQTAISA
Sbjct  142  GVDEENGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEEEMKGNPSFTFDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR E+P FR L+T EI+EHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRAENPEFRALTTEEIEEHLTAISERD  246



>gb|ABK22399.1| unknown [Picea sitchensis]
 gb|ABK25916.1| unknown [Picea sitchensis]
Length=246

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAGHF G+KA +AGVKE EA++FLEKK+KN+   SYE+TVQTA+SA
Sbjct  142  GIDEESGPQLFKCDPAGHFVGYKATAAGVKESEAVSFLEKKLKNNPELSYEETVQTAVSA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVV ++ P FR LST EIDEHLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVTKDSPVFRTLSTDEIDEHLTAISERD  246



>gb|EMT09268.1| Proteasome subunit alpha type-6 [Aegilops tauschii]
Length=246

 Score =   169 bits (427),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+   FSY++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDSPQFSYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDRVFRSLTTEEIDQHLTAISERD  246



>ref|XP_003558667.1| PREDICTED: proteasome subunit alpha type-6 [Brachypodium distachyon]
Length=246

 Score =   168 bits (426),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+   F+Y++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDSPQFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDRVFRALTTEEIDQHLTAISERD  246



>dbj|BAJ85935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+   F+Y++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDSPQFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FR L+T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDRVFRSLTTEEIDQHLTAISERD  246



>ref|XP_001777426.1| predicted protein [Physcomitrella patens]
 gb|EDQ57713.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   168 bits (425),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FG+KA S+G KEQEA+NFLEKKMKND   S+E TVQTAISA
Sbjct  142  GIDDEQGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLEKKMKNDPQLSFEDTVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQS+L EDFK +EIE+GVVR   P FR+LST EIDEHLTAISERD
Sbjct  202  LQSILLEDFKPTEIEVGVVRVGKPEFRILSTEEIDEHLTAISERD  246



>gb|AGO97077.1| 20S proteasome alpha [Saccharum hybrid cultivar GT28]
Length=246

 Score =   167 bits (424),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE   QLFKCDPAGHFFGHKA SAG+KEQEAINFLEKKMK+D  F+Y++TVQ AISA
Sbjct  142  GYDEEKNAQLFKCDPAGHFFGHKATSAGLKEQEAINFLEKKMKDDPKFTYDETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVLQEDFKA+EIE+GVVR+ED  FR  +T EID+HLTAISERD
Sbjct  202  LQSVLQEDFKATEIEVGVVRKEDRVFRAPTTEEIDQHLTAISERD  246



>ref|XP_002989745.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
 ref|XP_002991751.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ07155.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ09222.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
Length=246

 Score =   166 bits (421),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/105 (72%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
             I EE GPQLFKCDPAGH+ G++A SAG+KEQEA+N LEKKMKN+   SY++TVQTAISA
Sbjct  142  AIDEEKGPQLFKCDPAGHYVGYRATSAGLKEQEAVNILEKKMKNNPQLSYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQS+L EDFKA+EIE+G+VR  DP F+++ST EIDEHLTAISERD
Sbjct  202  LQSILLEDFKATEIEVGIVRATDPKFQIMSTEEIDEHLTAISERD  246



>ref|XP_001768229.1| predicted protein [Physcomitrella patens]
 gb|EDQ66843.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 91/105 (87%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FG+KA S+G KEQEA+NFLEKK+KN+   SY++TVQTAISA
Sbjct  142  GIDDEQGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLEKKIKNNPQLSYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQS+L EDFK +EIE+GVVR   P FRVLST EIDEHLTAISERD
Sbjct  202  LQSILLEDFKPTEIEVGVVRAGKPEFRVLSTEEIDEHLTAISERD  246



>ref|XP_001782615.1| predicted protein [Physcomitrella patens]
 gb|EDQ52604.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   164 bits (415),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FG+KA S+G KEQEA+NFLEKK K++  FSYE+TVQ AISA
Sbjct  142  GIDDELGPQLYKCDPAGHYFGYKATSSGSKEQEAVNFLEKKCKSNPQFSYEETVQIAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQS+L EDFK +EIE+GVVR   P FRVL+T EIDEHLTAISERD
Sbjct  202  LQSILLEDFKPTEIEVGVVRASKPEFRVLTTEEIDEHLTAISERD  246



>ref|XP_001751730.1| predicted protein [Physcomitrella patens]
 gb|EDQ83165.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   153 bits (387),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 90/105 (86%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ +E GP+L+KCDPAGHF G+KA S+G KEQEA+N L+KK+K++   SY++TVQTAI A
Sbjct  142  GMDDEHGPRLYKCDPAGHFVGYKATSSGAKEQEAVNILDKKLKHNPQLSYDETVQTAICA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQS+L EDFK +EIE+GVV Q DP+FR+L+T +ID+HLT+ISERD
Sbjct  202  LQSILLEDFKPTEIEVGVVSQADPNFRLLTTEDIDDHLTSISERD  246



>ref|NP_001150310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG38611.1| proteasome subunit alpha type 6 [Zea mays]
 tpg|DAA63585.1| TPA: proteasome subunit alpha type 6 [Zea mays]
Length=285

 Score =   143 bits (361),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 84/103 (82%), Gaps = 1/103 (1%)
 Frame = -3

Query  504  GIXEEXG-PQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAIS  328
            GI +E G PQLF CDPAG+FFGHKA SAG ++ EA+NFLEKKMKN+ +  +++T+Q AIS
Sbjct  162  GIDDEKGTPQLFTCDPAGYFFGHKAASAGQRDTEAVNFLEKKMKNNPSLPFQETIQMAIS  221

Query  327  ALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAIS  199
            ALQ  L+ D KASE+E+GVVR +DP+FRVL+  EIDEHL AI+
Sbjct  222  ALQFALKADLKASEVEVGVVRTDDPTFRVLTEAEIDEHLEAIN  264



>ref|XP_005648429.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
 gb|EIE23885.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
Length=247

 Score =   142 bits (357),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 85/106 (80%), Gaps = 1/106 (1%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFK DPAG++ G+KA SAG K+QEA NFLEK+ K +  FS+E+T QTAI+A
Sbjct  142  GIDEEAGPQLFKVDPAGYYVGYKATSAGAKDQEADNFLEKRFKGNPEFSFEETAQTAIAA  201

Query  324  LQSVLQEDFKASEIEIGVVR-QEDPSFRVLSTVEIDEHLTAISERD  190
            LQSVL EDFKASEIE+GVVR  E   FRVL   E+++HL+AISERD
Sbjct  202  LQSVLAEDFKASEIEVGVVRASEGGVFRVLGVEEVEDHLSAISERD  247



>ref|XP_010136410.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Buceros 
rhinoceros silvestris]
 ref|XP_010201963.1| PREDICTED: proteasome subunit alpha type-6 [Colius striatus]
 ref|XP_010201964.1| PREDICTED: proteasome subunit alpha type-6 [Colius striatus]
Length=167

 Score =   136 bits (342),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  63   GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  EDP FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVEDPKFRILTEAEIDVHLVALAERD  167



>gb|KHG04433.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=226

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 77/105 (73%), Gaps = 20/105 (19%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+KCDPAGHF+GHKA SAG KEQEAINFLEKKMKND AF+YE+TVQ     
Sbjct  142  GIDEEKGPQLYKCDPAGHFYGHKATSAGSKEQEAINFLEKKMKNDPAFTYEETVQ-----  196

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
                           +GVV+ ++P FRV+ST EIDEHLTAISERD
Sbjct  197  ---------------VGVVKADNPVFRVMSTEEIDEHLTAISERD  226



>ref|XP_006835408.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Chrysochloris 
asiatica]
 ref|XP_006835409.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Chrysochloris 
asiatica]
Length=167

