BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037J18

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    308   2e-100   Nicotiana sylvestris
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    303   3e-98    Nicotiana tomentosiformis
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    299   7e-97    Solanum lycopersicum
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    299   8e-97    Solanum tuberosum [potatoes]
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    294   7e-95    Sesamum indicum [beniseed]
emb|CDP04798.1|  unnamed protein product                                292   5e-94    Coffea canephora [robusta coffee]
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    291   1e-93    Nelumbo nucifera [Indian lotus]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               288   3e-93    Erythranthe guttata [common monkey flower]
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             289   4e-93    
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    291   4e-93    Sesamum indicum [beniseed]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    289   6e-93    Camelina sativa [gold-of-pleasure]
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             289   7e-93    Eutrema salsugineum [saltwater cress]
ref|XP_002515557.1|  conserved hypothetical protein                     288   2e-92    
ref|NP_196703.1|  uncharacterized protein                               288   2e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    288   2e-92    Camelina sativa [gold-of-pleasure]
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             287   4e-92    
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             286   6e-92    Capsella rubella
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    286   7e-92    Camelina sativa [gold-of-pleasure]
gb|AAN31807.1|  unknown protein                                         286   8e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         286   9e-92    Jatropha curcas
gb|AAM63507.1|  unknown                                                 285   1e-91    Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57107.1|  AT5G25460                                              279   2e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    284   5e-91    Brassica rapa
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             282   2e-90    Capsella rubella
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    282   3e-90    Tarenaya hassleriana [spider flower]
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    282   3e-90    Camelina sativa [gold-of-pleasure]
dbj|BAD93856.1|  hypothetical protein                                   277   3e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    282   3e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    282   3e-90    Nelumbo nucifera [Indian lotus]
emb|CDX85713.1|  BnaA02g01000D                                          282   3e-90    
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    282   3e-90    Brassica rapa
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    282   4e-90    Arabis alpina [alpine rockcress]
emb|CDX91217.1|  BnaC02g03800D                                          282   4e-90    
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    282   4e-90    Camelina sativa [gold-of-pleasure]
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    281   5e-90    Arabis alpina [alpine rockcress]
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    281   6e-90    Tarenaya hassleriana [spider flower]
emb|CDY19801.1|  BnaA09g04540D                                          281   7e-90    Brassica napus [oilseed rape]
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    280   3e-89    Cucumis sativus [cucumbers]
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             279   4e-89    Eutrema salsugineum [saltwater cress]
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     279   4e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             279   6e-89    Arabidopsis lyrata subsp. lyrata
emb|CDX97108.1|  BnaC09g45170D                                          278   7e-89    
gb|AAL06839.1|  AT5g25460/F18G18_200                                    279   7e-89    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    277   8e-89    Eucalyptus grandis [rose gum]
gb|AAM61720.1|  unknown                                                 278   2e-88    Arabidopsis thaliana [mouse-ear cress]
gb|EPS73289.1|  hypothetical protein M569_01466                         277   2e-88    Genlisea aurea
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             278   2e-88    
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    277   2e-88    Tarenaya hassleriana [spider flower]
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    277   2e-88    Citrus sinensis [apfelsine]
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    277   3e-88    Brassica rapa
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    277   3e-88    Prunus mume [ume]
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    277   3e-88    Brassica rapa
emb|CDY54909.1|  BnaC02g48660D                                          276   4e-88    Brassica napus [oilseed rape]
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    276   6e-88    Fragaria vesca subsp. vesca
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             276   8e-88    Prunus persica
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    276   9e-88    Vitis vinifera
gb|KHG29602.1|  Allergen Act d 3                                        276   1e-87    Gossypium arboreum [tree cotton]
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    277   1e-87    
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             275   2e-87    Citrus clementina [clementine]
gb|KJB80694.1|  hypothetical protein B456_013G110800                    273   2e-87    Gossypium raimondii
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    275   2e-87    Pyrus x bretschneideri [bai li]
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    274   3e-87    Pyrus x bretschneideri [bai li]
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    273   3e-87    Populus euphratica
gb|KJB80693.1|  hypothetical protein B456_013G110800                    274   4e-87    Gossypium raimondii
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    274   5e-87    Populus euphratica
emb|CDX80516.1|  BnaC07g29280D                                          271   6e-87    
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             273   7e-87    Phaseolus vulgaris [French bean]
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    272   1e-86    
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    273   1e-86    
emb|CAA22573.1|  putative protein                                       271   1e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             271   1e-86    
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    272   2e-86    Glycine max [soybeans]
gb|KHN06654.1|  hypothetical protein glysoja_037506                     272   2e-86    Glycine soja [wild soybean]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    272   2e-86    
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             271   4e-86    Arabidopsis lyrata subsp. lyrata
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             271   5e-86    
gb|KJB07801.1|  hypothetical protein B456_001G045200                    271   5e-86    Gossypium raimondii
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    271   6e-86    Populus euphratica
gb|KJB07802.1|  hypothetical protein B456_001G045200                    271   6e-86    Gossypium raimondii
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               271   7e-86    Gossypium arboreum [tree cotton]
gb|ABK94923.1|  unknown                                                 271   7e-86    Populus trichocarpa [western balsam poplar]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          270   7e-86    
ref|NP_567894.1|  uncharacterized protein                               271   9e-86    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  270   2e-85    Theobroma cacao [chocolate]
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             271   2e-85    
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    269   3e-85    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  267   5e-85    
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  270   6e-85    
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    268   7e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    268   9e-85    Camelina sativa [gold-of-pleasure]
dbj|BAE98407.1|  hypothetical protein                                   268   1e-84    Arabidopsis thaliana [mouse-ear cress]
emb|CDX68849.1|  BnaC01g06040D                                          267   2e-84    
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    267   2e-84    Brassica rapa
emb|CDX69757.1|  BnaA10g21060D                                          284   2e-84    
gb|ACJ84308.1|  unknown                                                 268   2e-84    Medicago truncatula
gb|AES58962.2|  plant/F18G18-200 protein                                268   2e-84    Medicago truncatula
emb|CAA06490.1|  hypothetical protein                                   259   6e-84    Cicer arietinum [garbanzo]
gb|AAB41813.1|  unknown protein                                         265   2e-83    Medicago sativa [alfalfa]
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    265   2e-83    Elaeis guineensis
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    264   3e-83    Cicer arietinum [garbanzo]
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    264   3e-83    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    262   2e-82    Eucalyptus grandis [rose gum]
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    261   5e-82    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    260   9e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    259   5e-81    Phoenix dactylifera
ref|XP_010106829.1|  hypothetical protein L484_006602                   253   5e-81    
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    258   6e-81    Vitis vinifera
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    258   8e-81    
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    258   8e-81    Elaeis guineensis
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    257   2e-80    Nicotiana sylvestris
emb|CBI36253.3|  unnamed protein product                                258   2e-80    Vitis vinifera
gb|KHG21629.1|  GTPase Der                                              254   2e-80    Gossypium arboreum [tree cotton]
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    256   3e-80    Solanum lycopersicum
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    256   4e-80    Phoenix dactylifera
gb|KHN07098.1|  hypothetical protein glysoja_023281                     255   4e-80    Glycine soja [wild soybean]
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 256   4e-80    Theobroma cacao [chocolate]
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    256   4e-80    Solanum lycopersicum
gb|KHN07099.1|  hypothetical protein glysoja_023282                     256   5e-80    Glycine soja [wild soybean]
gb|KJB70569.1|  hypothetical protein B456_011G080100                    254   6e-80    Gossypium raimondii
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    256   6e-80    
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    256   7e-80    Nicotiana tomentosiformis
gb|KJB70568.1|  hypothetical protein B456_011G080100                    255   1e-79    Gossypium raimondii
gb|KHG06895.1|  Agmatine deiminase                                      255   1e-79    Gossypium arboreum [tree cotton]
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    255   1e-79    Nicotiana tomentosiformis
ref|XP_010110340.1|  GTP-binding nuclear protein                        260   2e-79    
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    254   2e-79    
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    253   7e-79    Solanum tuberosum [potatoes]
ref|XP_002517567.1|  conserved hypothetical protein                     253   7e-79    Ricinus communis
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    252   1e-78    Nicotiana sylvestris
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            249   2e-78    Phaseolus vulgaris [French bean]
gb|KHG10708.1|  Allergen Act d 3                                        251   3e-78    Gossypium arboreum [tree cotton]
gb|AFK48067.1|  unknown                                                 245   4e-78    Lotus japonicus
gb|AGV54541.1|  hypothetical protein                                    251   6e-78    Phaseolus vulgaris [French bean]
gb|KJB68131.1|  hypothetical protein B456_010G227400                    250   9e-78    Gossypium raimondii
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    250   1e-77    
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    249   2e-77    Sesamum indicum [beniseed]
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    249   3e-77    Cicer arietinum [garbanzo]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    249   4e-77    Glycine max [soybeans]
gb|KHN47787.1|  hypothetical protein glysoja_029205                     248   5e-77    Glycine soja [wild soybean]
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    248   7e-77    Eucalyptus grandis [rose gum]
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    248   7e-77    Nicotiana tomentosiformis
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         247   1e-76    Jatropha curcas
dbj|BAK03126.1|  predicted protein                                      247   2e-76    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             246   2e-76    
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    248   3e-76    
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     246   3e-76    Glycine max [soybeans]
gb|KHN44154.1|  hypothetical protein glysoja_031815                     246   4e-76    Glycine soja [wild soybean]
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    246   5e-76    Populus euphratica
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    246   7e-76    Nicotiana sylvestris
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       243   9e-76    Triticum urartu
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    244   2e-75    Solanum lycopersicum
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  244   3e-75    Medicago truncatula
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             244   4e-75    Prunus persica
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    243   4e-75    Malus domestica [apple tree]
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    243   4e-75    Prunus mume [ume]
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    243   4e-75    Pyrus x bretschneideri [bai li]
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    243   4e-75    Pyrus x bretschneideri [bai li]
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    242   5e-75    Fragaria vesca subsp. vesca
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    243   5e-75    Malus domestica [apple tree]
gb|EMT16005.1|  hypothetical protein F775_13621                         242   8e-75    
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    242   1e-74    Populus euphratica
dbj|BAD16016.1|  unknown protein                                        239   2e-74    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    242   2e-74    Citrus sinensis [apfelsine]
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    242   2e-74    Fragaria vesca subsp. vesca
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                240   5e-74    Erythranthe guttata [common monkey flower]
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          240   6e-74    
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             241   7e-74    Populus trichocarpa [western balsam poplar]
gb|EEE56530.1|  hypothetical protein OsJ_05823                          240   8e-74    Oryza sativa Japonica Group [Japonica rice]
gb|EEC72709.1|  hypothetical protein OsI_06304                          240   1e-73    Oryza sativa Indica Group [Indian rice]
ref|NP_001046247.2|  Os02g0205200                                       239   2e-73    
gb|KJB70570.1|  hypothetical protein B456_011G080200                    233   2e-73    Gossypium raimondii
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    238   4e-73    Arabis alpina [alpine rockcress]
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   236   4e-73    Citrus sinensis [apfelsine]
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    238   4e-73    Tarenaya hassleriana [spider flower]
gb|KHG21630.1|  Adenosylhomocysteinase                                  238   5e-73    Gossypium arboreum [tree cotton]
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                238   6e-73    Erythranthe guttata [common monkey flower]
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             238   6e-73    Arabidopsis lyrata subsp. lyrata
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    237   1e-72    Setaria italica
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             237   1e-72    Citrus clementina [clementine]
emb|CDO98109.1|  unnamed protein product                                235   2e-72    Coffea canephora [robusta coffee]
ref|XP_010088264.1|  hypothetical protein L484_005140                   236   3e-72    Morus notabilis
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             235   5e-72    Citrus clementina [clementine]
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    235   5e-72    Camelina sativa [gold-of-pleasure]
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    235   6e-72    Camelina sativa [gold-of-pleasure]
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               235   8e-72    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             234   1e-71    Capsella rubella
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    233   3e-71    Camelina sativa [gold-of-pleasure]
emb|CDY54317.1|  BnaC06g43150D                                          232   1e-70    Brassica napus [oilseed rape]
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    229   1e-69    
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    228   2e-69    Nelumbo nucifera [Indian lotus]
emb|CDY57694.1|  BnaA07g38340D                                          228   3e-69    Brassica napus [oilseed rape]
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    229   6e-69    Brassica rapa
dbj|BAD52536.1|  unknown protein                                        225   7e-69    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001140426.1|  hypothetical protein precursor                     226   1e-68    Zea mays [maize]
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    225   6e-68    Nelumbo nucifera [Indian lotus]
emb|CDO98108.1|  unnamed protein product                                225   6e-68    Coffea canephora [robusta coffee]
dbj|BAB21293.1|  unknown protein                                        225   7e-68    Oryza sativa Japonica Group [Japonica rice]
emb|CDP07813.1|  unnamed protein product                                224   1e-67    Coffea canephora [robusta coffee]
gb|ABF99456.1|  expressed protein                                       222   1e-67    Oryza sativa Japonica Group [Japonica rice]
ref|NP_001043549.2|  Os01g0611000                                       225   1e-67    
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    224   2e-67    Eucalyptus grandis [rose gum]
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    223   3e-67    Tarenaya hassleriana [spider flower]
ref|XP_002517797.1|  conserved hypothetical protein                     223   3e-67    Ricinus communis
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          223   5e-67    Amborella trichopoda
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         222   5e-67    Jatropha curcas
gb|EAY92272.1|  hypothetical protein OsI_13995                          221   1e-66    Oryza sativa Indica Group [Indian rice]
dbj|BAK03627.1|  predicted protein                                      221   1e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             221   1e-66    Eutrema salsugineum [saltwater cress]
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    221   2e-66    Cucumis sativus [cucumbers]
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    221   2e-66    Brachypodium distachyon [annual false brome]
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          221   2e-66    
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    221   3e-66    Setaria italica
ref|NP_001051644.1|  Os03g0807700                                       221   3e-66    
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             219   6e-66    Populus trichocarpa [western balsam poplar]
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    219   8e-66    Populus euphratica
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    219   9e-66    Populus euphratica
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    219   1e-65    Vitis vinifera
gb|EMT06486.1|  hypothetical protein F775_26416                         219   1e-65    
ref|XP_007052493.1|  F17A17.37 protein                                  219   2e-65    
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    218   2e-65    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                216   3e-65    Erythranthe guttata [common monkey flower]
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             215   3e-65    
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    217   5e-65    Cucumis melo [Oriental melon]
gb|KJB24990.1|  hypothetical protein B456_004G171200                    218   5e-65    Gossypium raimondii
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    217   6e-65    Brachypodium distachyon [annual false brome]
gb|EMT25156.1|  hypothetical protein F775_26385                         218   7e-65    
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    217   7e-65    Prunus mume [ume]
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    217   7e-65    Fragaria vesca subsp. vesca
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          217   8e-65    
dbj|BAJ89665.1|  predicted protein                                      218   8e-65    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              217   9e-65    Gossypium arboreum [tree cotton]
gb|KJB24991.1|  hypothetical protein B456_004G171200                    218   1e-64    Gossypium raimondii
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    217   1e-64    Setaria italica
gb|AGV54808.1|  hypothetical protein                                    216   1e-64    Phaseolus vulgaris [French bean]
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             216   2e-64    Phaseolus vulgaris [French bean]
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    216   2e-64    Nicotiana sylvestris
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     216   2e-64    Glycine max [soybeans]
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     216   2e-64    Glycine max [soybeans]
gb|KHN45084.1|  hypothetical protein glysoja_040000                     216   2e-64    Glycine soja [wild soybean]
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             215   3e-64    Prunus persica
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    215   3e-64    Solanum tuberosum [potatoes]
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    215   4e-64    Phoenix dactylifera
gb|KHN11697.1|  hypothetical protein glysoja_006150                     215   5e-64    Glycine soja [wild soybean]
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    214   5e-64    Populus euphratica
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    216   5e-64    
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    214   5e-64    Elaeis guineensis
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             215   6e-64    
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    213   9e-64    
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             214   9e-64    Populus trichocarpa [western balsam poplar]
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          214   1e-63    Sorghum bicolor [broomcorn]
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    214   1e-63    Nicotiana tomentosiformis
gb|AFK39561.1|  unknown                                                 214   1e-63    Medicago truncatula
gb|AFK39148.1|  unknown                                                 214   1e-63    Lotus japonicus
gb|AFK34548.1|  unknown                                                 214   1e-63    Lotus japonicus
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    214   1e-63    Nelumbo nucifera [Indian lotus]
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    213   2e-63    Populus euphratica
gb|KEH17090.1|  DUF642 family protein                                   213   2e-63    Medicago truncatula
gb|AFK44456.1|  unknown                                                 207   2e-63    Lotus japonicus
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             213   2e-63    
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    213   2e-63    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB36028.1|  hypothetical protein B456_006G137000                    213   3e-63    Gossypium raimondii
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    213   3e-63    Eucalyptus grandis [rose gum]
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             213   4e-63    Populus trichocarpa [western balsam poplar]
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     213   4e-63    
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             212   4e-63    Eutrema salsugineum [saltwater cress]
gb|KHG07966.1|  Imidazolonepropionase                                   212   5e-63    Gossypium arboreum [tree cotton]
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    212   5e-63    
gb|KJB19256.1|  hypothetical protein B456_003G091800                    210   6e-63    Gossypium raimondii
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    212   6e-63    Glycine max [soybeans]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    214   8e-63    Prunus mume [ume]
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              212   9e-63    
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    211   1e-62    Pyrus x bretschneideri [bai li]
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    211   1e-62    Nelumbo nucifera [Indian lotus]
ref|XP_007028767.1|  F17A17.37 protein                                  211   1e-62    
gb|KJB19257.1|  hypothetical protein B456_003G091800                    210   2e-62    Gossypium raimondii
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  211   2e-62    
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    210   3e-62    Brassica rapa
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         210   3e-62    Jatropha curcas
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    210   4e-62    Cicer arietinum [garbanzo]
gb|AES87990.2|  DUF642 family protein                                   210   4e-62    
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  210   4e-62    
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    209   4e-62    
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    209   5e-62    
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    209   7e-62    
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    209   9e-62    
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    208   1e-61    
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    208   1e-61    
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    208   1e-61    
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             208   2e-61    
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    208   2e-61    
emb|CAH67378.1|  OSIGBa0159F11.2                                        207   3e-61    
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   207   3e-61    
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    207   3e-61    
gb|KHN32410.1|  hypothetical protein glysoja_026304                     206   4e-61    
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  206   4e-61    
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    207   6e-61    
emb|CDX79912.1|  BnaA05g02440D                                          209   6e-61    
gb|EAY74932.1|  hypothetical protein OsI_02826                          206   8e-61    
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                206   8e-61    
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    206   9e-61    
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    206   1e-60    
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         206   1e-60    
gb|ACG40327.1|  hypothetical protein                                    206   1e-60    
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    206   1e-60    
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    206   1e-60    
ref|XP_002532070.1|  conserved hypothetical protein                     206   1e-60    
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    211   2e-60    
ref|NP_181712.1|  uncharacterized protein                               204   5e-60    
emb|CAE01677.2|  OSJNBb0091E11.19                                       204   5e-60    
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             204   5e-60    
ref|NP_001145978.1|  hypothetical protein                               206   5e-60    
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    204   5e-60    
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             204   7e-60    
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    204   7e-60    
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    204   8e-60    
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             204   9e-60    
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             203   1e-59    
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  203   2e-59    
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             202   4e-59    
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    202   4e-59    
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    202   5e-59    
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    202   5e-59    
ref|NP_001053188.1|  Os04g0494600                                       202   7e-59    
emb|CDY48765.1|  BnaC04g02180D                                          203   7e-59    
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             201   1e-58    
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    201   2e-58    
ref|NP_181711.1|  uncharacterized protein                               200   2e-58    
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             200   2e-58    
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       200   3e-58    
gb|EAY94676.1|  hypothetical protein OsI_16455                          200   3e-58    
gb|EMT04285.1|  hypothetical protein F775_14657                         200   4e-58    
emb|CAH67292.1|  OSIGBa0103O01.10                                       199   4e-58    
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             198   4e-58    
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    199   4e-58    
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    199   5e-58    
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    199   5e-58    
ref|NP_974254.1|  germination-related protein                           197   6e-58    
gb|EPS66311.1|  hypothetical protein M569_08463                         198   7e-58    
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    198   8e-58    
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    199   8e-58    
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    199   9e-58    
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    198   1e-57    
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    198   1e-57    
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                198   1e-57    
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              198   1e-57    
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    198   1e-57    
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             198   1e-57    
ref|NP_566328.1|  germination-related protein                           197   2e-57    
ref|XP_010097437.1|  hypothetical protein L484_003208                   197   2e-57    
emb|CDX79913.1|  BnaA05g02430D                                          192   2e-57    
emb|CAE01676.2|  OSJNBb0091E11.17                                       197   2e-57    
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    197   2e-57    
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    197   3e-57    
emb|CDY22149.1|  BnaC01g39520D                                          197   3e-57    
emb|CDY14785.1|  BnaC04g47820D                                          197   3e-57    
emb|CDY28002.1|  BnaC05g44040D                                          197   3e-57    
ref|NP_001053189.1|  Os04g0494800                                       197   3e-57    
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    197   4e-57    
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    197   4e-57    
emb|CDY48764.1|  BnaC04g02170D                                          191   5e-57    
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    196   5e-57    
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    196   5e-57    
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    196   1e-56    
emb|CDY06908.1|  BnaA04g24070D                                          194   4e-56    
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    194   4e-56    
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             194   5e-56    
gb|KJB36031.1|  hypothetical protein B456_006G137000                    194   8e-56    
emb|CAN80832.1|  hypothetical protein VITISV_002505                     200   8e-56    
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             193   1e-55    
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    193   1e-55    
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            193   1e-55    
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          193   1e-55    
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    192   2e-55    
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    193   2e-55    
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    192   2e-55    
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    192   3e-55    
emb|CAH67377.1|  OSIGBa0159F11.1                                        192   4e-55    
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    191   5e-55    
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    191   6e-55    
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    190   1e-54    
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          190   2e-54    
emb|CAD41548.2|  OSJNBb0091E11.18                                       190   2e-54    
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    190   2e-54    
ref|NP_001053190.1|  Os04g0494900                                       189   3e-54    
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              189   4e-54    
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    189   6e-54    
gb|EEC81716.1|  hypothetical protein OsI_25327                          189   7e-54    
ref|NP_001141282.1|  hypothetical protein precursor                     188   8e-54    
emb|CDY39990.1|  BnaC06g40680D                                          187   1e-53    
emb|CDP21696.1|  unnamed protein product                                187   2e-53    
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    187   3e-53    
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    187   3e-53    
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    187   4e-53    
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          186   8e-53    
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    185   1e-52    
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    185   2e-52    
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    184   3e-52    
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          184   4e-52    
gb|EMS63053.1|  hypothetical protein TRIUR3_01734                       182   7e-52    
emb|CDX87297.1|  BnaA07g35760D                                          182   8e-52    
dbj|BAJ96954.1|  predicted protein                                      182   2e-51    
ref|XP_004976081.1|  PREDICTED: uncharacterized protein LOC101764801    181   5e-51    
gb|EMT04284.1|  hypothetical protein F775_14656                         180   7e-51    
gb|EMS51274.1|  hypothetical protein TRIUR3_06873                       177   1e-49    
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          178   1e-49    
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             177   1e-49    
gb|AGV54847.1|  hypothetical protein                                    177   2e-49    
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    177   2e-49    
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    177   4e-49    
tpg|DAA58940.1|  TPA: hypothetical protein ZEAMMB73_364218              171   4e-49    
gb|EMS51358.1|  hypothetical protein TRIUR3_26274                       175   4e-49    
gb|EAY94679.1|  hypothetical protein OsI_16458                          174   2e-48    
ref|NP_001053191.2|  Os04g0495000                                       174   2e-48    
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          174   3e-48    
dbj|BAJ97095.1|  predicted protein                                      173   4e-48    
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  172   1e-47    
gb|ACL52831.1|  unknown                                                 165   1e-47    
gb|AGV54803.1|  hypothetical protein                                    172   2e-47    
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    172   2e-47    
ref|XP_002893594.1|  predicted protein                                  171   2e-47    
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    172   3e-47    
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    172   3e-47    
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    172   3e-47    
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    171   4e-47    
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             171   4e-47    
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    171   4e-47    
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    171   5e-47    
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    171   5e-47    
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    171   6e-47    
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    172   7e-47    
gb|AFK48735.1|  unknown                                                 171   7e-47    
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    170   9e-47    
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    170   1e-46    
dbj|BAD87481.1|  unknown protein                                        165   1e-46    
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             170   1e-46    
gb|EEE61252.1|  hypothetical protein OsJ_15312                          173   2e-46    
gb|KHN47316.1|  hypothetical protein glysoja_020184                     169   3e-46    
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    169   3e-46    
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    169   3e-46    
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             169   3e-46    
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    169   3e-46    
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    169   3e-46    
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             169   4e-46    
ref|NP_973938.1|  uncharacterized protein                               168   4e-46    
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    168   5e-46    
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    168   5e-46    
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    168   5e-46    
ref|NP_564344.1|  uncharacterized protein                               168   8e-46    
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             168   9e-46    
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    168   9e-46    
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    167   1e-45    
emb|CBI30867.3|  unnamed protein product                                167   1e-45    
gb|KHN33140.1|  La-related protein 7                                    172   1e-45    
ref|XP_002519690.1|  conserved hypothetical protein                     167   1e-45    
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             167   2e-45    
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    167   2e-45    
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         167   2e-45    
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    167   2e-45    
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    167   2e-45    
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    166   3e-45    
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                166   3e-45    
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    166   3e-45    
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 167   3e-45    
ref|XP_004978107.1|  PREDICTED: uncharacterized protein LOC101761699    166   3e-45    
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          166   3e-45    
ref|XP_008669230.1|  PREDICTED: uncharacterized protein LOC103646278    166   4e-45    
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    166   4e-45    
gb|ACN30906.1|  unknown                                                 166   4e-45    
emb|CDX84311.1|  BnaC04g10730D                                          166   4e-45    
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          166   4e-45    
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             166   5e-45    
ref|NP_180998.1|  uncharacterized protein                               166   5e-45    
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  166   5e-45    
gb|ACF86181.1|  unknown                                                 166   5e-45    
ref|NP_001143445.1|  uncharacterized protein LOC100276100               164   5e-45    
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    166   6e-45    
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             166   7e-45    
emb|CDP19178.1|  unnamed protein product                                165   7e-45    
gb|KHG06200.1|  Periplasmic nitrate reductase                           165   8e-45    
emb|CDX99870.1|  BnaC05g22920D                                          165   8e-45    
emb|CDY17255.1|  BnaA05g09330D                                          165   8e-45    
emb|CDY26302.1|  BnaA09g26530D                                          166   9e-45    
gb|EEC70811.1|  hypothetical protein OsI_02272                          166   9e-45    
gb|KJB69807.1|  hypothetical protein B456_011G043300                    165   9e-45    
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    165   1e-44    
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    165   1e-44    
gb|KHG28355.1|  putative metabolite transport                           165   1e-44    
gb|KJB69808.1|  hypothetical protein B456_011G043300                    165   1e-44    
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    165   1e-44    
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    165   1e-44    
gb|KJB57253.1|  hypothetical protein B456_009G155400                    164   1e-44    
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    165   1e-44    
gb|ACJ84883.1|  unknown                                                 160   2e-44    
gb|EMS58461.1|  hypothetical protein TRIUR3_29087                       163   2e-44    
gb|KJB57254.1|  hypothetical protein B456_009G155400                    165   2e-44    
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              165   2e-44    
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    164   2e-44    
ref|NP_001044289.1|  Os01g0756600                                       164   2e-44    
ref|XP_008663355.1|  PREDICTED: uncharacterized protein LOC103641799    164   3e-44    
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    164   4e-44    