 Score =   135 bits (341),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+I+FLEKK+K    +++E+TV+TAI+ 
Sbjct  63   GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESISFLEKKVKKKFDWTFEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD  167



>ref|NP_989113.1| proteasome subunit alpha type-6 [Xenopus (Silurana) tropicalis]
 gb|AAH61438.1| proteasome (prosome, macropain) subunit, alpha type 6 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81265.1| proteasome (prosome macropain) subunit alpha type 6 [Xenopus 
(Silurana) tropicalis]
Length=246

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ+FKCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++YE+T++TAIS 
Sbjct  142  GVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLEKKVKKKLDWTYEQTLETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  EDP FRVL+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTVEDPKFRVLTEAEIDVHLVALAERD  246



>ref|XP_010169981.1| PREDICTED: proteasome subunit alpha type-6 [Caprimulgus carolinensis]
 ref|XP_010169982.1| PREDICTED: proteasome subunit alpha type-6 [Caprimulgus carolinensis]
Length=167

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  63   GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  167



>ref|XP_009942435.1| PREDICTED: proteasome subunit alpha type-6 [Opisthocomus hoazin]
 ref|XP_009942436.1| PREDICTED: proteasome subunit alpha type-6 [Opisthocomus hoazin]
Length=167

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  63   GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P+FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPNFRILTEAEIDVHLVALAERD  167



>ref|XP_009973400.1| PREDICTED: proteasome subunit alpha type-6 [Tyto alba]
 ref|XP_009973401.1| PREDICTED: proteasome subunit alpha type-6 [Tyto alba]
Length=167

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  63   GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDMHLVALAERD  167



>ref|XP_005444182.1| PREDICTED: proteasome subunit alpha type-6 [Falco cherrug]
 ref|XP_005417543.1| PREDICTED: proteasome subunit alpha type-6 [Geospiza fortis]
 ref|XP_005520350.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pseudopodoces 
humilis]
 ref|XP_005502374.1| PREDICTED: proteasome subunit alpha type-6 [Columba livia]
 ref|XP_008503446.1| PREDICTED: proteasome subunit alpha type-6 [Calypte anna]
 ref|XP_008637806.1| PREDICTED: proteasome subunit alpha type-6 [Corvus brachyrhynchos]
 ref|XP_008637807.1| PREDICTED: proteasome subunit alpha type-6 [Corvus brachyrhynchos]
 ref|XP_008923234.1| PREDICTED: proteasome subunit alpha type-6 [Manacus vitellinus]
 ref|XP_008940701.1| PREDICTED: proteasome subunit alpha type-6 [Merops nubicus]
 ref|XP_009069561.1| PREDICTED: proteasome subunit alpha type-6 [Acanthisitta chloris]
 ref|XP_009100162.1| PREDICTED: proteasome subunit alpha type-6 [Serinus canaria]
 ref|XP_009482323.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pelecanus 
crispus]
 ref|XP_009482324.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pelecanus 
crispus]
 ref|XP_009462347.1| PREDICTED: proteasome subunit alpha type-6 [Nipponia nippon]
 ref|XP_009462348.1| PREDICTED: proteasome subunit alpha type-6 [Nipponia nippon]
 ref|XP_009501763.1| PREDICTED: proteasome subunit alpha type-6 [Phalacrocorax carbo]
 ref|XP_009501764.1| PREDICTED: proteasome subunit alpha type-6 [Phalacrocorax carbo]
 ref|XP_009561904.1| PREDICTED: proteasome subunit alpha type-6 [Cuculus canorus]
 ref|XP_009579754.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Fulmarus 
glacialis]
 ref|XP_009669223.1| PREDICTED: proteasome subunit alpha type-6 [Struthio camelus 
australis]
 ref|XP_009644983.1| PREDICTED: proteasome subunit alpha type-6 [Egretta garzetta]
 ref|XP_009811689.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Gavia 
stellata]
 ref|XP_009704701.1| PREDICTED: proteasome subunit alpha type-6 [Cariama cristata]
 ref|XP_009867954.1| PREDICTED: proteasome subunit alpha type-6 [Apaloderma vittatum]
 ref|XP_009885255.1| PREDICTED: proteasome subunit alpha type-6 [Charadrius vociferus]
 ref|XP_009901280.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Picoides 
pubescens]
 ref|XP_009925669.1| PREDICTED: proteasome subunit alpha type-6 [Haliaeetus albicilla]
 ref|XP_009952430.1| PREDICTED: proteasome subunit alpha type-6 [Leptosomus discolor]
 ref|XP_010011288.1| PREDICTED: proteasome subunit alpha type-6 [Nestor notabilis]
 ref|XP_009985864.1| PREDICTED: proteasome subunit alpha type-6 [Tauraco erythrolophus]
 ref|XP_009992162.1| PREDICTED: proteasome subunit alpha type-6 [Chaetura pelagica]
 ref|XP_010153546.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Eurypyga 
helias]
 ref|XP_010074237.1| PREDICTED: proteasome subunit alpha type-6 [Pterocles gutturalis]
 ref|XP_010180651.1| PREDICTED: proteasome subunit alpha type-6 [Mesitornis unicolor]
 ref|XP_010180652.1| PREDICTED: proteasome subunit alpha type-6 [Mesitornis unicolor]
 ref|XP_010118742.1| PREDICTED: proteasome subunit alpha type-6 [Chlamydotis macqueenii]
 ref|XP_010220060.1| PREDICTED: proteasome subunit alpha type-6 [Tinamus guttatus]
 ref|XP_010282038.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Phaethon 
lepturus]
 ref|XP_010304152.1| PREDICTED: proteasome subunit alpha type-6 [Balearica regulorum 
gibbericeps]
 ref|XP_010581957.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Haliaeetus 
leucocephalus]
Length=167

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  63   GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  167



>ref|XP_010390621.1| PREDICTED: LOW QUALITY PROTEIN: proteasome subunit alpha type-6 
[Corvus cornix cornix]
Length=167

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  63   GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  167



>gb|KFO90954.1| Proteasome subunit alpha type-6, partial [Buceros rhinoceros 
silvestris]
 gb|KFP26112.1| Proteasome subunit alpha type-6, partial [Colius striatus]
Length=222

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/105 (59%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  EDP FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVEDPKFRILTEAEIDVHLVALAERD  222



>ref|XP_006732282.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Leptonychotes 
weddellii]
 ref|XP_006732283.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Leptonychotes 
weddellii]
 ref|XP_006891613.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Elephantulus 
edwardii]
 ref|XP_006891614.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Elephantulus 
edwardii]
 ref|XP_008692333.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Ursus 
maritimus]
 ref|XP_011227692.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Ailuropoda 
melanoleuca]
Length=167

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  63   GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLVALAERD  167



>gb|EGW11727.1| Proteasome subunit alpha type-6 [Cricetulus griseus]
Length=164

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  60   GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  119

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL A++ERD
Sbjct  120  LSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLVALAERD  164



>ref|XP_008157204.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Eptesicus 
fuscus]
Length=167

 Score =   133 bits (335),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  63   GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD  167



>ref|NP_001269161.1| proteasome subunit alpha type-6 isoform b [Homo sapiens]
 ref|NP_001269162.1| proteasome subunit alpha type-6 isoform b [Homo sapiens]
 ref|XP_005656351.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Sus scrofa]
 ref|XP_005891865.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Bos mutus]
 ref|XP_005891866.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Bos mutus]
 ref|XP_005965385.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Pantholops 
hodgsonii]
 ref|XP_005965386.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Pantholops 
hodgsonii]
 ref|XP_005965387.1| PREDICTED: proteasome subunit alpha type-6-like isoform X4 [Pantholops 
hodgsonii]
 ref|XP_006186438.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Camelus 
ferus]
 ref|XP_006186439.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Camelus 
ferus]
 ref|XP_006212819.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Vicugna 
pacos]
 ref|XP_006212820.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Vicugna 
pacos]
 ref|XP_007464886.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Lipotes 
vexillifer]
 ref|XP_007464887.1| PREDICTED: proteasome subunit alpha type-6 isoform X4 [Lipotes 
vexillifer]
 ref|XP_007936739.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Orycteropus 
afer afer]
 ref|XP_007936740.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Orycteropus 
afer afer]
 ref|XP_009247294.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pongo 
abelii]
 ref|XP_009425928.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pan troglodytes]
 dbj|BAG61026.1| unnamed protein product [Homo sapiens]
 dbj|BAH14594.1| unnamed protein product [Homo sapiens]
Length=167

 Score =   133 bits (335),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  63   GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  167



>gb|KFR01991.1| Proteasome subunit alpha type-6, partial [Opisthocomus hoazin]
Length=222

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P+FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPNFRILTEAEIDVHLVALAERD  222



>gb|KFZ47806.1| Proteasome subunit alpha type-6, partial [Caprimulgus carolinensis]
Length=221

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  117  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  176

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  177  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  221



>gb|KFV43324.1| Proteasome subunit alpha type-6, partial [Tyto alba]
Length=222

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDMHLVALAERD  222



>gb|KFO63713.1| Proteasome subunit alpha type-6, partial [Corvus brachyrhynchos]
Length=222

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  222



>ref|XP_005014711.1| PREDICTED: proteasome subunit alpha type-6, partial [Anas platyrhynchos]
Length=222

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  222



>ref|XP_006835407.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysochloris 
asiatica]
Length=246

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+I+FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESISFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD  246



>gb|KFP89006.1| Proteasome subunit alpha type-6, partial [Apaloderma vittatum]
 gb|KFQ33586.1| Proteasome subunit alpha type-6, partial [Mesitornis unicolor]
 gb|KFQ88161.1| Proteasome subunit alpha type-6, partial [Phoenicopterus ruber 
ruber]
 gb|KFW81906.1| Proteasome subunit alpha type-6, partial [Manacus vitellinus]
 gb|KFW90363.1| Proteasome subunit alpha type-6, partial [Phalacrocorax carbo]
Length=222

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  222



>gb|EMC83847.1| Proteasome subunit alpha type-6, partial [Columba livia]
 gb|KFM02429.1| Proteasome subunit alpha type-6, partial [Aptenodytes forsteri]
 gb|KFO12524.1| Proteasome subunit alpha type-6, partial [Balearica regulorum 
gibbericeps]
 gb|KFO78195.1| Proteasome subunit alpha type-6, partial [Cuculus canorus]
 gb|KFO97178.1| Proteasome subunit alpha type-6, partial [Calypte anna]
 gb|KFP41949.1| Proteasome subunit alpha type-6, partial [Chlamydotis macqueenii]
 gb|KFP68093.1| Proteasome subunit alpha type-6, partial [Cariama cristata]
 gb|KFQ10797.1| Proteasome subunit alpha type-6, partial [Haliaeetus albicilla]
 gb|KFQ13409.1| Proteasome subunit alpha type-6, partial [Leptosomus discolor]
 gb|KFQ48093.1| Proteasome subunit alpha type-6, partial [Nestor notabilis]
 gb|KFQ52159.1| Proteasome subunit alpha type-6, partial [Pelecanus crispus]
 gb|KFQ72088.1| Proteasome subunit alpha type-6, partial [Phaethon lepturus]
 gb|KFV18823.1| Proteasome subunit alpha type-6, partial [Tauraco erythrolophus]
 gb|KFV43399.1| Proteasome subunit alpha type-6, partial [Gavia stellata]
 gb|KFV79271.1| Proteasome subunit alpha type-6, partial [Struthio camelus australis]
 gb|KFW08157.1| Proteasome subunit alpha type-6, partial [Fulmarus glacialis]
 gb|KFW63854.1| Proteasome subunit alpha type-6, partial [Pygoscelis adeliae]
 gb|KGL82190.1| Proteasome subunit alpha type-6, partial [Tinamus guttatus]
 gb|KGL94893.1| Proteasome subunit alpha type-6, partial [Charadrius vociferus]
Length=222

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  222



>ref|XP_005047359.1| PREDICTED: proteasome subunit alpha type-6, partial [Ficedula 
albicollis]
Length=226

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  122  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  181

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  182  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  226



>ref|XP_009288678.1| PREDICTED: proteasome subunit alpha type-6 [Aptenodytes forsteri]
Length=224

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  120  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  179

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  180  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  224



>ref|XP_004773397.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Mustela 
putorius furo]
 ref|XP_004820514.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Mustela 
putorius furo]
 ref|XP_005623383.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Canis 
lupus familiaris]
Length=227

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  123  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  182

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL A++ERD
Sbjct  183  LSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLVALAERD  227



>gb|KFQ31740.1| Proteasome subunit alpha type-6, partial [Merops nubicus]
Length=226

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  122  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  181

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  182  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  226



>gb|KFQ96181.1| Proteasome subunit alpha type-6, partial [Nipponia nippon]
Length=233

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  129  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  188

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  189  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  233



>ref|NP_001088418.1| uncharacterized protein LOC495277 [Xenopus laevis]
 gb|AAH84423.1| LOC495277 protein [Xenopus laevis]
Length=246

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ+FKCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++Y +T++TAIS 
Sbjct  142  GVDEENGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLEKKVKKKLDWTYGQTLETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  +DP FRVL+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTVQDPKFRVLTEAEIDTHLVALAERD  246



>ref|NP_001264372.1| proteasome subunit alpha type-6 [Gallus gallus]
 ref|XP_003206625.1| PREDICTED: proteasome subunit alpha type-6 [Meleagris gallopavo]
Length=246

 Score =   134 bits (338),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  142  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTETEIDMHLVALAERD  246



>ref|XP_003971508.1| PREDICTED: proteasome subunit alpha type-6-like [Takifugu rubripes]
Length=246

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVITTQDPKFRILTETEVDTHLMALAERD  246



>ref|XP_003445487.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
 ref|XP_005738779.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005933943.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
 ref|XP_006799416.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=246

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++YE+T++TAIS 
Sbjct  142  GIDEELGPQLFKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTYEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  ++P F++LS  EID HL  +SER+
Sbjct  202  LSTVLSIDFKPSELEIGVITAQEPKFKILSEAEIDAHLMTLSERE  246



>emb|CAA43964.1| macropain subunit iota [Homo sapiens]
Length=221

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  117  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  176

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  177  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  221



>ref|XP_006515947.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mus musculus]
Length=227

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  123  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  182

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  183  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_006240160.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Rattus 
norvegicus]
Length=227

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  123  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  182

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  183  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_002500811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62069.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   135 bits (340),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 85/108 (79%), Gaps = 3/108 (3%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXA---FSYEKTVQTA  334
            GI EE GP L+K DPAG+F G+KA SAG KEQEAINFLEKK+K   A   F+ ++TV+TA
Sbjct  184  GIDEERGPSLYKNDPAGYFVGYKATSAGAKEQEAINFLEKKVKGKDAGNTFTEQETVRTA  243

Query  333  ISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            I+ LQ+VL ED KA E+E+G+V  +DP+FR+LS   I++HLTAISERD
Sbjct  244  IACLQTVLGEDLKARELEVGIVTVDDPNFRLLSETAIEDHLTAISERD  291



>ref|XP_001691723.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
 gb|EDP04831.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
Length=249

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 84/109 (77%), Gaps = 4/109 (4%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQLFK DPAG++ G+KA S GVKE EA NFLEKK K++  F+Y++ V TAI+A
Sbjct  141  GVDEERGPQLFKVDPAGYYVGYKATSVGVKETEANNFLEKKFKSNPQFTYDEAVTTAIAA  200