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/186 (77%), Positives = 160/186 (86%), Gaps = 0/186 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLPAW VESLKAVKY+D++
Sbjct  188  YPPRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSD  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDASN CEGSM++EAFAG  T
Sbjct  248  HFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGMDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GGYK A LRF+ATANRTR+MF STYYHTRSDDFVSLCGPVVD VKL+SVR
Sbjct  308  LKVPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDFVSLCGPVVDDVKLLSVR  367

Query  153  NPHRRL  136
            NP R L
Sbjct  368  NPRRFL  373



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 159/186 (85%), Gaps = 0/186 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLPAW VESLKAVKY+D++
Sbjct  188  YPPRATNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSD  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RA+ELVAGKESA+ Q+ART  GK Y+L+F VGDASN CEGSM++EAFAG  T
Sbjct  248  HFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASNSCEGSMIVEAFAGRDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A LRF+A ANRTR+MF STYYHTRSDD+VSLCGPVVD VKL+SVR
Sbjct  308  LKVPYESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDYVSLCGPVVDDVKLLSVR  367

Query  153  NPHRRL  136
            NP R L
Sbjct  368  NPRRFL  373



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   299 bits (766),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/186 (76%), Positives = 158/186 (85%), Gaps = 1/186 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN DFEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKY+D++
Sbjct  186  YPPRATNQNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSD  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  246  HFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNACEGSMIVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDFVSLCGPVVD V L+SVR
Sbjct  306  LKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVTLLSVR  365

Query  153  NPHRRL  136
              HRR+
Sbjct  366  T-HRRV  370



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   299 bits (766),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 141/186 (76%), Positives = 158/186 (85%), Gaps = 1/186 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLPAW VESLKAVKY+D++
Sbjct  186  YPPRATNQNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPAWMVESLKAVKYLDSD  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVPHG+RA+ELVAGKESA+ Q+ART  GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  246  HFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASNACEGSMIVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDFVSLCGPVVD V L+SVR
Sbjct  306  LKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFVSLCGPVVDDVTLLSVR  365

Query  153  NPHRRL  136
              HRR+
Sbjct  366  T-HRRV  370



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   294 bits (753),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 153/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T  NLLKN DFEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYIDA 
Sbjct  184  YPPKATRDNLLKNGDFEEGPYVFPNTSWGVLVPPNIEDDHSPLPAWIVESLKAVKYIDAA  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVPHG+RA+ELV GKESA+ Q+ART+ GK Y+LTF +GDASN CEGSM++EAFAG  T
Sbjct  244  HFSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDASNSCEGSMIVEAFAGRDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GGYK A LRF ATA RTR+MFFSTYYH RSDDF SLCGPVVD VKL+SV 
Sbjct  304  VKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDDFASLCGPVVDDVKLLSVH  363

Query  153  NPHR  142
             P R
Sbjct  364  KPRR  367



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   292 bits (747),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 154/186 (83%), Gaps = 0/186 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T+ NL+KN DFEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDA 
Sbjct  186  YPPKATSENLVKNGDFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVPH  RAVELVAGKESA+ Q+ART+ GK Y LTFLVGDASN CEGSM++EA+AG  T
Sbjct  246  HFSVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDASNSCEGSMIVEAYAGIVT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +K+PY S+G+GGYKPA L F AT NRTR+MFFSTYYHTRSDD  SLCGPV+D VKL+SVR
Sbjct  306  VKIPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDNASLCGPVIDDVKLLSVR  365

Query  153  NPHRRL  136
            NP + +
Sbjct  366  NPRKLM  371



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   291 bits (744),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/184 (75%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN NLLKN DFEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDAE
Sbjct  186  YPPRPTNKNLLKNGDFEEGPYIFPNTSWGVLVPPNIEDDHSPLPGWMIESLKAVKYIDAE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ QIART+ GK Y LTF VGDA+NKCEGSMV+EAFA  +T
Sbjct  246  HFSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDANNKCEGSMVVEAFADRNT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GG+K A LRF A + RTR+MF ST+Y  RSDD  SLCGPVVD VKL+S+R
Sbjct  306  VKVPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDDMASLCGPVVDDVKLLSIR  365

Query  153  NPHR  142
            NP R
Sbjct  366  NPRR  369



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   288 bits (738),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 151/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPT  NLLKN DFEEG Y+ PK   GVL PP  EDD+SPLPAW VESLKAVKYID  
Sbjct  151  YPPRPTRDNLLKNGDFEEGAYILPKTSWGVLIPPNIEDDNSPLPAWMVESLKAVKYIDRA  210

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVPHG RA+ELV GKESA+ Q+ART+AGK Y LTF VGDASN CEGSM++EAFAG  T
Sbjct  211  HFSVPHGERAIELVGGKESAIAQVARTIAGKTYQLTFAVGDASNSCEGSMIVEAFAGRDT  270

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYES+G+GGYK A LRF A  NRTR+MF STYYH RSDD+ SLCGPVVD VKL+SVR
Sbjct  271  VKVPYESRGKGGYKRAVLRFVAPTNRTRIMFLSTYYHMRSDDYASLCGPVVDDVKLLSVR  330

Query  153  NPHR  142
            NP +
Sbjct  331  NPRK  334



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   289 bits (739),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D E
Sbjct  159  YPPRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVE  218

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  T
Sbjct  219  HFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDT  278

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  279  LKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  338

Query  153  NP  148
             P
Sbjct  339  KP  340



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   291 bits (744),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+PTN NLLKN DFEEG Y+FP    GVL PP  EDD+SPLPAW VESLKAVKYIDA 
Sbjct  220  YPPKPTNQNLLKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPAWMVESLKAVKYIDAA  279

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVPHG+RA+ELV GKESA+ Q+ART+ GK Y LTF VGDASN CEGSM++EAFAG  T
Sbjct  280  HFSVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDASNSCEGSMIVEAFAGRDT  339

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GGYK A LRF AT  RTR+MF ST+YH RSDD+ SLCGPVVD VKL+SVR
Sbjct  340  VKVPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYHMRSDDYASLCGPVVDDVKLLSVR  399

Query  153  NPHR  142
             P R
Sbjct  400  KPRR  403



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   289 bits (739),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPYILPNATTGVLVPPFIEDDHSPLPAWMIESLKAVKYVDVE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  246  HFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  306  LKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365

Query  153  NP  148
             P
Sbjct  366  KP  367



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   289 bits (739),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACQGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  305  LKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID +
Sbjct  183  YPPRPTNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDVD  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  243  HFSVPQGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDT  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A LRF A ANRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  303  LKVPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDFSSLCGPVLDDVKLLSVR  362