Query  324  LQSVLQEDFKASEIEIGVVRQ----EDPSFRVLSTVEIDEHLTAISERD  190
            LQ VL E+FK+S++E+GVVR      D SFRVL+T E+D +LT ISERD
Sbjct  201  LQGVLSEEFKSSDLEVGVVRAGSEGGDGSFRVLTTEEVDHYLTIISERD  249



>ref|XP_004681994.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Condylura 
cristata]
Length=227

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  123  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  182

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  183  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_005243955.1| PREDICTED: proteasome subunit alpha type-6 [Falco peregrinus]
Length=254

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  150  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  209

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  210  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  254



>ref|XP_005158685.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Danio 
rerio]
 gb|AAH55520.1| Psma6a protein [Danio rerio]
 gb|AAI64827.1| Psma6a protein [Danio rerio]
Length=246

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++++TV+TAIS 
Sbjct  142  GVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKIKKKLDWTFDQTVETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGVV  E+P FR+LS  EID HL A++ERD
Sbjct  202  LSTVLAIDFKPSELEIGVVTTEEPKFRILSESEIDTHLMALTERD  246



>ref|XP_006258805.1| PREDICTED: proteasome subunit alpha type-6 [Alligator mississippiensis]
Length=246

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  142  GVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD  246



>ref|XP_010631916.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Fukomys 
damarensis]
Length=229

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  125  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  184

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  185  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  229



>gb|EXX71316.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=178

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  +E GPQLFKCDPAG++ G+KA +AG K+QEA+N LEKK+K D    +E+TV+ AI+ 
Sbjct  74   GYDDERGPQLFKCDPAGYYVGYKATAAGAKQQEALNHLEKKLKKDPVLDFEETVELAINT  133

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L SVL  DFK++EIE+ VV ++DP FR LS  EID+HL  I E+D
Sbjct  134  LSSVLSADFKSTEIEVAVVTKDDPKFRTLSINEIDDHLQRIVEKD  178



>ref|XP_009901279.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Picoides 
pubescens]
 gb|KFV69230.1| Proteasome subunit alpha type-6 [Picoides pubescens]
Length=246

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  142  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  246



>ref|XP_005376981.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Chinchilla 
lanigera]
Length=229

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  125  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  184

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  185  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  229



>ref|XP_005149366.1| PREDICTED: proteasome subunit alpha type-6 [Melopsittacus undulatus]
Length=246

 Score =   134 bits (337),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  142  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDGHLVALAERD  246



>ref|NP_001269163.1| proteasome subunit alpha type-6 isoform c [Homo sapiens]
 gb|EAW65876.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_a [Homo sapiens]
 dbj|BAG63411.1| unnamed protein product [Homo sapiens]
Length=227

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  123  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  182

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  183  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  227



>ref|XP_004612218.1| PREDICTED: proteasome subunit alpha type-6 [Sorex araneus]
Length=194

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  90   GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  149

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  150  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  194



>ref|XP_004270017.1| PREDICTED: proteasome subunit alpha type-6 isoform 2 [Orcinus 
orca]
 ref|XP_004319608.1| PREDICTED: proteasome subunit alpha type-6 isoform 2 [Tursiops 
truncatus]
Length=236

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  132  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  191

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  192  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  236



>gb|KFZ52790.1| Proteasome subunit alpha type-6, partial [Podiceps cristatus]
Length=222

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  118  GIDDEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  222



>ref|XP_004436463.1| PREDICTED: proteasome subunit alpha type-6 isoform 2 [Ceratotherium 
simum simum]
Length=236

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  132  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  191

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  192  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  236



>ref|XP_007464885.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Lipotes 
vexillifer]
Length=236

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  132  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  191

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  192  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  236



>ref|XP_537412.2| PREDICTED: proteasome subunit alpha type-6 isoformX2 [Canis lupus 
familiaris]
 ref|XP_002922862.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_004399857.1| PREDICTED: proteasome subunit alpha type-6 [Odobenus rosmarus 
divergens]
 ref|XP_004773396.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_004820513.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_005080563.1| PREDICTED: proteasome subunit alpha type-6 [Mesocricetus auratus]
 ref|XP_005343781.1| PREDICTED: proteasome subunit alpha type-6 [Microtus ochrogaster]
 ref|XP_006732281.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006891612.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Elephantulus 
edwardii]
 ref|XP_003509963.2| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Cricetulus 
griseus]
 ref|XP_007632099.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Cricetulus 
griseus]
 ref|XP_008692325.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ursus 
maritimus]
 gb|ERE72544.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=246

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLVALAERD  246



>ref|XP_002949740.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
 gb|EFJ49292.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
Length=249

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 4/109 (4%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFK DPAG++ G+KA + GVKE EA NFLEKK+K + A SY++ V TAISA
Sbjct  141  GIDEERGPQLFKVDPAGYYVGYKATAVGVKETEAHNFLEKKLKGNPALSYDEAVITAISA  200

Query  324  LQSVLQEDFKASEIEIGVVRQ----EDPSFRVLSTVEIDEHLTAISERD  190
            LQ VL E+FKA+++E+GVVR      D +FRVL+T E+D  LT ISERD
Sbjct  201  LQGVLSEEFKAADLEVGVVRNGPDGSDRAFRVLTTEEVDHFLTIISERD  249



>ref|XP_004055136.1| PREDICTED: proteasome subunit alpha type-6-like, partial [Gorilla 
gorilla gorilla]
Length=235

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  131  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  190

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  191  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  235



>ref|XP_010153543.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eurypyga 
helias]
 ref|XP_010581956.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Haliaeetus 
leucocephalus]
Length=246

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  142  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  246



>ref|NP_001232198.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
 ref|XP_005479894.1| PREDICTED: proteasome subunit alpha type-6 [Zonotrichia albicollis]
 ref|XP_005520349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pseudopodoces 
humilis]
 gb|ACH43691.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
Length=246

 Score =   134 bits (336),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  142  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  246



>ref|XP_007119013.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Physeter 
catodon]
 ref|XP_007119014.1| PREDICTED: proteasome subunit alpha type-6 isoform X3 [Physeter 
catodon]
Length=236

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  132  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  191

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  192  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  236



>ref|XP_005656350.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Sus scrofa]
Length=227

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  123  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  182

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  183  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  227



>gb|KHN46954.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=560

 Score =   138 bits (347),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 62/78 (79%), Positives = 73/78 (94%), Gaps = 0/78 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQL+KCDPAGH+FGHKA SAG+K+QEAINFLEKKMKND +F+YE+TVQTAISA
Sbjct  142  GIDDEYGPQLYKCDPAGHYFGHKATSAGLKDQEAINFLEKKMKNDPSFTYEETVQTAISA  201

Query  324  LQSVLQEDFKASEIEIGV  271
            LQSVLQEDFKA+EIE+ +
Sbjct  202  LQSVLQEDFKATEIEMSL  219



>ref|XP_010744453.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVLTTQDPKFRILTETEVDTHLMALAERD  246



>ref|XP_009317738.1| PREDICTED: proteasome subunit alpha type-6 [Pygoscelis adeliae]
Length=259

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  155  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  214

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  215  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  259



>emb|CAG00121.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=246

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+TV+TAIS 
Sbjct  142  GIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTVETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVITTQDPKFRILTETEVDTHLMSLAERD  246



>ref|XP_004584816.1| PREDICTED: proteasome subunit alpha type-6 [Ochotona princeps]
Length=242

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  138  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  197

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  198  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  242



>ref|XP_010876681.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ+FKCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++++TV+TAI+ 
Sbjct  142  GVDEECGPQVFKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFKETVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+LS  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILSESEVDTHLVSLAERD  246



>ref|XP_006632201.1| PREDICTED: proteasome subunit alpha type-6-like [Lepisosteus 
oculatus]
Length=246

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++++TV+TAI+ 
Sbjct  142  GVDEEFGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFDQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGVV  EDP FR+LS  EID HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEIGVVTTEDPKFRILSEAEIDGHLVSLAERD  246



>ref|XP_005285406.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Chrysemys 
picta bellii]
 ref|XP_007065316.1| PREDICTED: proteasome subunit alpha type-6 [Chelonia mydas]
Length=167

 Score =   131 bits (329),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+T I+ 
Sbjct  63   GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKYDWTFEQTVETGITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSELEVGVVTVENPKFRILTEAEIDTHLVALAERD  167



>ref|XP_003440740.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
Length=246

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  +DP FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTTQDPKFRILAETEVDTHLMSLAERD  246



>ref|XP_007660691.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Ornithorhynchus 
anatinus]
Length=167

 Score =   131 bits (329),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  63   GVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  122

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  123  LSTVLSIDFKPSELEVGVVTVENPKFRILTESEIDTHLVALAERD  167



>ref|XP_008300217.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQL+KCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++YE+T++TAIS 
Sbjct  142  GLDEELGPQLYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTYEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GV++ ++P F++LS  EID HL A+S+R+
Sbjct  202  LSTVLSIDFKPSELEVGVIKTQEPEFKILSEAEIDTHLMALSDRE  246



>ref|XP_007253022.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Astyanax 
mexicanus]
Length=246

 Score =   133 bits (335),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 83/105 (79%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EAI+FLEKK+K    +++E+T++TAIS 
Sbjct  142  GLDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEAISFLEKKVKKKHDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+G++  +DP FR+L+  E+D HL ++SERD
Sbjct  202  LSTVLSIDFKPSELEVGIITADDPKFRILTESEVDTHLVSLSERD  246



>ref|XP_004698589.1| PREDICTED: proteasome subunit alpha type-6 [Echinops telfairi]
 ref|XP_006085896.1| PREDICTED: proteasome subunit alpha type-6 [Myotis lucifugus]
 ref|XP_006759764.1| PREDICTED: proteasome subunit alpha type-6 [Myotis davidii]
 ref|XP_008157203.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eptesicus 
fuscus]
 gb|ELK33263.1| Proteasome subunit alpha type-6 [Myotis davidii]
Length=246

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD  246



>dbj|BAE36518.1| unnamed protein product [Mus musculus]
Length=246

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>ref|NP_001086785.1| proteasome alpha 6 subunit [Xenopus laevis]
 gb|AAH77442.1| Psma6-prov protein [Xenopus laevis]
 dbj|BAD42870.1| 20S proteasome alpha1 subunit [Xenopus laevis]
Length=246

 Score =   133 bits (334),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ+FKCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++YE+T++TAIS 
Sbjct  142  GVDEEHGPQVFKCDPAGYYCGFKATTAGVKQTEATSFLEKKVKKKLDWTYEQTLETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+ VV  +DP F+VL+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVAVVTVQDPKFKVLTEAEIDTHLVALAERD  246



>gb|KFP76959.1| Proteasome subunit alpha type-6, partial [Acanthisitta chloris]
 gb|KFV03490.1| Proteasome subunit alpha type-6, partial [Pterocles gutturalis]
Length=222

 Score =   132 bits (332),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+ AI+ 
Sbjct  118  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVEVAITC  177

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  178  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  222



>ref|XP_008267725.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Oryctolagus 
cuniculus]
Length=264

 Score =   133 bits (335),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  160  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  219

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  220  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  264



>ref|NP_001132918.1| proteasome subunit alpha type-6 [Ovis aries]
 gb|ACI46679.1| proteasome subunit alpha type 6 [Ovis aries]
Length=246

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>ref|NP_036098.1| proteasome subunit alpha type-6 [Mus musculus]
 ref|XP_010383847.1| PREDICTED: proteasome subunit alpha type-6 [Rhinopithecus roxellana]
 sp|Q9QUM9.1|PSA6_MOUSE RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Mus musculus]
 pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|U Chain U, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|II Chain i, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|WW Chain w, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|G Chain G, Mouse Constitutive 20s Proteasome
 pdb|3UNE|U Chain U, Mouse Constitutive 20s Proteasome
 pdb|3UNE|II Chain i, Mouse Constitutive 20s Proteasome
 pdb|3UNE|WW Chain w, Mouse Constitutive 20s Proteasome
 pdb|3UNF|G Chain G, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|U Chain U, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|G Chain G, Mouse 20s Immunoproteasome
 pdb|3UNH|U Chain U, Mouse 20s Immunoproteasome
 gb|AAD50532.1|AF060087_1 proteasome subunit iota [Mus musculus]
 gb|AAF21459.1|U60288_1 proteasome subunit iota [Mus musculus]
 dbj|BAC40169.1| unnamed protein product [Mus musculus]
 dbj|BAE31592.1| unnamed protein product [Mus musculus]
 gb|AAH86685.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Mus musculus]
Length=246

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_004436462.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Ceratotherium 
simum simum]
Length=246

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>ref|NP_058979.1| proteasome subunit alpha type-6 [Rattus norvegicus]
 ref|NP_002782.1| proteasome subunit alpha type-6 isoform a [Homo sapiens]
 ref|NP_001039427.1| proteasome subunit alpha type-6 [Bos taurus]
 ref|NP_001180482.1| proteasome subunit alpha type-6 [Macaca mulatta]
 ref|NP_001233586.1| proteasome subunit alpha type-6 [Pan troglodytes]
 ref|NP_001271993.1| uncharacterized protein LOC101866963 [Macaca fascicularis]
 ref|NP_001272627.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Capra 
hircus]
 ref|XP_001491320.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Equus caballus]
 ref|XP_002718187.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_003408905.1| PREDICTED: proteasome subunit alpha type-6 [Loxodonta africana]
 ref|XP_003792017.1| PREDICTED: proteasome subunit alpha type-6 [Otolemur garnettii]
 ref|XP_003821244.1| PREDICTED: proteasome subunit alpha type-6 [Pan paniscus]
 ref|XP_003987590.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Felis 
catus]
 ref|XP_004270016.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Orcinus 
orca]
 ref|XP_004319607.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Tursiops 
truncatus]
 ref|XP_004376568.1| PREDICTED: proteasome subunit alpha type-6 [Trichechus manatus 
latirostris]
 ref|XP_004681993.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Condylura 
cristata]
 ref|XP_004884716.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_004867614.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_005376980.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005891864.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Bos mutus]
 ref|XP_006186437.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Camelus 
ferus]
 ref|XP_006212818.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Vicugna 
pacos]
 ref|XP_006913536.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus alecto]
 ref|XP_007073792.1| PREDICTED: proteasome subunit alpha type-6 [Panthera tigris altaica]
 ref|XP_007119012.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Physeter 
catodon]
 ref|XP_006043909.1| PREDICTED: proteasome subunit alpha type-6 [Bubalus bubalis]
 ref|XP_007464884.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007936738.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Orycteropus 
afer afer]
 ref|XP_007984674.1| PREDICTED: proteasome subunit alpha type-6 [Chlorocebus sabaeus]
 ref|XP_008069643.1| PREDICTED: proteasome subunit alpha type-6 [Tarsius syrichta]
 ref|XP_008511175.1| PREDICTED: proteasome subunit alpha type-6 [Equus przewalskii]
 ref|XP_008572098.1| PREDICTED: proteasome subunit alpha type-6 [Galeopterus variegatus]
 ref|XP_008831132.1| PREDICTED: proteasome subunit alpha type-6 [Nannospalax galili]
 ref|XP_010631915.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Fukomys 
damarensis]
 ref|XP_010833601.1| PREDICTED: proteasome subunit alpha type-6 [Bison bison bison]
 ref|XP_010966161.1| PREDICTED: proteasome subunit alpha type-6 [Camelus bactrianus]
 ref|XP_010984427.1| PREDICTED: proteasome subunit alpha type-6 [Camelus dromedarius]
 ref|XP_011374978.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus vampyrus]
 sp|P60901.1|PSA6_RAT RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Rattus norvegicus]
 sp|P60900.1|PSA6_HUMAN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=27 
kDa prosomal protein; Short=PROS-27; Short=p27K; AltName: 
Full=Macropain iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota 
chain [Homo sapiens]
 sp|Q2YDE4.1|PSA6_BOVIN RecName: Full=Proteasome subunit alpha type-6 [Bos taurus]
 pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|O Chain O, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 emb|CAA42052.1| prosomal P27K protein [Homo sapiens]
 dbj|BAA01587.1| proteasome subunit R-IOTA [Rattus sp.]
 gb|AAH02979.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH17882.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH22354.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH23659.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH62232.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 gb|AAH70137.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 emb|CAG33225.1| PSMA6 [Homo sapiens]
 dbj|BAE01337.1| unnamed protein product [Macaca fascicularis]
 gb|AAI10261.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Bos taurus]
 gb|EAW65877.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_b [Homo sapiens]
 gb|ABM83272.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 gb|EDM03426.1| proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 dbj|BAG35846.1| unnamed protein product [Homo sapiens]
 gb|ACM47241.1| proteasome subunit alpha type 6 [Capra hircus]
 dbj|BAI46667.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 tpg|DAA17455.1| TPA: proteasome subunit alpha type-6 [Bos taurus]
 dbj|BAK63685.1| proteasome subunit alpha type 6 [Pan troglodytes]
 gb|EHB02978.1| Proteasome subunit alpha type-6 [Heterocephalus glaber]
 gb|EHH27823.1| hypothetical protein EGK_18113 [Macaca mulatta]
 gb|EHH63557.1| hypothetical protein EGM_16549 [Macaca fascicularis]
 gb|ELK11320.1| Proteasome subunit alpha type-6 [Pteropus alecto]
 gb|ELR59203.1| Proteasome subunit alpha type-6 [Bos mutus]
 gb|AIC63124.1| PSMA6, partial [synthetic construct]
 gb|KFO29294.1| Proteasome subunit alpha type-6 [Fukomys damarensis]
 prf||1912298A prosomal RNA-binding protein p27K
Length=246