Query  153  NP  148
             P
Sbjct  363  KP  364



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW VESLKA+KY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  305  LKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSAR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   288 bits (736),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PP+ EDDHSPLPAW +ESLKAVKY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPYILPNATTGVLIPPYIEDDHSPLPAWMIESLKAVKYVDVE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  246  HFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACQGSMVVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  306  LKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365

Query  153  NP  148
             P
Sbjct  366  KP  367



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   287 bits (734),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMIESLKAIKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  305  LKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSAR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   286 bits (733),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPYILPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  246  HFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDANNACQGSMVVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+ VR
Sbjct  306  LKVPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLGVR  365

Query  153  NP  148
             P
Sbjct  366  KP  367



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   286 bits (733),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+     TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPYILSNATTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  246  HFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  306  LKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365

Query  153  NP  148
             P
Sbjct  366  KP  367



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   286 bits (732),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW VESLKA+KY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+A+TV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  305  LKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSAR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   286 bits (731),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID++
Sbjct  183  YPPRPTNKNILKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSD  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP  RRAVELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  243  HFSVPQARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDASNSCEGSMVVEAFAGKDT  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A LRF A +NRTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  303  LKVPYESKGKGGFKRAVLRFVAASNRTRIMFYSTFYTMRSDDFSSLCGPVIDDVKLLSVR  362

Query  153  NP  148
             P
Sbjct  363  KP  364



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   285 bits (730),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPT+ N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW VESLKA+KY+D E
Sbjct  185  YPPRPTSKNILKNGGFEEGPYVLPNATTGVLVPPFIEDDHSPLPAWMVESLKAIKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACQGSMVVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  305  LKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFSSLCGPVIDDVKLLSAR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>dbj|BAH57107.1| AT5G25460 [Arabidopsis thaliana]
Length=186

 Score =   279 bits (713),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  5    YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  64

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  65   HFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDT  124

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  125  LKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVR  184

Query  153  NP  148
             P
Sbjct  185  KP  186



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   284 bits (727),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKV YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV 
Sbjct  305  LKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVG  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   282 bits (722),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  189  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  249  HFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKET  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A +NR+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  309  LKVPYESRGTGGFKRASIRFVAVSNRSRIMFYSTFYSMRSDDFSSLCGPVIDDVKLISVR  368

Query  153  NP  148
             P
Sbjct  369  KP  370



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKYID E
Sbjct  184  YPPRPTNKNILKNGGFEEGPLVLPNATTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDVE  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMIVEAFAGRDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYES+G GG+K A LRF A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+SVR
Sbjct  304  IKVPYESRGTGGFKRAALRFVAASDRTRIMFYSTFYSMRSDDFSSLCGPVVDDVKLLSVR  363

Query  153  NP  148
             P
Sbjct  364  KP  365



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  188  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  248  HFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKET  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  LKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVR  367

Query  153  NP  148
             P
Sbjct  368  KP  369



>dbj|BAD93856.1| hypothetical protein [Arabidopsis thaliana]
Length=224

 Score =   277 bits (709),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  43   YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  102

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  103  HFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDT  162

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  163  LKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVR  222

Query  153  NP  148
             P
Sbjct  223  KP  224



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  188  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  248  HFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKET  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  LKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVR  367

Query  153  NP  148
             P
Sbjct  368  KP  369



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPT  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYIDAE
Sbjct  185  YPPRPTGKNLLKNGNFEEGPYVFPNTSWGVLVPPNIEDDHSPLPGWMIESLKAVKYIDAE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ARTV GK Y L F VGDA+N+CEGSMV+EAFAG  T
Sbjct  245  HFSVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDANNRCEGSMVVEAFAGRDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GG+K A L+F A + RTR+MF ST+Y  RSDD  SLCGPVVD VKL+S+R
Sbjct  305  VKVPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFYTMRSDDMASLCGPVVDDVKLLSIR  364

Query  153  NPHR  142
            NP R
Sbjct  365  NPRR  368



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            LKVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  305  LKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMIESLKAVKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            LKVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  305  LKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYV P   TGVL PPF EDDHSPLPAW +ESLKA+KY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPYVLPNATTGVLIPPFIEDDHSPLPAWMIESLKAIKYVDVE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  T
Sbjct  246  HFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANNACEGSMIVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPY+S G+GG+K A LRF A + RTR+MF+ST+Y  RSDDF SLCGPV+D VKL++ R
Sbjct  306  LKVPYKSLGKGGFKRASLRFIAVSTRTRIMFYSTFYAMRSDDFSSLCGPVIDDVKLLTAR  365

Query  153  NP  148
             P
Sbjct  366  KP  367



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/179 (74%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW VESLKAVKY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYLLPNSTTGVLIPPFIEDDHSPLPAWMVESLKAVKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N CEGSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACEGSMIVEAFAGRDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            LKVPY+SKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  305  LKVPYQSKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  189  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ QI RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  249  HFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKET  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  309  LKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFSSLCGPVIDDVKLISVR  368

Query  153  NP  148
             P
Sbjct  369  KP  370



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   281 bits (720),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  189  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTE  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  249  HFSVPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGKET  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  309  LKVPYESRGTGGFKRASVRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  368

Query  153  NP  148
             P
Sbjct  369  KP  370



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   281 bits (719),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKYID E
Sbjct  183  YPPRPTNKNVLKNGGFEEGPLVLPNSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYIDIE  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+A  +AGK Y L+F VGDASN C+GSM++EAFAG  T
Sbjct  243  HFSVPQGRRAIELVAGKESAIAQVAPAIAGKTYVLSFAVGDASNACKGSMIVEAFAGRDT  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF AT+NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  303  LKVPYESRGTGGFKRAAMRFVATSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  362

Query  153  NP  148
             P
Sbjct  363  KP  364



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   281 bits (719),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  189  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTE  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFS+P GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  249  HFSIPQGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDANNACKGSMVVEAFAGRDT  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  309  LKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  368

Query  153  NP  148
             P
Sbjct  369  KP  370



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ +N NL+KN DFE GPYVFP   +GVL PP  EDDHSP+P W VESLKAVKYID++
Sbjct  185  YPPKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKYIDSD  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDASN CEGSMV+EAFAG +T
Sbjct  245  HFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFAGKNT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF SLCGPV+D V+L+SVR
Sbjct  305  LKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRLLSVR  364

Query  153  NP  148
            NP
Sbjct  365  NP  366



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ARTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  246  HFSVPQGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDANNACKGSMVVEAFAGKDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  306  LKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365

Query  153  N  151
             
Sbjct  366  K  366



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   279 bits (714),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  188  YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  248  HFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  LKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVR  367

Query  153  NP  148
             P
Sbjct  368  KP  369



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   279 bits (713),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  188  YPPRPTNKNILKNGGFEEGPLVLPGATTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDIE  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  248  HFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYVLSFAVGDANNACKGSMVVEAFAGKET  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A ++R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  LKVPYESQGTGGFKRASIRFVAVSSRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVR  367

Query  153  NP  148
             P
Sbjct  368  KP  369



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   278 bits (712),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 149/179 (83%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            LKV YES G+GG+K A LRF A ++RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  305  LKVAYESNGKGGFKRAALRFVAVSSRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   279 bits (713),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  188  YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  248  HFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVEAFAGKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A +RF A   R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  LKVPYESKGTGGFKRASIRFVAVLTRSRIMFYSTFYAMRSDDFSSLCGPVIDDVKLISVR  367

Query  153  NP  148
             P
Sbjct  368  KP  369



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   277 bits (708),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 151/182 (83%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ +N NLLKN DFEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID+ 
Sbjct  144  YPPKASNRNLLKNGDFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSG  203

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  204  HFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFAVGDASNSCEGSMVVEAFAGKDT  263

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GGYK A LRF+A + RTR+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  264  VKVPYESKGKGGYKRAVLRFKAVSVRTRIMFYSTFYTMRSDDFSSLCGPVLDDVKLLSVR  323

Query  153  NP  148
             P
Sbjct  324  FP  325



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   278 bits (710),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  188  YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDVE  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RTV GK Y L+F VGDA+N C+GSMV+E+FAG  T
Sbjct  248  HFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANNACKGSMVVESFAGKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  308  LKVPYESKGTGGFKRASIRFVAVSTRSRMMFYSTFYAMRSDDFSSLCGPVIDDVKLISVR  367

Query  153  NP  148
             P
Sbjct  368  KP  369



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   277 bits (708),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/184 (70%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+PTN N+LKN DFEEG Y+FP    GVL PP  EDD+SPLPAW VESLKAV+YID+ 
Sbjct  164  YPPKPTNQNILKNGDFEEGAYIFPNTSWGVLIPPNIEDDNSPLPAWMVESLKAVRYIDSA  223

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELV G+ESA+ Q+ART AGKFY LTF VGDASN CEGSMV+EAFAG S+
Sbjct  224  HFSVPRGRRAIELVGGRESAIAQVARTAAGKFYRLTFAVGDASNSCEGSMVVEAFAGGSS  283

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +++PYES G+GGYK A L+F A ++RTR+MF STYYH RSDD+ SLCGPVVD V+L+SVR
Sbjct  284  VRIPYESSGRGGYKRAILQFVAASDRTRIMFTSTYYHMRSDDYASLCGPVVDDVELLSVR  343

Query  153  NPHR  142
               R
Sbjct  344  ETPR  347



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 148/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPYVFP    GVL PP  ED HSPLP W VESLKAVKYID E
Sbjct  217  YPPRPTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSPLPGWMVESLKAVKYIDVE  276

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  277  HFSVPQGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDT  336

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF SLCGPV+D +KL+S+R
Sbjct  337  LKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIKLLSLR  396

Query  153  N  151
             
Sbjct  397  G  397



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P   +GVL PP  EDDHSPLP W VESLKAVK+ID++
Sbjct  182  FPPRPTNKNILKNGGFEEGPWVLPNASSGVLIPPNIEDDHSPLPGWIVESLKAVKFIDSD  241

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN C GSMV+EAFAG  T
Sbjct  242  HFSVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASNACSGSMVVEAFAGKDT  301

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF A +NRTR+MFFST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  302  VKVPYESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDFSSLCGPVIDDVKLLSAR  361

Query  153  NP  148
             P
Sbjct  362  KP  363



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   277 bits (709),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR +N N+LKN  FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++
Sbjct  184  YPPRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+N C GSMV+EAFAG  T
Sbjct  244  HFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFAGKGT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  304  IKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLLSVR  363

Query  153  N  151
            N
Sbjct  364  N  364



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFS+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  246  HFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  306  LKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLISAR  365



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID+ 
Sbjct  184  YPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSN  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  244  HFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S++
Sbjct  304  VKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLK  363

Query  153  NPHR  142
            NP +
Sbjct  364  NPRQ  367



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  186  YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTE  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFS+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  246  HFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  306  LKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  365



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   276 bits (705),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 128/180 (71%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   TGVL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  159  YPPRPTNKNILKNGGFEEGPLVLPGSTTGVLIPPFIEDDHSPLPGWMVESLKAVKYVDTE  218

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFS+P GRRA+ELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  219  HFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDT  278

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF SLCGPV+D VKL+S R
Sbjct  279  LKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLISAR  338



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   276 bits (706),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 149/184 (81%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  185  YPPRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ QI RT+ GK Y LTF VGDASN CEGSM++EAFAG  T
Sbjct  245  HFSVPEGKRAVELVAGKESAIAQIVRTIPGKTYMLTFSVGDASNSCEGSMIVEAFAGRDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+FRA   RTR+MF ST+Y  RSDDF SLCGPV+D VKL+S+R
Sbjct  305  IKVPYESKGKGGFKRAVLKFRAVGPRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSLR  364

Query  153  NPHR  142
             P +
Sbjct  365  RPRQ  368



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   276 bits (705),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/184 (71%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN  FEEGPY+FP    GVL PP  EDDHSPLP W VESLKAVKYID+ 
Sbjct  184  YPPRATNKNLLKNAGFEEGPYMFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSN  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  244  HFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S++
Sbjct  304  VKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLK  363

Query  153  NPHR  142
            NP +
Sbjct  364  NPRQ  367



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   276 bits (705),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRP++ NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  183  YPPRPSSKNLLKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP  +RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  243  HFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASNSCEGSMVVEAFAGRDT  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDD+ SLCGPV+D VKL+S+R
Sbjct  303  IKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYASLCGPVLDDVKLLSLR  362

Query  153  NPHRRL  136
             P R +
Sbjct  363  TPPRHI  368



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   276 bits (705),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N++KN  FEEGPY+FP    GVL PP  EDD+SPLPAW VESLKAVKYID+ 
Sbjct  188  YPPRPTNKNIIKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVESLKAVKYIDSA  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ VP GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +T
Sbjct  248  HYFVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKAT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  308  LKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIR  367

Query  153  NP  148
            NP
Sbjct  368  NP  369



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 151/181 (83%), Gaps = 0/181 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ +N NL+KN DFE GPYVFP   +GVL PP  EDDHSP+P W VESLKAVKYID++H
Sbjct  240  PPKASNDNLVKNGDFESGPYVFPNASSGVLVPPNIEDDHSPIPGWMVESLKAVKYIDSDH  299

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            FSVP G+RAVELVAGKESA+ QI RT+ GK Y L+F+VGDASN CEGSMV+EAFAG +TL
Sbjct  300  FSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASNSCEGSMVVEAFAGKNTL  359

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            KVPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF SLCGPV+D V+L+SVRN
Sbjct  360  KVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFSSLCGPVLDKVRLLSVRN  419

Query  150  P  148
            P
Sbjct  420  P  420



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR +N N+LKN  FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++
Sbjct  184  YPPRASNKNILKNGGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RA+ELVAGKESA+ QIART+ GK Y LTF VGDA+N C GSMV+EAFAG  T
Sbjct  244  HFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANNACAGSMVVEAFAGKGT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  304  IKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLLSVR  363

Query  153  N  151
            +
Sbjct  364  S  364



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N++KN  FEEGPY+FP    GVL PP  EDD+SPLPAW VESLKAVKYID+ 
Sbjct  144  YPPRPTNKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVESLKAVKYIDSA  203

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ +P GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +T
Sbjct  204  HYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKAT  263

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  264  LKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIR  323

Query  153  NP  148
            NP
Sbjct  324  NP  325



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   275 bits (703),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  188  YPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T
Sbjct  248  HFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R
Sbjct  308  VKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLR  367

Query  153  NP  148
             P
Sbjct  368  KP  369



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  184  YPPRATNKNLLKNAGFEEGPYVFPNASWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T
Sbjct  244  HFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R
Sbjct  304  VKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLR  363

Query  153  NP  148
             P
Sbjct  364  KP  365



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID E
Sbjct  162  YPPRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDIE  221

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  222  HFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDT  281

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  282  LKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  341

Query  153  N  151
             
Sbjct  342  G  342



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   274 bits (701),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N++KN  FEEGPY+FP    GVL PP  EDD+SPLPAW VESLKAVKYID+ 
Sbjct  188  YPPRPTNKNIMKNGGFEEGPYIFPNTPWGVLIPPNIEDDNSPLPAWVVESLKAVKYIDSA  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ +P GRRAVELV GKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG +T
Sbjct  248  HYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANNSCAGSLVVEAFAGKAT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  308  LKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSIR  367

Query  153  NP  148
            NP
Sbjct  368  NP  369



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   274 bits (700),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID E
Sbjct  184  YPPRPTNKNLIKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDIE  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  244  HFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASNSCEGSMVVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  304  LKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  363

Query  153  N  151
             
Sbjct  364  G  364



>emb|CDX80516.1| BnaC07g29280D [Brassica napus]
Length=306

 Score =   271 bits (694),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 146/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP V P   T VL PPF EDDHSPLP W VESLKAVKY+D E
Sbjct  125  YPPRPTNKNILKNGGFEEGPLVLPGSTTRVLIPPFIEDDHSPLPGWMVESLKAVKYVDTE  184

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFS+P GRRA+ELV GKESA+ Q+ART+ GK Y L+F VGDA+N C+GSMV+EAFAG  T
Sbjct  185  HFSIPQGRRAIELVVGKESAIAQVARTIIGKTYVLSFAVGDANNACKGSMVVEAFAGRDT  244

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES+G GG+K A +RF A + RT+VMF+ST+Y  RSDDF SLCGPV+D VKL+SVR
Sbjct  245  LKVPYESRGTGGFKRASIRFVAVSTRTKVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSVR  304

Query  153  N  151
             
Sbjct  305  K  305



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   273 bits (699),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ TN NLLKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID++
Sbjct  185  YPPKATNQNLLKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSD  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  245  HFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNYCEGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPVVD VKLVS+R
Sbjct  305  IKVPYESKGKGGFKRAALKFVAVGPRTRVMFLSTFYTMRSDDFSSLCGPVVDDVKLVSLR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   272 bits (696),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NL+KN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  164  YPPRATNKNLIKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  223

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGS+++EAFAG +T
Sbjct  224  HFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSLIVEAFAGKNT  283

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPV+D VKL+S+R
Sbjct  284  VKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFSSLCGPVLDDVKLLSLR  343