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>gb|EDL36728.1| proteasome (prosome, macropain) subunit, alpha type 6, isoform 
CRA_b [Mus musculus]
Length=251

 Score =   133 bits (334),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  147  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  206

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  207  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  251



>ref|XP_001095366.1| PREDICTED: proteasome subunit alpha type-6-like isoform 1 [Macaca 
mulatta]
 ref|XP_001095483.1| PREDICTED: proteasome subunit alpha type-6-like isoform 2 [Macaca 
mulatta]
Length=246

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_004542308.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
 ref|XP_005724902.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005917154.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
Length=246

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GIDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GV+  +DP FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVITTQDPKFRILAETEVDTHLMSLAERD  246



>ref|XP_002824717.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pongo 
abelii]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>gb|ACO08806.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA  FLEKK+K    +++ +T++TAI+ 
Sbjct  142  GVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLEKKVKKKLDWTFAQTIETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL ++SERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLVSLSERD  246



>ref|XP_004649175.1| PREDICTED: proteasome subunit alpha type-6 [Jaculus jaculus]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  ++P FR+LS  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVDNPKFRILSEAEIDTHLVALAERD  246



>ref|XP_004093269.1| PREDICTED: LOW QUALITY PROTEIN: proteasome subunit alpha type-6 
[Nomascus leucogenys]
Length=242

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  138  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  197

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  198  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  242



>ref|XP_004470220.1| PREDICTED: proteasome subunit alpha type-6 [Dasypus novemcinctus]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTIENPKFRILTEAEIDAHLVALAERD  246



>gb|ACH70967.1| proteasome (prosome, macropain) subunit, alpha type 6-1 [Salmo 
salar]
 gb|ACI66033.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ACI70006.1| Proteasome subunit alpha type-6 [Salmo salar]
 emb|CDQ70650.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA  FLEKK+K    +++ +T++TAI+ 
Sbjct  142  GVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLEKKVKKKLDWTFAQTIETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL ++SERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLVSLSERD  246



>ref|NP_001002589.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAH76196.1| Zgc:92716 [Danio rerio]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+ V+TAI+ 
Sbjct  142  GLDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQAVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+LS  E+D HL ++SERD
Sbjct  202  LTTVLSIDFKPSELEIGVITAEDPKFRILSESEVDTHLVSLSERD  246



>gb|ACO08382.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA  FLEKK+K    +++ +T++TAI+ 
Sbjct  142  GVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLEKKVKKKLDWTFAQTIETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL ++SERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLVSLSERD  246



>gb|ACI69778.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA  FLEKK+K    +++ +T++TAI+ 
Sbjct  142  GVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATTFLEKKVKKKLDWTFAQTIETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL ++SERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILTETEIDVHLVSLSERD  246



>gb|ACO51961.1| Proteasome subunit alpha type-6 [Rana catesbeiana]
Length=246

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E++V+TAIS 
Sbjct  142  GVDEETGPQVYKCDPAGYYCGFKATTAGVKQTEATSFLEKKVKKKFDWTFEQSVETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  +DP FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTVQDPKFRILTEAEIDVHLVALAERD  246



>ref|XP_007180773.1| PREDICTED: proteasome subunit alpha type-6 [Balaenoptera acutorostrata 
scammoni]
Length=246

 Score =   132 bits (332),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDVHLVALAERD  246



>ref|XP_004559366.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
Length=246

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFKCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++YE+T++ AIS 
Sbjct  142  GIDEELGPQLFKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTYEQTIEAAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  ++P F++LS  EID HL  +SER+
Sbjct  202  LSTVLSIDFKPSELEIGVITAQEPKFKILSEAEIDAHLMTLSERE  246



>gb|ESA18832.1| hypothetical protein GLOINDRAFT_344383 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71315.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=245

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  +E GPQLFKCDPAG++ G+KA +AG K+QEA+N LEKK+K D    +E+TV+ AI+ 
Sbjct  141  GYDDERGPQLFKCDPAGYYVGYKATAAGAKQQEALNHLEKKLKKDPVLDFEETVELAINT  200

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L SVL  DFK++EIE+ VV ++DP FR LS  EID+HL  I E+D
Sbjct  201  LSSVLSADFKSTEIEVAVVTKDDPKFRTLSINEIDDHLQRIVEKD  245



>ref|XP_003059392.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56524.1| predicted protein [Micromonas pusilla CCMP1545]
Length=249

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXA---FSYEKTVQTA  334
            GI EE GP LFK DPAG+  G+KA SAGVKEQEAINFLEKK+K + A   F   +T+QTA
Sbjct  142  GIDEEKGPCLFKNDPAGYCVGYKATSAGVKEQEAINFLEKKVKGENAGNAFDETETIQTA  201

Query  333  ISALQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            IS LQSVL ED K+ E+E+G+V  E+ +FR+LS+  I+EHLTAISERD
Sbjct  202  ISCLQSVLGEDLKSKELEVGIVTTENKNFRLLSSDVIEEHLTAISERD  249



>ref|XP_006117859.1| PREDICTED: proteasome subunit alpha type-6, partial [Pelodiscus 
sinensis]
Length=236

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  132  GVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKYDWTFEQTVETAITC  191

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  192  LSTVLSIDFKPSELEVGVVTVENPKFRILTEAEIDTHLVALAERD  236



>ref|XP_005965384.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Pantholops 
hodgsonii]
Length=279

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  175  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  234

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  235  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  279



>ref|XP_006172412.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, alpha type, 6 [Tupaia chinensis]
Length=246

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK  E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKXTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>ref|XP_004333676.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11663.1| proteasome subunit alpha type6, putative [Acanthamoeba castellanii 
str. Neff]
Length=242