Query  153  NP  148
             P
Sbjct  344  KP  345



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN  FEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  184  YPPRATNKNLLKNAGFEEGPYVFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSM++EAFA  +T
Sbjct  244  HFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASNSCEGSMIVEAFADKNT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF SLCGPVVD VKL+S+R
Sbjct  304  VKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFSSLCGPVVDDVKLLSLR  363

Query  153  NP  148
             P
Sbjct  364  KP  365



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++
Sbjct  144  FPPRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSD  203

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  204  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDT  263

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  264  IKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  323

Query  153  NP  148
             P
Sbjct  324  RP  325



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   271 bits (694),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKYID++
Sbjct  144  YPPRPTNKNILKNGGFEEGPWVLPNSSSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSD  203

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  204  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDT  263

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R DDF SLCGPV+D VKL+S R
Sbjct  264  IKVPYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDFSSLCGPVIDDVKLLSAR  323

Query  153  NP  148
             P
Sbjct  324  RP  325



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN N+LKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID+ 
Sbjct  185  YPPRATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSG  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  245  HFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A   RTR+MF ST+Y  RSDDF SLCGPV+D VKLVS+R
Sbjct  305  IKVPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ TN N+LKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID++
Sbjct  185  YPPKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSD  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  245  HFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPV+D VKLVS+R
Sbjct  305  IKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   272 bits (696),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ TN N+LKN  FEEGPYVFP    GV+ PP  EDDHSPLP W VESLKAVKYID++
Sbjct  185  YPPKATNQNILKNGGFEEGPYVFPNSSWGVIIPPNIEDDHSPLPGWMVESLKAVKYIDSD  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVEL+AGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  245  HFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF SLCGPV+D VKLVS+R
Sbjct  305  IKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFSSLCGPVIDDVKLVSLR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   271 bits (694),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++
Sbjct  184  FPPRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  IKVPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363

Query  153  NP  148
             P
Sbjct  364  RP  365



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   271 bits (692),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKYID++
Sbjct  173  FPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSD  232

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  233  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDT  292

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  293  IKVPYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  352

Query  153  NP  148
             P
Sbjct  353  RP  354



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N +KN  FEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYID+ 
Sbjct  188  YPPRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAVKYIDSA  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  T
Sbjct  248  HYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  308  LKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  367



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   271 bits (693),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 145/181 (80%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN N+LKN  FEEGPYVFP    GVL PP  ED HS LP W VESLKAVKYID E
Sbjct  185  YPPRLTNKNILKNGGFEEGPYVFPNTTWGVLIPPNIEDKHSTLPGWMVESLKAVKYIDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKES + Q+ARTV GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF SLCGPV+D +KL+S+R
Sbjct  305  LKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFSSLCGPVIDDIKLLSLR  364

Query  153  N  151
             
Sbjct  365  G  365



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   271 bits (694),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N +KN  FEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYID+ 
Sbjct  193  YPPRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAVKYIDSA  252

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  T
Sbjct  253  HYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDT  312

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  313  LKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  372



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   271 bits (694),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N +KN  FEEGPYVFP    GVL PP  EDDHSPLPAW VESLKAVKYID+ 
Sbjct  193  YPPRPTNKNSVKNGGFEEGPYVFPNTPWGVLIPPNIEDDHSPLPAWIVESLKAVKYIDSA  252

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ VP GRRAVELVAGKESA+ QI RT+ GK Y L+F VGDA+N C GS+V+EAFAG  T
Sbjct  253  HYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANNSCVGSLVVEAFAGKDT  312

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF SLCGPV+D VKL+S++
Sbjct  313  LKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFSSLCGPVLDDVKLLSIQ  372



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   271 bits (692),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 126/181 (70%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID E
Sbjct  184  YPPRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDVE  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN C+GSMV+EAFAG  T
Sbjct  244  HFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCQGSMVVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  304  VKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  363

Query  153  N  151
             
Sbjct  364  G  364



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   270 bits (689),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/184 (71%), Positives = 146/184 (79%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN +FEEGPY+FP    GVL PP  ED++SPLP W VESLKAVKYID+ 
Sbjct  144  YPPRATNKNLLKNGNFEEGPYIFPNASWGVLVPPNIEDENSPLPGWMVESLKAVKYIDSN  203

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDASN C GSMV+EAFAG  T
Sbjct  204  HFSVPEGKRAVELVAGKESAIAQVARTIPGKLYALTFAVGDASNACTGSMVVEAFAGRDT  263

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A LRF A + RTRV+F ST+Y  RSDDF SLCGPV+D VKL+SV 
Sbjct  264  LKVPYESKGTGGFKRAVLRFTAVSERTRVVFLSTFYSMRSDDFSSLCGPVIDDVKLLSVH  323

Query  153  NPHR  142
               R
Sbjct  324  GAPR  327



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   271 bits (692),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++
Sbjct  184  FPPRPTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  IKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363

Query  153  NP  148
             P
Sbjct  364  RP  365



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN N+LKN  FEEG Y+FP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  194  YPPRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  253

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C GSMV+EAFAG  T
Sbjct  254  HYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNSCAGSMVVEAFAGKDT  313

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF SLCGPVVD VKL+SVR
Sbjct  314  LKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSVR  373

Query  153  NP  148
             P
Sbjct  374  KP  375



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   271 bits (693),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 127/181 (70%), Positives = 147/181 (81%), Gaps = 0/181 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN NL+KN  FEEGPY+ P    GVL PP  ED HSPLP W VESLKAVK+ID E
Sbjct  234  YPPRPTNKNLVKNGGFEEGPYLLPNTSWGVLIPPNIEDKHSPLPGWMVESLKAVKFIDVE  293

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRA+ELVAGKESA+ Q+ RT+ GK Y L+F VGDASN CEGSMV+EAFAG  T
Sbjct  294  HFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASNSCEGSMVVEAFAGKDT  353

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF SLCGPVVD VKL+S+R
Sbjct  354  VKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFSSLCGPVVDDVKLLSLR  413

Query  153  N  151
             
Sbjct  414  G  414



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   269 bits (688),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/182 (71%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR TN NLLKN DFEEGPY+ P    GVL PP  EDDHSPLP W VESLKAVKY+DAE
Sbjct  183  FPPRRTNTNLLKNGDFEEGPYILPNTTWGVLIPPQIEDDHSPLPGWMVESLKAVKYLDAE  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVEL+AGKESA+ Q+ RTV G+ Y L+F VGDASN CEGS+++EAFAG  T
Sbjct  243  HFSVPRGRRAVELLAGKESAIAQVVRTVPGRRYALSFAVGDASNACEGSLLVEAFAGEHT  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG K A L+F AT  RTRV+F+S+YY+TRSDD  SLCGPV+D V LVSVR
Sbjct  303  IKVPYESKGRGGSKRAVLQFTATTARTRVVFWSSYYNTRSDDLSSLCGPVLDDVALVSVR  362

Query  153  NP  148
             P
Sbjct  363  YP  364



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   267 bits (683),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ 
Sbjct  145  YPPKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSA  204

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  205  HFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  264

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR
Sbjct  265  IKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVR  324

Query  153  NP  148
             P
Sbjct  325  KP  326



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   270 bits (690),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 128/182 (70%), Positives = 145/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN N+LKN  FEEG Y+FP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  231  YPPRATNKNILKNAGFEEGAYIFPNTPWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  290

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+ VP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C GSMV+EAFAG  T
Sbjct  291  HYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANNSCAGSMVVEAFAGKDT  350

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF SLCGPVVD VKL+SVR
Sbjct  351  LKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFSSLCGPVVDDVKLLSVR  410

Query  153  NP  148
             P
Sbjct  411  KP  412



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   268 bits (686),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKYID++
Sbjct  184  FPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG++ A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  IKVPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363

Query  153  NP  148
             P
Sbjct  364  RP  365



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   268 bits (685),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 148/182 (81%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKY+D++
Sbjct  184  FPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYLDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  IKVPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363

Query  153  NP  148
             P
Sbjct  364  RP  365



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   268 bits (684),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR TN N+LKN  FEEGP+V P + +GVL PP + DDHSPLP W VESLKAVKYID++
Sbjct  184  FPPRTTNKNILKNGGFEEGPWVLPNISSGVLIPPNSIDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  IKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363

Query  153  NP  148
             P
Sbjct  364  RP  365



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P   +GVL PP   DDHSPLP W VESLKAVKYID++
Sbjct  184  FPPRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVEL+AGKESAV Q+ RT  GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  LKVPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   267 bits (683),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGP+V P   +GVL PP   DDHSPLP W VESLKAVKYID++
Sbjct  184  YPPRPTNKNILKNGGFEEGPWVLPNTSSGVLIPPNAVDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT  GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVP+ESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF SLCGPV+D VKL+S R
Sbjct  304  LKVPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFSSLCGPVIDDVKLLSAR  363



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   284 bits (726),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 131/179 (73%), Positives = 150/179 (84%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPRPTN N+LKN  FEEGPY+ P   TGVL PPF EDDHSPLPAW +ESLKAVKY+D E
Sbjct  185  YPPRPTNKNILKNGGFEEGPYIIPNATTGVLIPPFIEDDHSPLPAWIIESLKAVKYVDVE  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+ Q+ART+ GK Y L+F VGDA+N C+GSM++EAFAG  T
Sbjct  245  HFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANNACKGSMIVEAFAGKDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            LKV YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF SLCGPV+D VKL+SV
Sbjct  305  LKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFSSLCGPVIDDVKLLSV  363



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ 
Sbjct  195  YPPKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSA  254

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  255  HFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  314

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR
Sbjct  315  IKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVR  374

Query  153  NP  148
             P
Sbjct  375  KP  376



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   268 bits (684),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ 
Sbjct  195  YPPKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSA  254

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  255  HFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  314

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR
Sbjct  315  IKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVR  374

Query  153  NP  148
             P
Sbjct  375  KP  376



>emb|CAA06490.1| hypothetical protein [Cicer arietinum]
Length=180

 Score =   259 bits (663),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+ TN NLLKN  FEEGPY+FP    GV+ PP  ED+HSPLP W VESLKAVKY+D+ HF
Sbjct  1    PKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSPLPGWMVESLKAVKYLDSSHF  60

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T+K
Sbjct  61   SVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDTVK  120

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  SLCGPV+D VKL+S+R P
Sbjct  121  VPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSSLCGPVIDDVKLLSLRKP  180



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ +N N+LKN  FEEGPY+FP    GV+ PP  EDDHSPLP W VESLKAVKY+D+ 
Sbjct  194  YPPKASNKNILKNGGFEEGPYIFPNTSYGVIIPPNIEDDHSPLPGWMVESLKAVKYLDSG  253

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RAVELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  254  HFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGKDT  313

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  SLCGPV+D VKL+SVR
Sbjct  314  IKVPYSSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLSSLCGPVIDDVKLLSVR  373



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   265 bits (676),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN DFEEGPY+ P    G L PP  EDDHSPLP W VESLKAV YID+ 
Sbjct  184  YPPRLTNKNLLKNADFEEGPYILPNTTWGALVPPNIEDDHSPLPGWMVESLKAVNYIDSA  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G+RAVELV GKESA+ Q+ARTV G+ Y L+FLVGDA N C G MV+EAFA  ST
Sbjct  244  HFKVPQGKRAVELVGGKESALAQVARTVVGRVYTLSFLVGDAGNACTGPMVVEAFAARST  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D   SLCGPVVD V L+SVR
Sbjct  304  VKVPYDSKGTGGFKRAVLRFTAVAERTRVVFLSTYYNTRTDG--SLCGPVVDDVTLLSVR  361

Query  153  NPHRRL  136
            NP RRL
Sbjct  362  NPSRRL  367



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ TN NLLKN  FEEGPY+FP    GV+ PP  ED+HSPLP W VESLKAVKY+D+ 
Sbjct  185  YPPKATNKNLLKNGGFEEGPYIFPNTSYGVIIPPNIEDNHSPLPGWMVESLKAVKYLDSS  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RA+ELVAGKESA+ Q+ART+ GK Y L+F VGDASN CEGSM++EAFAG  T
Sbjct  245  HFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASNSCEGSMIVEAFAGRDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  SLCGPV+D VKL+S+R
Sbjct  305  VKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLSSLCGPVIDDVKLLSLR  364

Query  153  NP  148
             P
Sbjct  365  KP  366



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   264 bits (675),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/182 (71%), Positives = 145/182 (80%), Gaps = 2/182 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR T  NLLKN DFEEGPYVFP    GVL PP  EDDHSPLP W VESLKAVKYID++
Sbjct  184  YPPRLTRDNLLKNRDFEEGPYVFPNTTWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVPHG+RAVELVAGKESA+ Q+ART+ GK Y LTF VGDA N C GSMV+EAFA   T
Sbjct  244  HFSVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAGNGCVGSMVVEAFASRGT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +K+PYESKG GGYK A LRF A   RTRV+F ST+YHT++D   SLCGPVVD V L+SVR
Sbjct  304  VKIPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTDG--SLCGPVVDDVSLLSVR  361

Query  153  NP  148
            +P
Sbjct  362  SP  363



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 131/183 (72%), Positives = 148/183 (81%), Gaps = 0/183 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN  FEEGPY+FP    GVL PP  EDDHSPLP W VESLKAVKYID+ 
Sbjct  185  YPPRATNKNLLKNGGFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMVESLKAVKYIDSA  244

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RA+ELVAGKESA+ Q+ART+ GK Y L F VGDASN CEGSM++EAFAG  T
Sbjct  245  HFSVPGGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDASNSCEGSMIVEAFAGRDT  304

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K A LRF+A + RTR+MF+ST+Y  RSDDF SLCGPVVD V L+SVR
Sbjct  305  IKVPYESKGKGGFKRAVLRFKAVSTRTRIMFYSTFYTMRSDDFSSLCGPVVDDVVLLSVR  364

Query  153  NPH  145
            NP 
Sbjct  365  NPR  367



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 129/185 (70%), Positives = 144/185 (78%), Gaps = 2/185 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T  NLLKN DFEEGPYV P    GVL PP  EDDHSPLP WTVESLKAVKYID++
Sbjct  186  YPPKLTGDNLLKNRDFEEGPYVLPNTTWGVLIPPNIEDDHSPLPGWTVESLKAVKYIDSD  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RAVELVAGKESA+ Q+ARTV GK Y L F +GDA N C GSMV+EAFAG  T
Sbjct  246  HFSVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDAGNGCVGSMVVEAFAGRGT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
             K+PYESKG GGYK   LRF A A RTRV+FFST+YHT+ D   SLCGP +D V L+SVR
Sbjct  306  AKIPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYHTKVDG--SLCGPSLDDVSLLSVR  363

Query  153  NPHRR  139
            +P RR
Sbjct  364  SPVRR  368



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   260 bits (665),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T +NLLKN +FEEGPY+F     G L PP  ED HSPLP W +ESLKAVKY+D++
Sbjct  186  YPPKRTGLNLLKNGNFEEGPYIFRNTSWGTLIPPNIEDAHSPLPGWMIESLKAVKYLDSD  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G+RA+ELVAGKESA+ Q+ RTV GK Y LTF VGDA+N C GSMV+EAFAG  T
Sbjct  246  HFFVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDANNACSGSMVVEAFAGKDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
             KVPY SKG+GG+K A LRF AT  RTR+MF+ST+Y  RSDDF SLCGPV+D V+LVSVR
Sbjct  306  AKVPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFYSMRSDDFSSLCGPVIDDVRLVSVR  365

Query  153  NP  148
             P
Sbjct  366  RP  367



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 144/186 (77%), Gaps = 2/186 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR TN NLLKN DFEEGPY+ P    GVL PP  EDDHSPLP+W VESLKAV YID+ 
Sbjct  190  YPPRLTNKNLLKNADFEEGPYILPNTTWGVLVPPNIEDDHSPLPSWMVESLKAVNYIDSA  249

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G+RAVELV GKESA+ Q+ RTV G+ Y L+F VGDA N C G+M++EAFA  ST
Sbjct  250  HFKVPQGKRAVELVGGKESALAQVVRTVVGRVYTLSFSVGDAGNACAGTMMVEAFAARST  309

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D   SLCGPVVD V L+SVR
Sbjct  310  VKVPYDSKGTGGFKRAVLRFTAEAERTRVVFLSTYYNTRTDG--SLCGPVVDDVTLLSVR  367

Query  153  NPHRRL  136
             P RRL
Sbjct  368  KPSRRL  373



>ref|XP_010106829.1| hypothetical protein L484_006602 [Morus notabilis]
 gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis]
Length=217

 Score =   253 bits (647),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 141/174 (81%), Gaps = 1/174 (1%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  490
            NL++N  FE GPYVF    TGVL PP  EDDHSPLP W VESLKAVKYID++HFSVPHG+
Sbjct  44   NLIRNPSFEYGPYVF-NTTTGVLIPPNIEDDHSPLPYWMVESLKAVKYIDSDHFSVPHGK  102

Query  489  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  310
            RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDASN CEGSM++EAFAG +T+KVPYESK
Sbjct  103  RAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNSCEGSMIVEAFAGRATVKVPYESK  162

Query  309  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            G+GG+K   L F AT  RTR+MF ST+Y  RSDDF SLCGPV+D +KL+SVR P
Sbjct  163  GKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSSLCGPVLDDIKLLSVRKP  216



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   258 bits (660),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++
Sbjct  189  YPPRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSD  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+R VELVAGKESA++Q+  T+  + Y L+F VGDA+N CEGSMV+EAFAG  T
Sbjct  249  HFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDT  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+  SLCGPV+D VKL+SVR
Sbjct  309  VKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGSLCGPVLDDVKLLSVR  368



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   258 bits (659),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDAEH
Sbjct  189  PHRPKG-NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAEH  247

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDASN C+GSM++EAFAG  TL
Sbjct  248  FTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSCQGSMLIEAFAGNITL  307

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPYES G+GG+K AKLRF A   RTRV F STYYH +SD   SLCGPVVD V+LV VR 
Sbjct  308  RVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRLVGVRY  367

Query  150  P  148
            P
Sbjct  368  P  368


 Score = 53.1 bits (126),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 52/189 (28%), Positives = 79/189 (42%), Gaps = 34/189 (18%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  499
            LL N +FE+GP       T V       D H+ +P W     VE +KA +        VP
Sbjct  23   LLPNGNFEQGPKASQMKGTKV------TDPHA-IPHWEISGYVEYIKAGQTQGDMLLPVP  75

Query  498  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  334
             G  AV L  G+++ + T++     G FY L+F   + +  C     L     P+     
Sbjct  76   EGAFAVRL--GEDAYIKTRVTNVTNGTFYSLSF---NFARTCAQEEKLNVSVSPNNEPND  130

Query  333  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  169
                 ++  Y S G   Y      F A AN   +M      H  + +    CGP++DF+ 
Sbjct  131  WAMLPMQTMYSSDGWDSYS---WGFLAQANEIEIML-----HNPAVEKDPACGPLIDFIA  182

Query  168  LVSVRNPHR  142
            L +++ PHR
Sbjct  183  LKALKTPHR  191



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   258 bits (659),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 123/182 (68%), Positives = 144/182 (79%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +N NLLKN DFEEGPY+ P    GVL PP TEDDHSPLP W V+S KAVKY+D+ 
Sbjct  183  HPPRRSNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDSPKAVKYLDST  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RAVEL+AGKESA+ Q  RTV G+ Y L F VGDASN C+G+M++EAFAG  T
Sbjct  243  HFSVPRGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACQGTMIVEAFAGEHT  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GG K A LRFRA+  RTR++FFS+ Y+TRSDD  SLCGPV+D V LVS+R
Sbjct  303  VKVPYESKGAGGAKRAVLRFRASKARTRIVFFSSNYNTRSDDLSSLCGPVLDDVALVSIR  362

Query  153  NP  148
            NP
Sbjct  363  NP  364



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 142/181 (78%), Gaps = 1/181 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDA H
Sbjct  193  PHRPKG-NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAAH  251

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAG+ESA+ Q+  T  GK YDL F VGDASN C+GSM++EAFAG  TL
Sbjct  252  FTVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDASNSCQGSMLIEAFAGQITL  311

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD   SLCGPVVD V+LV VR+
Sbjct  312  RVPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRLVGVRH  371

Query  150  P  148
            P
Sbjct  372  P  372


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 54/192 (28%), Positives = 83/192 (43%), Gaps = 34/192 (18%)
 Frame = -2

Query  675  NVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHF  508
            N  LL N +FE+GP       T V  P      H+ +P W     VE +K+ +       
Sbjct  24   NDGLLPNGNFEQGPKPSQLKGTRVTNP------HA-IPHWEISGYVEYIKSGQTQGDMLL  76

Query  507  SVPHGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST-  334
             VP G  AV L  G+++++ T+I     G FY L+F   + +  C     L     P++ 
Sbjct  77   PVPEGAFAVRL--GEDASIKTRITNFTKGTFYSLSF---NFARTCAQEEKLNVSVSPNSE  131

Query  333  --------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVD  178
                    ++  Y S G   Y      F A AN   +M      H  + +    CGP++D
Sbjct  132  PNDWGMLPMQTMYSSDGWDSYS---WGFLAEANEIDIML-----HNPAIEKDPACGPLID  183

Query  177  FVKLVSVRNPHR  142
            F+ L +++NPHR
Sbjct  184  FIALKALKNPHR  195



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPPR T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++
Sbjct  189  YPPRRTRANLLKNGNFEEGPYVFPTASWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSD  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+R VELVAGKESA++Q+  T+  + Y L+F VGDA+N CEGSMV+EAFAG  T
Sbjct  249  HFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANNSCEGSMVVEAFAGLDT  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+  SLCGPV+D VKL+SVR
Sbjct  309  VKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSGSLCGPVLDDVKLLSVR  368



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   254 bits (650),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  517
            Y P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+
Sbjct  117  YNPKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDS  176

Query  516  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  337
            EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +
Sbjct  177  EHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKN  236

Query  336  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SV
Sbjct  237  TVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSV  296

Query  156  RNPH  145
            R  H
Sbjct  297  RKLH  300



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   256 bits (655),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P     N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDAEHF
Sbjct  194  PHRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAEHF  253

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G+RA+ELVAG+ESA+ QI RT  GK YDL F VGDASN C+GSM++EAFAG  TL+
Sbjct  254  TVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASNSCQGSMLIEAFAGKITLR  313

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPYES G+GG+K AKLRF A   RTRV F STYYH ++D   SLCGPVVD ++LV VR+P
Sbjct  314  VPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKNDHSGSLCGPVVDDMRLVGVRHP  373


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 52/192 (27%), Positives = 83/192 (43%), Gaps = 38/192 (20%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  505
            LL N +FE+GP       T V       D H+ +P W +     V+YI +          
Sbjct  28   LLPNGNFEQGPKASQMKGTKV------TDPHA-IPHWEISGY--VEYIRSGQTQGDMLLP  78

Query  504  VPHGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST--  334
            VP G  AV L  G+++++ T++    +G FY L+F   + +  C     L     P+T  
Sbjct  79   VPEGAFAVRL--GEDASIKTRVTNVTSGSFYSLSF---NFARTCAQEEKLNVSVSPNTEP  133

Query  333  -------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDF  175
                   ++  Y S G   Y      F A AN   +       H  + +    CGP++DF
Sbjct  134  NDWGMLPMQTMYSSDGWDSYS---WGFLAQANEIEITL-----HNPAVEKDPACGPLIDF  185

Query  174  VKLVSVRNPHRR  139
            + L +++NPHR+
Sbjct  186  IALKALKNPHRQ  197



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP  TN NLLKN DFEEGPY+ P    GVL PP TEDDHSPLP W V+S KAVKY+D+ 
Sbjct  184  HPPSRTNKNLLKNGDFEEGPYILPNTTWGVLIPPTTEDDHSPLPGWMVDSPKAVKYLDSA  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VPHGRRAVEL+AGKESA+ Q  RTV G+ Y L F VGDASN CEGSM++EAFAG  T
Sbjct  244  HFFVPHGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASNACEGSMIVEAFAGEHT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GG K A LRFRA+  RTR++F S+ Y TR DD  SLCGPV+D V LVS+R
Sbjct  304  VKVPYESKGAGGAKRAVLRFRASKARTRIVFLSSNYSTRRDDLSSLCGPVLDDVALVSIR  363

Query  153  NP  148
            NP
Sbjct  364  NP  365



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   255 bits (651),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYID  520
            YPPRPTN N+LKN  FEEGPYVFP   +GVL PP   D  DHSPLP W VESLKAVKYID
Sbjct  145  YPPRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSPLPGWIVESLKAVKYID  204

Query  519  AEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGP  340
            ++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA N CEGS+ +EA+ G 
Sbjct  205  SDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNSCEGSLSVEAYVGK  264

Query  339  STLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  160
             ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF SLCGPV+D V L+S
Sbjct  265  ESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFASLCGPVIDDVTLIS  324

Query  159  VRNP  148
            +R P
Sbjct  325  LRKP  328



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/183 (64%), Positives = 147/183 (80%), Gaps = 0/183 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T  NLLKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID+E
Sbjct  188  YPPKRTPANLLKNGNFEEGPYIFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSE  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G+RA+ELVAGKESA+ Q+ +T  G+ Y L+F VGDA+N CEGSMV+EAFAG +T
Sbjct  248  HFSVPEGKRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDANNACEGSMVVEAFAGKNT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +K  Y+SKG+GG+K A L F+A ++RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SVR
Sbjct  308  VKASYQSKGKGGFKRAILAFKAESSRTRIMFYSTFYTMKSDNSGSLCGPVLDDVKLLSVR  367

Query  153  NPH  145
              H
Sbjct  368  KLH  370



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   256 bits (654),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYID+EH
Sbjct  190  PKRPRG-NMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDSEH  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T+
Sbjct  249  FHVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDASNSCEGSMLVEAFAGKITM  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            + PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV +RN
Sbjct  309  QFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGLRN  368

Query  150  PH  145
            PH
Sbjct  369  PH  370



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYID  520
            YPPR TN N+LKN  FEEGPYVFP   +GVL PP   D  +HSPLP W VESLKAV+YID
Sbjct  170  YPPRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYID  229

Query  519  AEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGP  340
            ++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA N CEGS+ +EA+ G 
Sbjct  230  SDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEAYVGK  289

Query  339  STLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  160
             ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD  SLCGPV+D V L+S
Sbjct  290  ESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASLCGPVIDDVTLIS  349

Query  159  VRNPHRRL  136
            +R PHRR 
Sbjct  350  LRKPHRRF  357



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   254 bits (650),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  517
            Y P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+
Sbjct  143  YNPKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDS  202

Query  516  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  337
            EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +
Sbjct  203  EHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNGCEGPMVVEAFAGKN  262

Query  336  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SV
Sbjct  263  TVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSV  322

Query  156  RNPH  145
            R  H
Sbjct  323  RKLH  326



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   256 bits (653),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 146/188 (78%), Gaps = 2/188 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYID  520
            YPPR TN N+LKN  FEEGPYVFP   +GVL PP   D  +HSPLP W VESLKAV+YID
Sbjct  183  YPPRLTNKNVLKNGGFEEGPYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYID  242

Query  519  AEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGP  340
            ++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA N CEGS+ +EA+ G 
Sbjct  243  SDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSCEGSLSVEAYVGK  302

Query  339  STLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  160
             ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD  SLCGPV+D V L+S
Sbjct  303  ESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLASLCGPVIDDVTLIS  362

Query  159  VRNPHRRL  136
            +R PHRR 
Sbjct  363  LRKPHRRF  370



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   256 bits (653),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 141/181 (78%), Gaps = 1/181 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYIDA H
Sbjct  193  PHRPKG-NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDAAH  251

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAG+ESA+ Q   T  GK YDL F VGDASN C+GSM++EAFAG  TL
Sbjct  252  FAVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDASNSCQGSMLIEAFAGQITL  311

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD   SLCGPVVD V+LV VR+
Sbjct  312  RVPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSGSLCGPVVDDVRLVGVRH  371

Query  150  P  148
            P
Sbjct  372  P  372


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 51/189 (27%), Positives = 80/189 (42%), Gaps = 34/189 (18%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  499
            LL N +FE+GP       T V  P      H+ +P W     VE +K+ +        VP
Sbjct  27   LLPNGNFEQGPKPSQLKGTKVTEP------HA-IPHWEISGYVEYIKSGQTQGDMLLPVP  79

Query  498  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  334
             G  AV L  G+++++ T+I     G FY L+F   + +  C     L     P+     
Sbjct  80   EGAFAVRL--GEDASIKTRITNVTKGTFYSLSF---NFARTCAQEEKLNVSVSPNNEPND  134

Query  333  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  169
                 ++  Y S G   Y      F A A    +M      H  + +    CGP++D++ 
Sbjct  135  WGMLPMQTMYSSDGWDSYS---WGFLAQATEIDIML-----HNPAVEKDPACGPLIDYIA  186

Query  168  LVSVRNPHR  142
            L +++NPHR
Sbjct  187  LKALKNPHR  195



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  517
            Y P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+
Sbjct  189  YNPKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDS  248

Query  516  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  337
            EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +
Sbjct  249  EHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANNGCEGPMVVEAFAGKN  308

Query  336  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SV
Sbjct  309  TVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSV  368

Query  156  RNPH  145
            R  H
Sbjct  369  RKLH  372



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   255 bits (652),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 147/184 (80%), Gaps = 1/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  517
            Y P+ T  NLLKN +FEEGPY+FP+    GV+ PP  EDDHSPLP W +ESLKA+KYID+
Sbjct  189  YNPKRTRANLLKNGNFEEGPYIFPRPTSEGVIIPPHIEDDHSPLPGWIIESLKAIKYIDS  248

Query  516  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  337
            EHFSVP G+RA+EL+AGKESAV QI +T  G+ Y L+FLVGDA+N CEG MV+EAFAG +
Sbjct  249  EHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANNGCEGPMVVEAFAGKN  308

Query  336  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  SLCGPV+D VKL+SV
Sbjct  309  TVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSGSLCGPVLDDVKLLSV  368

Query  156  RNPH  145
            R  H
Sbjct  369  RKLH  372


 Score = 49.7 bits (117),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 52/190 (27%), Positives = 73/190 (38%), Gaps = 37/190 (19%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  505
            LL N +FE GP       T V+           +P W +     V+YI + H        
Sbjct  26   LLPNGNFEYGPKASELEGTKVMSA-------KAIPNWEISGY--VEYIKSGHKQGDMLLI  76

Query  504  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  334
            VP G  AV L  G E+ + Q    V G FY LTF     +  C     L     P+    
Sbjct  77   VPEGAFAVRL--GNEALIKQKVEVVKGDFYSLTF---STARTCAQEERLNVSVSPNNEKN  131

Query  333  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  172
                  ++  Y S G   Y  A   F+A A+   +       H    +  + CGP++D V
Sbjct  132  DFGLFPIQTMYSSNGWDSYAWA---FQADAHVIEISI-----HNPGVEEDAACGPLIDSV  183

Query  171  KLVSVRNPHR  142
             L ++ NP R
Sbjct  184  ALKTLYNPKR  193



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   255 bits (651),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 143/182 (79%), Gaps = 1/182 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYIDAEH
Sbjct  190  PKRPKG-NMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDAEH  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T+
Sbjct  249  FTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSMLVEAFAGKITM  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            + PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV VRN
Sbjct  309  QFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGVRN  368

Query  150  PH  145
            P 
Sbjct  369  PR  370



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   260 bits (664),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 148/182 (81%), Gaps = 1/182 (1%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+PT+ NL++N  FE GPYVF    TGVL PP  EDDHSPLP W VESLKAVKYID++HF
Sbjct  185  PKPTSENLIRNPSFEYGPYVF-NTTTGVLIPPNIEDDHSPLPYWMVESLKAVKYIDSDHF  243

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVPHG+RAVELVAGKESA+ Q+ RT+ GK Y LTF VGDASN CEGSM++EAFAG +T+K
Sbjct  244  SVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNSCEGSMIVEAFAGRATVK  303

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDDF SLCGPV+D +KL+SVR P
Sbjct  304  VPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSSLCGPVLDDIKLLSVRKP  363

Query  147  HR  142
            ++
Sbjct  364  NQ  365



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   254 bits (649),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 144/184 (78%), Gaps = 2/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYID  520
            YPPRPTN N+LKN  FEEGPYVFP   +GVL PP   D  DHSPLP W VESLKAVKYID
Sbjct  182  YPPRPTNKNVLKNGGFEEGPYVFPNTTSGVLIPPNIVDLSDHSPLPGWIVESLKAVKYID  241

Query  519  AEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGP  340
            ++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK Y L+F VGDA N CEGS+ +EA+ G 
Sbjct  242  SDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGNSCEGSLSVEAYVGK  301

Query  339  STLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  160
             ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF SLCGPV+D V L+S
Sbjct  302  ESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFASLCGPVIDDVTLIS  361

Query  159  VRNP  148
            +R P
Sbjct  362  LRKP  365



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   253 bits (646),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 142/182 (78%), Gaps = 1/182 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FE GPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYID+EH
Sbjct  189  PKRPRG-NMLKNGNFEVGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDSEH  247

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T+
Sbjct  248  FHVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDASNSCEGSMLVEAFAGKITM  307

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            + PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV VRN
Sbjct  308  QFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGVRN  367

Query  150  PH  145
            PH
Sbjct  368  PH  369



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/184 (63%), Positives = 145/184 (79%), Gaps = 0/184 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+ T  NLLKN +FEEGPYVFP  D GVL PP  EDDHSPLP W +ESLKAVKYID +HF
Sbjct  195  PKRTRGNLLKNGNFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDLDHF  254

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G+RA+ELVAGKESA+ Q+ +T+ GK Y LTF VGDA+N CEGSM++EA+AG   ++
Sbjct  255  AVPEGKRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDANNACEGSMIVEAYAGKDKIQ  314

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
             PY SKG+GG+K AKL+F+A +  TR+MF S++Y  +SD+  SLCGPV+D VKL+SVR P
Sbjct  315  FPYVSKGKGGFKTAKLQFKAVSTHTRIMFLSSFYTMKSDNSGSLCGPVLDDVKLISVRQP  374