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            I EE GPQL+KCDPAG + G KA  AG KEQEA NFLEKK K D     +KT++ AI+AL
Sbjct  139  IDEEEGPQLYKCDPAGSYAGFKATGAGHKEQEARNFLEKKFKTDPKLDADKTIKMAINAL  198

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            Q+VL EDFKAS+IE+GVV  + P FR LS  E+D HLT I+ERD
Sbjct  199  QTVLGEDFKASDIEVGVVTTDSPRFRRLSDDEVDRHLTEIAERD  242



>ref|XP_003924255.1| PREDICTED: proteasome subunit alpha type-6 [Saimiri boliviensis 
boliviensis]
Length=283

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  179  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  238

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  239  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  283



>ref|XP_007530301.1| PREDICTED: proteasome subunit alpha type-6 [Erinaceus europaeus]
Length=246

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  +DP FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTIDDPKFRILTEAEIDAHLVALAERD  246



>ref|XP_003756477.1| PREDICTED: proteasome subunit alpha type-6 [Sarcophilus harrisii]
Length=204

 Score =   130 bits (328),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  100  GVDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  159

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  160  LSTVLSIDFKPSELEVGVVTVENPKFRILTESEIDTHLVALAERD  204



>ref|XP_003079656.1| 20S proteasome alpha subunit A1 (ISS) [Ostreococcus tauri]
Length=173

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            + E+ GP LFKCDPAG++ G++A SAG KE EA+NFLEKK+K   +F   +T Q AISAL
Sbjct  70   MDEDRGPSLFKCDPAGYYVGYRATSAGSKEVEAVNFLEKKVKAGSSFDANETAQLAISAL  129

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            Q VL E+ KASE+E+ +V  ++P+FRV+S  +++EHLTAISERD
Sbjct  130  QHVLGEEVKASELEVAIVTADNPAFRVISESQVEEHLTAISERD  173



>ref|NP_001031340.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AEC05980.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=220

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GP L+KCDPAGHF+GHKA SAG+KEQEA+NFLEKKMK + AF+Y++TVQTAISA
Sbjct  142  GIDEERGPLLYKCDPAGHFYGHKATSAGMKEQEAVNFLEKKMKENPAFTYDETVQTAISA  201

Query  324  LQSVLQEDFKASEIEI  277
            LQSVLQEDFKA+EIE+
Sbjct  202  LQSVLQEDFKATEIEV  217



>ref|XP_005865030.1| PREDICTED: proteasome subunit alpha type-6 [Myotis brandtii]
 gb|EPQ06979.1| Proteasome subunit alpha type-6 [Myotis brandtii]
Length=246

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG + G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGSYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD  246



>ref|XP_004637142.1| PREDICTED: proteasome subunit alpha type-6 [Octodon degus]
Length=244

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  140  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  199

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  ++P FR+L+  EID HL A++ERD
Sbjct  200  LSTVLSIDFKPSEIEVGVVTVDNPKFRILTEAEIDAHLVALAERD  244



>ref|XP_006015430.1| PREDICTED: proteasome subunit alpha type-6 [Alligator sinensis]
Length=382

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    ++YE+TV+TAI+ 
Sbjct  278  GVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTYEQTVETAITC  337

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  338  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDTHLVALAERD  382



>gb|ABM86477.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
Length=246

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++E+D
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAEKD  246



>ref|XP_005356606.1| PREDICTED: proteasome subunit alpha type-6-like [Microtus ochrogaster]
Length=242

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++   KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  138  GIDEEQGPQVYKCDPAGYYCSFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  197

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL A++ERD
Sbjct  198  LSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLVALAERD  242



>ref|XP_006985315.1| PREDICTED: proteasome subunit alpha type-6 [Peromyscus maniculatus 
bairdii]
Length=246

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI  E GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDGEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+LS  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILSEAEIDAHLVALAERD  246



>ref|XP_001418143.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96436.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=246

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
             + E+ GP LFKCDPAG+F G+ A SAG KE EA+NFLEKK+K+  +F   +T Q AISA
Sbjct  142  AVDEDRGPSLFKCDPAGYFVGYSATSAGAKEVEAVNFLEKKVKSGASFDVNQTAQLAISA  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            LQ VL E+ KASE+E+ VV  ++P+FRV+S  E+++HLT+ISERD
Sbjct  202  LQHVLGEEVKASELEVAVVTADNPNFRVISESEVEDHLTSISERD  246



>ref|XP_001363110.1| PREDICTED: proteasome subunit alpha type-6 [Monodelphis domestica]
Length=246

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GVDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTVENPKFRILTESEIDTHLVALAERD  246



>ref|XP_005562133.1| PREDICTED: proteasome subunit alpha type-6-like [Macaca fascicularis]
Length=245

 Score =   131 bits (329),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  141  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  200

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  201  LSTVLSIDFKPSETEVGVVTVENPKFRILTEAEIDAHLVALAERD  245



>gb|ETI45522.1| hypothetical protein F443_09944 [Phytophthora parasitica P1569]
 gb|ETK85476.1| hypothetical protein L915_09741 [Phytophthora parasitica]
 gb|ETL38875.1| hypothetical protein L916_09645 [Phytophthora parasitica]
 gb|ETL92024.1| hypothetical protein L917_09568 [Phytophthora parasitica]
 gb|ETM45321.1| hypothetical protein L914_09611 [Phytophthora parasitica]
 gb|ETO74136.1| hypothetical protein F444_10040 [Phytophthora parasitica P1976]
 gb|ETP15302.1| hypothetical protein F441_09894 [Phytophthora parasitica CJ01A1]
 gb|ETP43379.1| hypothetical protein F442_09848 [Phytophthora parasitica P10297]
Length=242

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            + +E GPQLFK DPAGHF+G+KA SAGVKEQEA N+LEKK+K + A  YE T+ TAI+ L
Sbjct  140  VDDEKGPQLFKIDPAGHFWGYKATSAGVKEQEAQNYLEKKIKANPAMDYETTLHTAITCL  199

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            QSVL  DF+ +EIE+GVV Q    FR L+  EI+ HLTAISERD
Sbjct  200  QSVLSADFRPNEIEVGVVVQGQ-RFRQLTEDEIETHLTAISERD  242



>emb|CDQ90937.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++++TV+TAI+ 
Sbjct  142  GVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFKETVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILTESEVDVHLVSLAERD  246



>ref|XP_005285405.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysemys 
picta bellii]
Length=246

 Score =   130 bits (328),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+T I+ 
Sbjct  142  GIDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKYDWTFEQTVETGITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTVENPKFRILTEAEIDTHLVALAERD  246



>ref|XP_007436765.1| PREDICTED: proteasome subunit alpha type-6 [Python bivittatus]
Length=246

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE  PQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEENNPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKLDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIEIGVV  ++P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEIGVVTVDNPKFRILTEAEIDTHLVALAERD  246



>ref|XP_001640650.1| predicted protein [Nematostella vectensis]
 gb|EDO48587.1| predicted protein [Nematostella vectensis]
Length=246

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQL+K DPAG+F G KA S GVK+ EA +FLEKK+K   A+++ +TV+TAIS 
Sbjct  142  GIDEEKGPQLYKTDPAGYFCGFKACSVGVKQTEANSFLEKKVKKKHAWTFNETVETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L SVL  DFK SE+E+GVV  ++P FR L+  EID HL AI+ERD
Sbjct  202  LSSVLSADFKPSELEVGVVSMDNPRFRKLTEAEIDTHLVAIAERD  246



>ref|XP_006065991.1| PREDICTED: proteasome subunit alpha type-6-like [Bubalus bubalis]
Length=246

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GVDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  ++P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVKNPKFRILTEAEIDAHLVALAERD  246



>ref|XP_004653726.1| PREDICTED: proteasome subunit alpha type-6-like [Jaculus jaculus]
Length=246