Query  147  HRRL  136
             R L
Sbjct  375  RRLL  378



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   252 bits (644),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 142/182 (78%), Gaps = 1/182 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP    GVL PP  EDDHSPL  W +ESLKAVKYIDAEH
Sbjct  190  PKRPKG-NMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHSPLLGWMIESLKAVKYIDAEH  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RAVELVAG+ESA+ Q+ RT  GK YDL F +GDASN CEGSM++EAFAG  T+
Sbjct  249  FTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASNSCEGSMLVEAFAGKITM  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            + PYESKG+GG K ++LRF A + RTRV F STYYH +SD+  SLCGPVVD V+LV VRN
Sbjct  309  QFPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYHMKSDNSGSLCGPVVDDVRLVGVRN  368

Query  150  PH  145
            P 
Sbjct  369  PR  370



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   249 bits (637),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ T  NLLKN +FEEGPY+FP    G L PP  ED HSPLP W VESLKAVKYID++H
Sbjct  111  PPKRTRANLLKNGNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDH  170

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+N CEGSM++EAFAG  T+
Sbjct  171  FAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETV  230

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            ++PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+  SLCGPV+D VKL+SVR 
Sbjct  231  QIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRY  290

Query  150  PHR  142
            P R
Sbjct  291  PRR  293



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   251 bits (642),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 150/184 (82%), Gaps = 1/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  517
            YPP+ T VNLLKN +FEEGPY+F   V  GV+ PP  EDDHSPLP W ++SLKAVKYID+
Sbjct  189  YPPKRTRVNLLKNGNFEEGPYIFSGPVSEGVIIPPHIEDDHSPLPGWIIDSLKAVKYIDS  248

Query  516  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  337
            +HF+VP G+RA+EL+AGKES+++Q+ RT  G+ Y L+F +GDA+N CEGSMV+EAFA  +
Sbjct  249  DHFTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDANNACEGSMVVEAFANKN  308

Query  336  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+  SLCGPVVD VKLVS+
Sbjct  309  TVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGSLCGPVVDDVKLVSI  368

Query  156  RNPH  145
            R  H
Sbjct  369  RKLH  372



>gb|AFK48067.1| unknown [Lotus japonicus]
Length=204

 Score =   245 bits (626),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 141/183 (77%), Gaps = 0/183 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR T  NLLKN +FEEGPY+FP    GVL PP  ED HSPLP W VESLKAVKYID+ H
Sbjct  21   PPRRTRDNLLKNGNFEEGPYMFPNTSWGVLIPPHIEDAHSPLPGWMVESLKAVKYIDSNH  80

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RAVELVAGKES + Q  +T  GK Y LTF VGDA+N CEGSMV+EAFAG  T+
Sbjct  81   FAVPAGKRAVELVAGKESVIAQNVKTTIGKVYVLTFAVGDANNSCEGSMVVEAFAGGDTV  140

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPY+SKG+GG+   KLRF+A + RTRV F ST+Y  ++D+  SLCGP++D ++L+SVR 
Sbjct  141  QVPYQSKGKGGFVRGKLRFKAVSARTRVRFLSTFYTMKNDNSGSLCGPIIDDIRLLSVRY  200

Query  150  PHR  142
            P R
Sbjct  201  PGR  203



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/183 (63%), Positives = 142/183 (78%), Gaps = 0/183 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ T  NLLKN +FEEGPY+FP    G L PP  ED HSPLP W VESLKAVKYID++H
Sbjct  193  PPKRTRANLLKNGNFEEGPYLFPNSSWGALIPPHIEDAHSPLPGWIVESLKAVKYIDSDH  252

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAGKESA+ Q+  T  G+ YDLTF VGDA+N CEGSM++EAFAG  T+
Sbjct  253  FAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANNACEGSMIVEAFAGAETV  312

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            ++PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+  SLCGPV+D VKL+SVR 
Sbjct  313  QIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLSVRY  372

Query  150  PHR  142
            P R
Sbjct  373  PRR  375



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   250 bits (639),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 149/184 (81%), Gaps = 1/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPK-VDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  517
            YPP+ T VNLLKN +FEEGPY+F   +  GV+ PP  EDDHSPLP W ++SLKAVKYID+
Sbjct  189  YPPKRTRVNLLKNGNFEEGPYIFAGPISEGVIIPPHIEDDHSPLPGWIIDSLKAVKYIDS  248

Query  516  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  337
            +HF+VP G+RA+EL+AGKES+++Q+ RT  G  Y L+F +GDA+N CEGSMV+EAFA  +
Sbjct  249  DHFTVPEGKRAIELIAGKESSLSQVVRTTIGGDYVLSFTIGDANNACEGSMVVEAFANKN  308

Query  336  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+  SLCGPVVD VKLVS+
Sbjct  309  TVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSGSLCGPVVDDVKLVSI  368

Query  156  RNPH  145
            R  H
Sbjct  369  RKLH  372



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   250 bits (639),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/179 (67%), Positives = 142/179 (79%), Gaps = 1/179 (1%)
 Frame = -2

Query  684  RPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFS  505
            RP + N+LKN +FEEGPY+FP    GVL PP  EDDH PLP W VESLKAVKY+DA+HF+
Sbjct  200  RPKD-NMLKNGNFEEGPYIFPNTTWGVLIPPNIEDDHCPLPGWIVESLKAVKYVDADHFT  258

Query  504  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  325
            VP G+RA+ELVAG+ESA+ Q   T AG+ YDLTF VGDA+N CEGSMV+EAFAG   L+ 
Sbjct  259  VPEGKRAIELVAGRESAIAQQVITKAGRIYDLTFSVGDANNSCEGSMVVEAFAGNVALQF  318

Query  324  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
             Y SKG+GG+K AKLRF AT+ RTRV F S+YYH +SD+  SLCGPVVD V+LVSVRNP
Sbjct  319  KYVSKGKGGFKRAKLRFTATSQRTRVRFLSSYYHMKSDNSGSLCGPVVDDVRLVSVRNP  377



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 140/187 (75%), Gaps = 3/187 (2%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            Y P+    N+LKN +FEEGPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID++
Sbjct  186  YTPKRQRGNMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSD  245

Query  513  HFSVPHGRRAVELVA---GKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAG  343
            HF VP G+RAVELVA   G+E A+ Q  RTV GK YDL F +GDA N CEGSM++EA AG
Sbjct  246  HFGVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSIGDAKNSCEGSMMVEATAG  305

Query  342  PSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  163
               L+VPYESKG GG+K AKLRF+A + RTR+ F STYYH +SD+  SLCGPV+D VKLV
Sbjct  306  KVILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYHMKSDNSGSLCGPVIDDVKLV  365

Query  162  SVRNPHR  142
             VR P R
Sbjct  366  GVRRPGR  372



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 140/184 (76%), Gaps = 0/184 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR T  NLLKN +FEEGPYVFP    GVL PP  ED H PLP W VESLKAVKYID++H
Sbjct  189  PPRRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVESLKAVKYIDSKH  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F VP G RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA+N CEGSM +EAFAG  T+
Sbjct  249  FYVPEGNRAIELVAGKESALAQVVITTIGKVYDLTFSVGDANNSCEGSMTVEAFAGGDTV  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPYESKG+GG+   KLRF A + RTR+ F ST+Y  ++D+  SLCGPV+D VKL+SVR 
Sbjct  309  QVPYESKGKGGFVRGKLRFTALSTRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLLSVRY  368

Query  150  PHRR  139
            P++ 
Sbjct  369  PNKH  372


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/188 (28%), Positives = 78/188 (41%), Gaps = 32/188 (17%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  505
            LL N DFE GP    ++   V+        H  +P WT+     V+YI +          
Sbjct  25   LLPNGDFEVGPKA-SELKGSVVT------SHDGIPNWTISGF--VEYIKSGQKQGDMLLI  75

Query  504  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK-  328
            VP G  AV L  G E+ + Q  +   G FY +TF    A+  C     L     P+T K 
Sbjct  76   VPEGAYAVRL--GNEAYIKQKVKLNKGSFYSITF---SAARTCAQEEKLNVSVVPTTEKR  130

Query  327  ----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  163
                +P ++  G  G++     F+A   +  ++      H    +    CGP++D V L 
Sbjct  131  DYGIIPIQTMYGSNGWESFACGFKADYEQGEIVI-----HNSGVEDDPACGPLIDSVAL-  184

Query  162  SVRNPHRR  139
             V NP RR
Sbjct  185  KVLNPPRR  192



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   249 bits (635),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            + P+ T  NLLKN +FEEGPYVFPK   GVL PP  ED +SPLP W VESLKAVKYID++
Sbjct  190  HSPKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWMVESLKAVKYIDSD  249

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+N CEGSMV+EAFAG  T
Sbjct  250  HFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAGKDT  309

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            ++V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  SLCGP++D ++L+SVR
Sbjct  310  IQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLLSVR  369


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 76/188 (40%), Gaps = 31/188 (16%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------F  508
             LL N DFE GP       + V  P       + +P WT+  +  V+YI +         
Sbjct  26   GLLPNGDFEVGPKPSELKGSIVTTP-------NGIPHWTISGM--VEYIKSGQKQGDMVL  76

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
             VPHG  AV L  G E+++ Q  + V G FY LTF    AS  C     L     PS  K
Sbjct  77   VVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLTF---SASRTCAQEEKLNVSVVPSNEK  131

Query  327  -----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
                  P ++  G  G       FRA   R  ++      H    D    CGP++D V L
Sbjct  132  SDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVI-----HNPGVDEDPACGPLIDSVAL  186

Query  165  VSVRNPHR  142
              + +P R
Sbjct  187  KLLHSPKR  194



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   248 bits (634),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            + P+ T  NLLKN +FEEGPYVFPK   GVL PP  ED +SPLP W VESLKAVKYID++
Sbjct  188  HSPKRTRDNLLKNGNFEEGPYVFPKESWGVLIPPHIEDAYSPLPGWMVESLKAVKYIDSD  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+RA+ELVAGKESA+ Q+  T+ GK YDLTF+VGDA+N CEGSMV+EAFAG  T
Sbjct  248  HFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANNSCEGSMVVEAFAGKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            ++V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  SLCGP++D ++L+SVR
Sbjct  308  IQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTGSLCGPIIDDIRLLSVR  367


 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 57/188 (30%), Positives = 76/188 (40%), Gaps = 31/188 (16%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------F  508
             LL N DFE GP       + V  P       + +P WT+  +  V+YI +         
Sbjct  24   GLLPNGDFEVGPKPSELKGSIVTTP-------NGIPHWTISGM--VEYIKSGQKQGDMVL  74

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
             VPHG  AV L  G E+++ Q  + V G FY LTF    AS  C     L     PS  K
Sbjct  75   VVPHGTYAVRL--GNEASIKQKIQVVKGMFYSLTF---SASRTCAQEEKLNVSVVPSNEK  129

Query  327  -----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
                  P ++  G  G       FRA   R  ++      H    D    CGP++D V L
Sbjct  130  SDWGVFPIQTMYGSNGCDSYACGFRADYPRVEIVI-----HNPGVDEDPACGPLIDSVAL  184

Query  165  VSVRNPHR  142
              + +P R
Sbjct  185  KLLHSPKR  192



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            Y P+ TN NL+KN +FEEGPYV PK   GVL PP  EDDHSPLP W +ESLKAVK++D++
Sbjct  188  YIPKRTNANLVKNGNFEEGPYVPPKTSWGVLIPPHIEDDHSPLPGWIIESLKAVKFVDSD  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+RAVELVAGKESA+ Q+  T  GK Y LTF VGDA N CEGSM +EA+AG ++
Sbjct  248  HFAVPEGKRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAKNSCEGSMAVEAYAGTAS  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            + VPY S G+GGY  AKLRF AT++RTRV F S+YY+ +SD   SLCGPV+D V+LVSVR
Sbjct  308  VTVPYTSTGKGGYVHAKLRFTATSDRTRVRFLSSYYNMQSDHSGSLCGPVIDDVRLVSVR  367

Query  153  NPHRRL  136
            N  R+L
Sbjct  368  N--RKL  371



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP  + G+L PP  EDDH PLP W +ESLKAVKYID EH
Sbjct  197  PHRPKG-NMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWIIESLKAVKYIDTEH  255

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA+N CEGSM++EAFAG   L
Sbjct  256  FAVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEGSMLIEAFAGKVAL  315

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPY SKG+GG+K AK RF A + RTRV F ST YH ++D+  SLCGPV+D V+LVSVRN
Sbjct  316  QVPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYHMKTDNSGSLCGPVIDDVRLVSVRN  375

Query  150  P  148
            P
Sbjct  376  P  376


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (43%), Gaps = 34/189 (18%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  499
            LL N +FE+GP       T V+      D H+ +P W     VE +K+ +        VP
Sbjct  31   LLPNGNFEQGPKPSQMKHTRVM------DPHA-IPHWELSGYVEYIKSGQMQGDMLLPVP  83

Query  498  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  334
             G  AV L  G+++++ T++     G FY L+F+    +  C     L     PS     
Sbjct  84   QGDFAVRL--GEDASLKTKVVNVTKGTFYALSFVF---ARTCAQEERLNVSVTPSKEPKD  138

Query  333  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  169
                 L+  Y S G   Y      F A AN   ++      H  + +    CGP++DFV 
Sbjct  139  WGMLPLQTMYSSDGWDTYS---WGFLAEANVVEIVL-----HNPAREKDPACGPLIDFVA  190

Query  168  LVSVRNPHR  142
            L +++ PHR
Sbjct  191  LKALKTPHR  199



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   247 bits (631),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 144/184 (78%), Gaps = 0/184 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+ T  NLLKN DFEEGPYVFP  D GVL PP  EDDHSPLP W +ESLKAVKYI++EHF
Sbjct  192  PKRTRDNLLKNGDFEEGPYVFPNTDWGVLIPPHIEDDHSPLPGWIIESLKAVKYINSEHF  251

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
             VP G+RA+ELVAGKESA++QI +T+  K Y LTF VGDA+N CEGS+V+E +AG   ++
Sbjct  252  KVPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDANNSCEGSLVVEVYAGNDKIE  311

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            +PY SKG+GG+KPA+ +F+A +  TR+MF S++Y  +SD+  SLCGPV+D VKL+SVR P
Sbjct  312  IPYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFYTMKSDNSGSLCGPVIDDVKLLSVRRP  371

Query  147  HRRL  136
               L
Sbjct  372  RHLL  375



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   247 bits (631),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 144/183 (79%), Gaps = 1/183 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P  T D+HSPLP W VESLKAVKYID++H
Sbjct  188  PPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRTVDEHSPLPGWMVESLKAVKYIDSDH  247

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDASN C GS+++EA+AG  + 
Sbjct  248  FAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMVEAYAGRESA  307

Query  330  KVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPYES GQGG  K A L FRAT+ RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR
Sbjct  308  KVPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVR  367

Query  153  NPH  145
              H
Sbjct  368  ARH  370



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   246 bits (629),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 141/185 (76%), Gaps = 1/185 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP + NLLKN +FEEGPYVFP  D GVL PP  EDDH PLP W V+SLKAVKYID++H
Sbjct  190  PKRPKD-NLLKNGNFEEGPYVFPNADWGVLVPPNIEDDHCPLPGWMVDSLKAVKYIDSDH  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RAVELVAGKESA++Q+ +T   K Y LTF VGD SN C GSMV+E +AG    
Sbjct  249  FTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAGKDKT  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRN
Sbjct  309  QVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRN  368

Query  150  PHRRL  136
            P R L
Sbjct  369  PRRHL  373


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/190 (26%), Positives = 75/190 (39%), Gaps = 37/190 (19%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  505
            LL N DFE+GP   P    G +         + +P W +     ++YI + H        
Sbjct  25   LLPNGDFEQGPR--PSEMKGTVVTA-----KNAIPNWEISGF--IEYIKSGHKQGDMVLV  75

Query  504  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  334
            VP G  AV L  G E+++ Q  +   G FY LTF   + +  C     L     P++   
Sbjct  76   VPAGAYAVRL--GNEASIKQRVKVTQGLFYSLTF---NVARTCAQEEKLNVSVSPNSEPR  130

Query  333  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  172
                  ++  Y S G   Y  A   F+A      +       H    +  + CGP++D V
Sbjct  131  DWGILPMQTMYSSNGWDAYAWA---FQADGPEVEISI-----HNPGVEEDAACGPLIDSV  182

Query  171  KLVSVRNPHR  142
             L  + NP R
Sbjct  183  ALKLLSNPKR  192



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   248 bits (632),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+    N+LKN +FEEGPY+FP    G+L PP  EDDHSPLP W +ESLKAVKY+D+ HF
Sbjct  219  PKRQRGNILKNGNFEEGPYIFPNTSYGILIPPNIEDDHSPLPGWMIESLKAVKYVDSNHF  278

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G+RAVELVAG+ESA+ Q  RTV GK Y+L F +GDA N CEGSM +EA AG   L+
Sbjct  279  AVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDAKNSCEGSMTVEANAGRDILQ  338

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPYESKG GG+K AKLRF+A ++RTRV F ST+YH +SD+  SLCGP++D V+LVS+R P
Sbjct  339  VPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDNSGSLCGPIIDDVRLVSIRYP  398


 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 51/191 (27%), Positives = 77/191 (40%), Gaps = 37/191 (19%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  505
            LL N +FE GP       T V+      D H+ +P+W +     V+YI + H        
Sbjct  54   LLPNGNFEYGPKPSQMKGTKVI------DPHA-IPSWEISGF--VEYITSGHKQGDMLLV  104

Query  504  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  334
            VP G  AV L  G E+++    +   G FY L+F    A+  C     L     P+    
Sbjct  105  VPEGASAVRL--GDEASIKTKVKVTNGMFYSLSF---SAARTCAQEEKLNVSVLPNKESK  159

Query  333  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  172
                  ++  Y S G   Y      F A +N   +M      H    +    CGP++D +
Sbjct  160  DWGILPIQTVYSSDGWDSYS---WGFLAQSNDIEIMI-----HNPGKEKDPACGPLIDSI  211

Query  171  KLVSVRNPHRR  139
             L ++ NP R+
Sbjct  212  ALKALPNPKRQ  222



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   246 bits (629),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 143/188 (76%), Gaps = 2/188 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTED--DHSPLPAWTVESLKAVKYID  520
            YPPR TN N+LKN  FEEG YVFP   +GVL PP   D  +HSPLP W VESLKAV+YID
Sbjct  181  YPPRLTNKNVLKNGGFEEGLYVFPNTSSGVLIPPNIVDHIEHSPLPGWMVESLKAVRYID  240

Query  519  AEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGP  340
            ++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK Y L F VGDA N  EGS+ +EA+ G 
Sbjct  241  SDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGNSSEGSLSVEAYVGK  300

Query  339  STLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  160
             ++KVPYESKG+GG+K A L+F A + RT ++F ST+Y+ RSDD  SLCGPV+D V L+S
Sbjct  301  ESVKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYNMRSDDLASLCGPVIDDVTLIS  360

Query  159  VRNPHRRL  136
            +R PHRR 
Sbjct  361  LRKPHRRF  368



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/182 (62%), Positives = 141/182 (77%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T  NLLKN + EEGPY+FP    G L PP  ED H PLP W VESLKAVKYID++
Sbjct  190  YPPKRTRANLLKNGNLEEGPYIFPNSSWGALIPPHIEDSHGPLPGWIVESLKAVKYIDSD  249

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+RA+ELVAGKESA+ Q+  T  GK YDLTF VGDA+N+CE SM++EAFAG +T
Sbjct  250  HFAVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDANNECEASMMVEAFAGANT  309

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            ++VPY+SKG+GG+   KLRF+A + RTR+ F ST+Y  +SD+  SLCGPV+D VKL+ VR
Sbjct  310  VQVPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFYTMKSDNSGSLCGPVIDDVKLLGVR  369

Query  153  NP  148
             P
Sbjct  370  YP  371


 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 51/188 (27%), Positives = 78/188 (41%), Gaps = 31/188 (16%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------F  508
             LL N +FE+GP   P    G +        H  +P WT+     V+YI +         
Sbjct  26   GLLPNGNFEQGPK--PSQLKGSVV-----TGHDAIPNWTISGF--VEYIKSGQKQGDMLL  76

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
             VP G  AV L  G E+++ Q  + + G FY +TF    A+  C     L     P+T K
Sbjct  77   VVPEGDYAVRL--GNEASIKQKLKLIKGSFYSITF---SAARTCAQEEKLNVSVVPTTEK  131

Query  327  -----VPYESK-GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
                 +P ++  G  G++     FRA     +++      H    +    CGP++D V L
Sbjct  132  RDWGIIPIQTMYGSNGWESFTCGFRADFPEAQIVI-----HNPGKEEDPACGPLIDSVAL  186

Query  165  VSVRNPHR  142
              +  P R
Sbjct  187  KVLYPPKR  194



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   246 bits (629),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 141/185 (76%), Gaps = 1/185 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP + NLLKN +FEEGPYVFP  D GVL PP  EDDH PLP W V+SLKAVKYID++H
Sbjct  212  PKRPKD-NLLKNGNFEEGPYVFPSTDWGVLVPPNIEDDHCPLPGWMVDSLKAVKYIDSDH  270

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RAVELVAGKESA++Q+ +T   K Y LTF VGD SN C GSMV+E +AG    
Sbjct  271  FTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSNSCVGSMVVEVYAGKDKT  330

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRN
Sbjct  331  QVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDNSGSLCGPVLDDVKLVSVRN  390

Query  150  PHRRL  136
            P R L
Sbjct  391  PRRHL  395


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/190 (27%), Positives = 76/190 (40%), Gaps = 37/190 (19%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH------FS  505
            LL N DFE+GP   P    G +         S +P W +     ++YI + H        
Sbjct  47   LLPNGDFEQGPK--PSEMKGTVVTA-----KSAIPNWEISGF--IEYIKSGHKQGDMVLV  97

Query  504  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST---  334
            VP G  AV L  G E+++ Q  +   G FY LTF   + +  C     L     P++   
Sbjct  98   VPAGAYAVRL--GNEASIKQRVKVTQGLFYSLTF---NVARTCAQEEKLNVSVSPNSEPR  152

Query  333  ------LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  172
                  ++  Y S G   Y  A   F+A     ++       H    +  + CGP++D V
Sbjct  153  DWGILPMQTMYSSNGWDAYAWA---FQADGPEVKISI-----HNPGVEEDAACGPLIDSV  204

Query  171  KLVSVRNPHR  142
             L  + NP R
Sbjct  205  ALKLLSNPKR  214



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   246 bits (627),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 140/181 (77%), Gaps = 1/181 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P RP   N+LKN +FEEGPY+FP  + G+L PP  EDDH PLP W +ESLKAVKY+DAEH
Sbjct  197  PHRPKG-NMLKNGNFEEGPYIFPNTNWGILIPPNIEDDHCPLPGWIIESLKAVKYVDAEH  255

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RAVELVAG+ESA+ Q   T AGK YDL F VGDA+N CEGSM++EAFAG   L
Sbjct  256  FTVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANNSCEGSMLIEAFAGKVAL  315

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +V Y SKG+GG+K AKLRF A + RT V F ST YH +SD+  SLCGPV+D V+LVSVRN
Sbjct  316  QVRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYHMKSDNSGSLCGPVIDDVRLVSVRN  375

Query  150  P  148
            P
Sbjct  376  P  376


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 53/189 (28%), Positives = 81/189 (43%), Gaps = 34/189 (18%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  499
            LL N +FE+GP       T V+ P      H+ +P W     VE +K+ +        VP
Sbjct  31   LLPNGNFEQGPKPSQMKHTIVINP------HA-IPHWELSGYVEYIKSGQMQGDMLLPVP  83

Query  498  HGRRAVELVAGKESAV-TQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST----  334
             G  AV L  G+++++ T++     G FY L+F+    +  C     L     PS     
Sbjct  84   QGDFAVRL--GEDASLKTKVVNVTKGTFYALSFVF---ARTCAQEERLNVSVTPSKEPKD  138

Query  333  -----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVK  169
                 L+  Y S G   Y      F A AN   ++      H  + +    CGP++DFV 
Sbjct  139  WGMLPLQTMYSSDGWDTYS---WGFFAEANVIEIVL-----HNPAREKDPACGPLIDFVA  190

Query  168  LVSVRNPHR  142
            L +++ PHR
Sbjct  191  LKALKTPHR  199



>gb|EMS52012.1| hypothetical protein TRIUR3_31218 [Triticum urartu]
Length=312

 Score =   243 bits (620),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++H
Sbjct  126  PPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSPLPGWMVESLKAVKYIDSDH  185

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV GK Y L+F VGDASN C GS+++EA+AG  + 
Sbjct  186  FAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASNTCRGSLMVEAYAGREST  245

Query  330  KVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR
Sbjct  246  KVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVR  305



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 139/179 (78%), Gaps = 1/179 (1%)
 Frame = -2

Query  684  RPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFS  505
            RP + N+LKN +FEEGPY+FP    GVL PP  EDDH PLP W VESLKAVKY+DA+HF+
Sbjct  200  RPKD-NMLKNGNFEEGPYIFPNTSWGVLIPPNIEDDHCPLPGWIVESLKAVKYVDADHFT  258

Query  504  VPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKV  325
            VP G+RA+ELVAG+ESA+ Q   T  G+ YDL F VGDA+N CEGSMV+EAFAG   L+ 
Sbjct  259  VPEGKRAIELVAGRESAIAQQVITKTGRIYDLIFSVGDANNACEGSMVVEAFAGNVALQF  318

Query  324  PYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
             Y SKG+GG+K AKLRF A + RTRV F S+YYH +SD+  SLCGPV+D V+LVSVRNP
Sbjct  319  QYVSKGKGGFKRAKLRFTAMSQRTRVRFLSSYYHMKSDNSGSLCGPVIDDVRLVSVRNP  377


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/188 (28%), Positives = 78/188 (41%), Gaps = 31/188 (16%)
 Frame = -2

Query  666  LLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWT----VESLKAVKYIDAEHFSVP  499
            LL N +FE+GP      +T V+      D H+ +P W     VE +K+ +        VP
Sbjct  31   LLPNGNFEQGPKSSQMKNTRVI------DPHA-IPHWELSGYVEYIKSGQMQGDMLLPVP  83

Query  498  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST-----  334
             G  AV L  G  S  T++     G FY L+F+    +  C     L     P++     
Sbjct  84   QGDYAVRLGEGA-SLKTKVTSVTKGTFYSLSFVF---ARTCAQEERLNVSVSPNSEPKDW  139

Query  333  ----LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
                L+  Y S G   Y      F A AN   ++  +   H +       CGP++DFV L
Sbjct  140  GMLPLQTMYSSDGWDTYSWG---FLAEANEIDIVLHNPIAHEKD----PACGPLIDFVAL  192

Query  165  VSVRNPHR  142
             +++  HR
Sbjct  193  KALKTTHR  200



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 139/182 (76%), Gaps = 0/182 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP  T  NLLKN +FEEGPYVFP    GVL PP  ED H PLP W VESLKAVKYID+EH
Sbjct  189  PPIRTRANLLKNGNFEEGPYVFPNASWGVLIPPHIEDAHGPLPGWIVESLKAVKYIDSEH  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAGKESA+ Q   T  GK Y LTF VGDA+N CEGSM +EAFAG  T+
Sbjct  249  FTVPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDANNACEGSMTVEAFAGRDTV  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            +VPY+SKG+GG+   KLRF+A+  RTR+ F ST+Y  ++D+  SLCGPV+D VKL+SVR 
Sbjct  309  QVPYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFYTMKNDNSGSLCGPVIDDVKLLSVRY  368

Query  150  PH  145
            P+
Sbjct  369  PN  370



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 137/179 (77%), Gaps = 0/179 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ T  NLLKN +FEEGP+VFP    GVL PP  EDDHSPLP W +ESLKAVKYID+ H
Sbjct  193  PPKRTRANLLKNGNFEEGPFVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSTH  252

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+ N CEGS+V+EAFAG  TL
Sbjct  253  FAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNACEGSLVVEAFAGKDTL  312

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPYESKG+GG+K A+L F A    TRVMF ST+Y   +D   SLCGPV+D VKL+SVR
Sbjct  313  KVPYESKGKGGFKRARLLFTAVETHTRVMFLSTFYTMSADHSGSLCGPVIDDVKLLSVR  371



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ T  NLLKN +FEEGPYV P    G L PP  EDDHSPLP W +ESLKAVKYID+EH
Sbjct  192  PPKRTRANLLKNGNFEEGPYVSPNTSWGTLIPPHIEDDHSPLPGWIIESLKAVKYIDSEH  251

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F VP GRRA+ELV GKESA+TQ+  T  GK Y LTF VGD++N CEGS+V+EAFAG  TL
Sbjct  252  FFVPEGRRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSNNSCEGSLVVEAFAGKDTL  311

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  312  KVPYQSKGKGGFKRARLIFTAVGPRTRIMFYSTFYTMVADHSGSLCGPIIDDVKLLSVR  370



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/179 (65%), Positives = 136/179 (76%), Gaps = 0/179 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ T  NLLKN DFEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID+ H
Sbjct  193  PPKRTRANLLKNGDFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSNH  252

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+RA+ELVAGKESA+ Q+  T  G+ Y LTF VGD+ N CEGS+V+EAFAG  TL
Sbjct  253  FAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKNSCEGSLVVEAFAGKDTL  312

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPYES G+GG+K A+L F A    TRVMF S++Y   +D   SLCGPV+D VKL+SVR
Sbjct  313  KVPYESMGKGGFKRARLLFTAVETHTRVMFLSSFYTMSADHSGSLCGPVIDDVKLLSVR  371



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ T  NLLKN +FEEGPYV P    GVL PP  EDDHSPLP W +ESLKAVKYID++H
Sbjct  192  PPKRTRANLLKNGNFEEGPYVLPNASWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKH  251

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F VP GRRA+ELV GKESA+ Q+  T  GK Y LTF VGD++N CEGS+++EAFAG  TL
Sbjct  252  FFVPEGRRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFAGKDTL  311

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  312  KVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKLLSVR  370



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   243 bits (621),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 137/178 (77%), Gaps = 0/178 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  193  PKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKHF  252

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP GRRA+ELVAGKESA+ Q+  T+ GK Y LTF VGD++N CEGS+ +EAFAG  TLK
Sbjct  253  SVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSNNACEGSLAVEAFAGKDTLK  312

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            V Y+SKGQGG+K A+  F A   RTRVMF+S +Y   +D   SLCGPV+D VKL+SVR
Sbjct  313  VLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADHSGSLCGPVIDDVKLLSVR  370



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   242 bits (617),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  151  PKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKHF  210

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD +N CEGS+ +EAFAG  T+K
Sbjct  211  AVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNNGCEGSLFIEAFAGKETVK  270

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPYESKG+GG+K A+L F A + RTRVMF ST Y   SD   SLCGPV+D VKL+S+R  
Sbjct  271  VPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSGSLCGPVIDDVKLLSIRGR  330

Query  147  HR  142
             R
Sbjct  331  PR  332



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+ T  NLLKN +FEEGPYV P    GVL PP  EDDHSPLP W +ESLKAVKYID++H
Sbjct  192  PPKRTRANLLKNGNFEEGPYVLPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSQH  251

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F VP GR+A+ELV GKESA+ Q+  T  GK Y LTF VGD++N CEGS+++EAFAG  TL
Sbjct  252  FFVPEGRKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNNACEGSLIVEAFAGKDTL  311

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   SLCGP++D VKL+SVR
Sbjct  312  KVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSGSLCGPIIDDVKLLSVR  370



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   242 bits (617),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 143/180 (79%), Gaps = 1/180 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++H
Sbjct  154  PPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRMVDEHSPLPGWMVESLKAVKYIDSDH  213

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VG+ASN C GS+++EA+AG  + 
Sbjct  214  FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASNTCRGSLMVEAYAGREST  273

Query  330  KVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD  SLCGPV+D V +VSVR
Sbjct  274  KVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDMSSLCGPVIDDVAVVSVR  333



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   242 bits (618),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+    NLLKN +FEEGPY+FP  D GVL PP  EDD  PLP W V+SLKAVKYID+EHF
Sbjct  190  PKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHNEDDQCPLPGWIVDSLKAVKYIDSEHF  249

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G+RAVEL+AGKESA++QI +T+  K Y LTF VGD SN C GSMV+E +AG    +
Sbjct  250  TVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSNSCVGSMVVEVYAGKDRTQ  309

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPY+S G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP
Sbjct  310  VPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNP  369

Query  147  HRRL  136
             R L
Sbjct  370  RRHL  373



>dbj|BAD16016.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD38436.1| unknown protein [Oryza sativa Japonica Group]
Length=302

 Score =   239 bits (611),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++H
Sbjct  114  PPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDH  173

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + 
Sbjct  174  FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGREST  233

Query  330  KVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  234  RVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  293



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T VN+LKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID +
Sbjct  188  YPPKRTGVNMLKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYIDLK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESA+TQ+ +T   K Y L+F VGDA N C G++ +EA+AG   
Sbjct  248  HFSVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAGRDN  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD   SLCGPV+D VKL+  R
Sbjct  308  VKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGSLCGPVIDDVKLLVAR  367



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 116/182 (64%), Positives = 138/182 (76%), Gaps = 0/182 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+ T  NLLKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID++HF
Sbjct  191  PKRTRANLLKNGNFEEGPYVFPNTSWGVLIPPHIEDDHSPLPGWIIESLKAVKYIDSKHF  250

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP GRRA+EL+AGKESA+ Q+  T  G+ Y LTF VGD +N CEGS+ +EAFAG  T+K
Sbjct  251  AVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNNGCEGSLFIEAFAGKETVK  310

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPYESKG+GG+K A+L F A + RTRVMF ST Y   SD   SLCGPV+D VKL+S+R  
Sbjct  311  VPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSGSLCGPVIDDVKLLSIRGR  370

Query  147  HR  142
             R
Sbjct  371  PR  372



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 139/184 (76%), Gaps = 0/184 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            + PR    N+LKN +FE GPY+FP    GVL PP  EDDHSPLP W +ESLKAVKYID++
Sbjct  186  HTPRRPRGNMLKNGNFEAGPYIFPNTKWGVLIPPNIEDDHSPLPGWMIESLKAVKYIDSD  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            +F VP G+RAVELV G+ES V Q+ RT   K YDL F VGD++NKCEGSM++ A+AG   
Sbjct  246  NFRVPEGKRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSNNKCEGSMMVVAYAGVDI  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            L+VPYESKG GG+K A++RF+AT+ RTR+ F S YYH +SD+  SLCGPVVD V+LV +R
Sbjct  306  LQVPYESKGHGGFKSARMRFKATSTRTRIRFSSEYYHMKSDNSGSLCGPVVDDVRLVRIR  365