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G  EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GTDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  ++P FR+LS  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVDNPKFRILSEAEIDTHLVALAERD  246



>ref|XP_003471921.1| PREDICTED: proteasome subunit alpha type-6 [Cavia porcellus]
Length=246

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+ AI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVEIAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAERD  246



>pdb|4R3O|A Chain A, Human Constitutive 20s Proteasome
 pdb|4R3O|O Chain O, Human Constitutive 20s Proteasome
 pdb|4R67|A Chain A, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|O Chain O, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|CC Chain c, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|QQ Chain q, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=244

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  141  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  200

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISER  193
            L +VL  DFK SEIE+GVV  E+P FR+L+  EID HL A++ER
Sbjct  201  LSTVLSIDFKPSEIEVGVVTVENPKFRILTEAEIDAHLVALAER  244



>ref|XP_001511492.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ornithorhynchus 
anatinus]
Length=246

 Score =   130 bits (328),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GVDEEHGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  E+P FR+L+  EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTVENPKFRILTESEIDTHLVALAERD  246



>ref|XP_011396415.1| Proteasome subunit alpha type-6 [Auxenochlorella protothecoides]
 gb|KFM23542.1| Proteasome subunit alpha type-6 [Auxenochlorella protothecoides]
Length=212

 Score =   129 bits (325),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQLFK DPAG+F G++A + G KEQEAIN+LEKK++ D + S + TVQ AISA
Sbjct  107  GIDEERGPQLFKVDPAGYFVGYRATATGPKEQEAINYLEKKIRPDLSLSADDTVQMAISA  166

Query  324  LQSVLQEDFKASEIEIGVVRQEDPS-FRVLSTVEIDEHLTAISERD  190
            LQ+VL ED KA+++E+G+    +   FRVL+  E++EH+ AISERD
Sbjct  167  LQNVLAEDLKATDLEVGIAETSNGGLFRVLTNAEVEEHIVAISERD  212



>gb|ACI66289.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ADM16303.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   130 bits (327),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++++TV+TAI+ 
Sbjct  142  GVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFKETVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILTESEVDIHLVSLAERD  246



>ref|XP_002902293.1| proteasome subunit alpha type-6, putative [Phytophthora infestans 
T30-4]
 gb|EEY56965.1| proteasome subunit alpha type-6, putative [Phytophthora infestans 
T30-4]
Length=242

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            + +E GPQLFK DPAGHF+G+KA SAGVKEQEA N+LEKK+K + A  YE T+ TAI+ L
Sbjct  140  VDDEKGPQLFKIDPAGHFWGYKATSAGVKEQEAQNYLEKKIKANPAMDYETTLHTAITCL  199

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            QSVL  DF+ +EIE+GVV  E   FR L+  EI+ HLTAISERD
Sbjct  200  QSVLSADFRPNEIEVGVV-VEGQRFRQLTEDEIEAHLTAISERD  242



>ref|XP_010876973.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++ +TV+ AI+ 
Sbjct  142  GVDEECGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFAQTVEMAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+EIGV+  EDP FR+L+  EID HL ++SERD
Sbjct  202  LSTVLSIDFKPSELEIGVITTEDPKFRILTESEIDVHLVSLSERD  246



>ref|XP_005810950.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  ++P FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTTQEPKFRILTESEVDTHLMSLAERD  246



>ref|NP_001279159.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Callorhinchus 
milii]
 gb|AFM88302.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++Y++TV+TAI+ 
Sbjct  142  GVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTYDQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIEIGVV  ++P FR+ +  E D HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEIGVVSVDNPKFRIFTETETDVHLVALAERD  246



>ref|XP_008396439.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GVDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  ++P FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTTQEPKFRILTESEVDAHLMSLAERD  246



>ref|XP_003216618.1| PREDICTED: proteasome subunit alpha type-6 [Anolis carolinensis]
Length=246

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE  PQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEENNPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKLDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIEIGVV  ++P FR+L+  E+D HL A++ERD
Sbjct  202  LSTVLSIDFKPSEIEIGVVTVDNPKFRILTEAEVDTHLVALAERD  246



>ref|XP_009526410.1| hypothetical protein PHYSODRAFT_285915 [Phytophthora sojae]
 gb|EGZ17352.1| hypothetical protein PHYSODRAFT_285915 [Phytophthora sojae]
Length=242

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            + +E GPQLFK DPAGHF+G+KA SAGVKEQEA N+LEKK+K + A  YE T+ TAI+ L
Sbjct  140  VDDEKGPQLFKIDPAGHFWGYKATSAGVKEQEAQNYLEKKIKANPAMDYETTLHTAITCL  199

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            QSVL  DF+ +EIE+GVV Q    FR L   EI+ HLTAISERD
Sbjct  200  QSVLSADFRPNEIEVGVVVQGQ-RFRKLPEDEIEAHLTAISERD  242



>ref|NP_001132944.1| proteasome subunit alpha type-6 [Sus scrofa]
 gb|ACJ06406.1| proteasome subunit alpha type 6 [Sus scrofa]
Length=246

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ E+ +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDEEQGPQVYKCDPAGYYCGFKATAAGVKQTESTSFLEKKVKKKFDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIE+GVV  E+P FR+ +  EID HL A++ERD
Sbjct  202  LFTVLSIDFKPSEIEVGVVTVENPKFRIFTEAEIDAHLVALAERD  246



>emb|CEF98211.1| Proteasome A-type subunit [Ostreococcus tauri]
Length=246

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = -3

Query  501  IXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISAL  322
            + E+ GP LFKCDPAG++ G++A SAG KE EA+NFLEKK+K   +F   +T Q AISAL
Sbjct  143  MDEDRGPSLFKCDPAGYYVGYRATSAGSKEVEAVNFLEKKVKAGSSFDANETAQLAISAL  202

Query  321  QSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            Q VL E+ KASE+E+ +V  ++P+FRV+S  +++EHLTAISERD
Sbjct  203  QHVLGEEVKASELEVAIVTADNPAFRVISESQVEEHLTAISERD  246



>ref|XP_005989234.1| PREDICTED: proteasome subunit alpha type-6 [Latimeria chalumnae]
Length=246

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI +E GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+TV+TAI+ 
Sbjct  142  GIDQEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  ++P FR+L   EID HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTVDNPKFRILRESEIDAHLVALAERD  246



>ref|XP_004083706.1| PREDICTED: proteasome subunit alpha type-6 [Oryzias latipes]
Length=246

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 81/105 (77%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            GI EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GIDEEFGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  +D  FR+L+  E+D HL A++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTTQDHKFRILTEAEVDTHLMALAERD  246



>ref|XP_007569003.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 82/105 (78%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    +++E+T++TAIS 
Sbjct  142  GMDEEYGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTFEQTIETAISC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SE+E+GVV  ++P FR+L+  E+D HL +++ERD
Sbjct  202  LSTVLSIDFKPSELEVGVVTTQEPKFRILTESEVDTHLMSLAERD  246



>gb|AFK10987.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   129 bits (325),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  504  GIXEEXGPQLFKCDPAGHFFGHKAXSAGVKEQEAINFLEKKMKNDXAFSYEKTVQTAISA  325
            G+ EE GPQ++KCDPAG++ G KA +AGVK+ EA +FLEKK+K    ++Y++TV+TAI+ 
Sbjct  142  GVDEELGPQVYKCDPAGYYCGFKATAAGVKQTEATSFLEKKVKKKLDWTYDQTVETAITC  201

Query  324  LQSVLQEDFKASEIEIGVVRQEDPSFRVLSTVEIDEHLTAISERD  190
            L +VL  DFK SEIEIGVV  ++P FR+ +  E D HL A++ERD
Sbjct  202  LSTVLPIDFKPSEIEIGVVSVDNPKFRIFTETETDVHLVALAERD  246



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905