Query  153  NPHR  142
             P R
Sbjct  366  YPSR  369



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   240 bits (613),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 114/183 (62%), Positives = 139/183 (76%), Gaps = 0/183 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    DDHSPLP W VESLKA+KYID++ 
Sbjct  181  PPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVDDHSPLPGWMVESLKAIKYIDSDS  240

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN C GS+++EA+AG  + 
Sbjct  241  FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNACRGSLMVEAYAGREST  300

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            KV YES G+GG K A L FRA + RTR++FFS++Y TRSDD  SLCGPV+D V +VSVR 
Sbjct  301  KVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGPVLDDVAVVSVRT  360

Query  150  PHR  142
              R
Sbjct  361  TKR  363



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   241 bits (614),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 137/184 (74%), Gaps = 0/184 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+    NLLKN +FEEGPY+FP  D GVL PP  EDD  PLP W V+SLKAVKYID EHF
Sbjct  206  PKRARDNLLKNGNFEEGPYMFPNTDWGVLIPPHIEDDQCPLPGWIVDSLKAVKYIDREHF  265

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G+RAVELVAGKESA++Q  +T+  K Y LTF VGD SN C GSMV+E +AG    +
Sbjct  266  TVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYVGDTSNSCVGSMVVEVYAGKDRTQ  325

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  SLCGPV+D VKLVSVRNP
Sbjct  326  VPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSGSLCGPVLDDVKLVSVRNP  385

Query  147  HRRL  136
             R L
Sbjct  386  RRHL  389



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   240 bits (613),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++H
Sbjct  191  PPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDH  250

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + 
Sbjct  251  FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGREST  310

Query  330  KVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  311  RVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  370



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++H
Sbjct  191  PPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDH  250

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + 
Sbjct  251  FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGREST  310

Query  330  KVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  311  RVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  370



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 140/180 (78%), Gaps = 1/180 (1%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    D+HSPLP W VESLKAVKYID++H
Sbjct  177  PPRRTNKNLVKNGDFEEGPYIIPGTRWGVLIPSMVVDEHSPLPGWMVESLKAVKYIDSDH  236

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F VGDASN CEGS+V+EA+AG  + 
Sbjct  237  FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNGCEGSLVVEAYAGREST  296

Query  330  KVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  297  RVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMSSLCGPVIDDVAVVSVR  356



>gb|KJB70570.1| hypothetical protein B456_011G080200 [Gossypium raimondii]
Length=203

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 139/178 (78%), Gaps = 1/178 (1%)
 Frame = -2

Query  675  NVNLLKNWDFEEGPYVFPKVDT-GVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVP  499
            + NLLKN +FEEGPY+FP + + G++ PP  EDDHSPLP W +ESLKA+KYID+EH SVP
Sbjct  24   DANLLKNGNFEEGPYIFPILTSEGLIIPPEIEDDHSPLPGWIIESLKAIKYIDSEHLSVP  83

Query  498  HGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPY  319
             G+ A+EL+AGKESAV QI +T  G+ Y L+F+VGDA+N CEG M++EAFAG + + V Y
Sbjct  84   QGKWAIELIAGKESAVAQIVKTTIGRNYVLSFVVGDANNGCEGPMMVEAFAGKNMVMVSY  143

Query  318  ESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  145
             SKG+GG+K A+L FRA + RTR+MF+ST Y  +SD+  SLCGPV+D V L+SVR  H
Sbjct  144  NSKGKGGFKAARLAFRAESTRTRIMFYSTIYTIKSDNSGSLCGPVLDDVMLLSVRKLH  201



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR    NL+KN +FEEGPYVFP    GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  186  FPPRFIGNNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RA+ELVAGKESA++QI RT   +FY LTF VGDA + CEG M++EAFAG S 
Sbjct  246  HFAVPEGHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDARDTCEGPMIVEAFAGRSK  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            + V Y SKG+GG+   KL F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV++R
Sbjct  306  IMVDYVSKGKGGFTQGKLVFKAVSTRTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAIR  365



>gb|KDO83473.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=291

 Score =   236 bits (601),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP PT  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+
Sbjct  111  YPPMPTRDNLVKNPGFEEGPHRLVNTTNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDAK  170

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP+G  AVELVAG+ESA+ QI RTV  K Y+LTF +GDA N C GSM +EAFAG  T
Sbjct  171  HFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDT  230

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            + VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF SLCGPV+D V+++S+R
Sbjct  231  VAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGSLCGPVLDEVRVLSIR  290



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR    N++KN +FEEGPYVFP V  GVL PPF EDD+S LP W VESLKAVKY+D  H
Sbjct  183  PPRFLRNNMIKNGNFEEGPYVFPNVKWGVLIPPFIEDDNSALPGWIVESLKAVKYVDKAH  242

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G RA+ELV GKES+V QI RT   KFY LTF VGDA N CEG M +EAFAG   +
Sbjct  243  FAVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDAGNSCEGPMAVEAFAGRGRI  302

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
             V Y S G+GG KPA+L F+A + RTRV F ST+YHT+SD   SLCGPV+D V+LV VR+
Sbjct  303  SVDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYHTKSDHSGSLCGPVIDDVRLVPVRS  362



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   238 bits (608),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 111/184 (60%), Positives = 141/184 (77%), Gaps = 1/184 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFP-KVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDA  517
            Y P+ T  NLLKN +FEEGPY+FP     GV+ PP  EDDHSPLP W +ESLKA+K+ID+
Sbjct  189  YYPKRTRANLLKNGNFEEGPYIFPIPTSEGVIIPPEIEDDHSPLPGWIIESLKAIKHIDS  248

Query  516  EHFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPS  337
            EHFSVP G+RA+EL+AGKES V QI +T  G+ Y L+F+VGDA+N CEG M++EAFAG +
Sbjct  249  EHFSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDANNGCEGPMMVEAFAGKN  308

Query  336  TLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             + V Y SKG+GG+K A+L FRA + RTR+ F+ST Y  +SD+  SLCGPV+D VKL+SV
Sbjct  309  MVMVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIYTIKSDNSGSLCGPVLDDVKLLSV  368

Query  156  RNPH  145
            R  H
Sbjct  369  RKLH  372



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   238 bits (607),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 0/176 (0%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  490
            N+LKN +FEEGPY+FP    G L PP  EDDHSPLP W +ESLKAVKY+D++H+ VP G+
Sbjct  198  NMLKNGNFEEGPYIFPNTTYGCLIPPNIEDDHSPLPGWIIESLKAVKYVDSDHYGVPEGK  257

Query  489  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  310
            RAVELVAG+ESA+ QI +TV GK YDL FL+GDA N CEG M +EA AG ++L+  YESK
Sbjct  258  RAVELVAGRESALAQIVKTVPGKTYDLYFLLGDAKNSCEGMMTVEAAAGKNSLQFHYESK  317

Query  309  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPHR  142
            G GG++ +KLRF+A + RTRV F S  YH +SD+  SLCGPV+D V+LV VRNP R
Sbjct  318  GAGGFQRSKLRFKAVSVRTRVRFLSMLYHMKSDNTGSLCGPVIDDVRLVGVRNPGR  373



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVFP   +GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  188  FPPRFSGYNLIKNGNFEEGPYVFPTAKSGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKA  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M +EAFAG   
Sbjct  248  HFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFSVGDARDGCEGPMTVEAFAGQGK  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            + V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+VR
Sbjct  308  VMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAVR  367



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/179 (63%), Positives = 136/179 (76%), Gaps = 0/179 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    DDHSPLP W VESLKAV+Y+D   
Sbjct  192  PPRRTNRNLVKNGDFEEGPYILPGTKWGVLIPSRVVDDHSPLPGWMVESLKAVRYVDGGS  251

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+E AV Q+ RTV G+ Y L+F VGDA N C GS+V+EA+AG  ++
Sbjct  252  FAVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAGNACRGSLVVEAYAGRESV  311

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KV YES+G+GG + A L FRA A RTR++FFS++Y TRSDD  SLCGPV+D V +VSVR
Sbjct  312  KVAYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDLSSLCGPVLDDVAVVSVR  370



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/177 (63%), Positives = 136/177 (77%), Gaps = 0/177 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP+ T VN+LKN +FEEGPYVFP    GVL PP  EDDHSPLP W +ESLKAVKYID +
Sbjct  188  YPPKRTGVNILKNGNFEEGPYVFPNASWGVLIPPKIEDDHSPLPGWIIESLKAVKYIDLK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP GRRA+ELVAGKESA+TQ+ +T   K Y L+F VGDA N C G++ +EA+AG   
Sbjct  248  HFFVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDAGNGCAGTLGVEAYAGREN  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  163
            +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD   SLCGPV+D VKL+
Sbjct  308  VKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSGSLCGPVIDDVKLL  364



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/178 (62%), Positives = 134/178 (75%), Gaps = 0/178 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P  T  NLLKN +FEEGPY+FP    G L PP  EDDHSPLP W +ESLKAVKY+D+EHF
Sbjct  151  PLKTRGNLLKNGNFEEGPYIFPNTTWGALIPPNIEDDHSPLPGWIIESLKAVKYVDSEHF  210

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G+RAVEL+AG+ESA+ QI +T+ G +YDL F VGDA N CEGSM++EA AG  TL+
Sbjct  211  SVPEGKRAVELIAGRESAIAQIVKTIPGWWYDLVFSVGDAKNGCEGSMLIEASAGKVTLQ  270

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            VPY+S G+G +  A  RFRA + RTRV F S  YH RSD+  +LCGPV+D V+L S+R
Sbjct  271  VPYQSSGKGKFIRATHRFRAVSRRTRVRFLSINYHMRSDNTGTLCGPVIDDVRLYSLR  328



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 135/182 (74%), Gaps = 0/182 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+ T  NLLKN +FEEGPYVFP    GVL PP  +D HSPLP W ++SLKAVKYID++HF
Sbjct  193  PKRTRANLLKNGNFEEGPYVFPNAPWGVLIPPHIDDAHSPLPGWIIDSLKAVKYIDSDHF  252

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
             VP G+RA+ELV GKES++ QI RT  GK Y LTF VGDA N C GS+ +EAFAG  T K
Sbjct  253  HVPEGKRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAKNSCVGSLGIEAFAGNGTTK  312

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNP  148
            V Y S G GG+K AKLRF+AT  RTRVMFFST+Y   SD+  +LCGP +D VKL+SVR P
Sbjct  313  VVYVSTGSGGFKRAKLRFKATQWRTRVMFFSTFYTMTSDNSGTLCGPTLDDVKLISVRTP  372

Query  147  HR  142
             R
Sbjct  373  PR  374



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP PT  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+
Sbjct  188  YPPMPTRDNLVKNPGFEEGPHRLVNTTNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDAK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP+G  AVELVAG+ESA+ QI RTV  K Y+LTF +GDA N C GSM +EAFAG  T
Sbjct  248  HFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKNGCHGSMRVEAFAGKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            + VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF SLCGPV+D V+++S+R
Sbjct  308  VAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFGSLCGPVLDEVRVLSIR  367



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/179 (62%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR ++ NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  186  FPPRFSSNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RA+ELVAGKESA++QI RT   KFY LTF VGDA + CEG M +EA AG   
Sbjct  246  HFAVPEGHRAIELVAGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMTVEALAGRGK  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
              V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+V
Sbjct  306  AMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAV  364



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   235 bits (600),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  186  FPPRFSGNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M++EA AG   
Sbjct  246  HFAVPEGHRAIELVGGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGK  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
              V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+V
Sbjct  306  TMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDGVRLVAV  364



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   235 bits (599),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 109/179 (61%), Positives = 135/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVFP    GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  187  FPPRFSGYNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWMIESLKAVKYVDKA  246

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M++EAFAG   
Sbjct  247  HFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFNVGDARDGCEGPMIVEAFAGQGK  306

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            + V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV+V
Sbjct  307  VMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVAV  365



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  195  FPPRFSGNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  254

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G+RA+ELV GKESA++QI RT     Y LTF VGDA + CEG M++EAFAG   
Sbjct  255  HFYVPEGQRAIELVGGKESAISQIVRTSVNNLYSLTFNVGDARDGCEGPMMVEAFAGGRK  314

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            + V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   S+CGPV+D V+LV+VR
Sbjct  315  IMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSMCGPVIDDVRLVAVR  374



>ref|XP_010472958.1| PREDICTED: uncharacterized protein LOC104752499 [Camelina sativa]
Length=369

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 133/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVFPK   GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  186  FPPRFSGNNLIKNGNFEEGPYVFPKAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M++EA AG   
Sbjct  246  HFAVPEGHRAIELVGGKESAISQIVRTSVNKFYALTFNVGDARDGCEGPMIVEALAGRGK  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
              V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   SLCGPV+D V+LV V
Sbjct  306  TMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSGSLCGPVIDDVRLVVV  364



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVFP    GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  187  FPPRFSGYNLIKNGNFEEGPYVFPTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  246

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA + CEG M +EAFAG   
Sbjct  247  HFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGN  306

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
              V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D   SLCGPVVD V+LV+V+
Sbjct  307  TLVDYMSKGKGGFKQGRLVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVK  366



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 136/178 (76%), Gaps = 4/178 (2%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P+P   NLLKN ++EEGPYVFP    GVL PP  ED+HSPLP W +ESLKAVKYID++HF
Sbjct  185  PKP---NLLKNGNYEEGPYVFPNTSWGVLIPPHIEDNHSPLPGWIIESLKAVKYIDSKHF  241

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G RA+ELV GKESA+ Q+  T+ GK Y LTF VGD++N CEGS+V+EAFAG   LK
Sbjct  242  SVPEGWRAIELV-GKESALAQVVFTLPGKLYALTFTVGDSNNACEGSLVVEAFAGKDILK  300

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            VPY+SKG+GG+K  +  F A   RTR+MF+ST+Y   +D   SLCGPV+D VKL+SVR
Sbjct  301  VPYQSKGRGGFKRXRFLFTAVGPRTRIMFYSTFYTMAADHSGSLCGPVIDDVKLLSVR  358



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 132/178 (74%), Gaps = 0/178 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP PT  NL++N  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID+ H
Sbjct  186  PPMPTRDNLVRNGGFEEGPHLLKNSTNGVLLPPKQEDATSPLPGWIIESLKAVKFIDSAH  245

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP+G  AVELVAGKESA+ Q+ RTV  K Y+LTF VGDA N C GSM +EAFAG  TL
Sbjct  246  FNVPYGSAAVELVAGKESAIAQVIRTVPNKLYNLTFTVGDARNGCHGSMSVEAFAGAETL  305

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            KVP+ESKG+GG+K    +F+A   RTR+ FFS++YHTR DD+ SLCGP++D V++  V
Sbjct  306  KVPFESKGKGGFKAVSFKFKAVGARTRITFFSSFYHTRVDDYGSLCGPILDQVRVFPV  363



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 132/180 (73%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVF     GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  187  FPPRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  246

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA + CEG M +EAFAG   
Sbjct  247  HFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDACEGPMAVEAFAGRGK  306

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
              V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D   SLCGPVVD V+LV+V+
Sbjct  307  TLVEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVK  366



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   229 bits (583),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 132/180 (73%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN +FEEGPYVF     GVL PPF EDD+SPLP W +ESLKAVKY+D  
Sbjct  186  FPPRFSGYNLIKNGNFEEGPYVFSTAKWGVLIPPFIEDDNSPLPGWIIESLKAVKYVDKA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G RA+ELV GKESAV+QI RT   KFY LTF VGDA + CEG M +EAFAG   
Sbjct  246  HFFVPEGHRAIELVGGKESAVSQIVRTSPNKFYALTFNVGDARDGCEGPMAVEAFAGRGK  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
              V Y SKG+GG+K  +L F+A + RTRV F ST+YH ++D   SLCGPVVD V+LV+V+
Sbjct  306  TLVEYVSKGKGGFKRGRLVFKAVSARTRVTFLSTFYHMKNDHSGSLCGPVVDDVRLVAVK  365



>dbj|BAD52536.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61499.1| unknown protein [Oryza sativa Japonica Group]
Length=299

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA 
Sbjct  112  YPPTLAKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAA  171

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RAVELV GKESA+ Q  RTV G  Y L+F VGDA + C GSMV EA+A  ++
Sbjct  172  HFAVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARAS  231

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GGYK A L F A ANRTRV+F ST+YHT +D   SLCGPV+D   LV +R
Sbjct  232  IKVPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG--SLCGPVIDDASLVGLR  289

Query  153  --NPHRRL  136
                 RRL
Sbjct  290  KKTAGRRL  297



>ref|NP_001140426.1| hypothetical protein precursor [Zea mays]
 gb|ACF83808.1| unknown [Zea mays]
 gb|ACR34644.1| unknown [Zea mays]
 gb|AFW70605.1| hypothetical protein ZEAMMB73_168025 [Zea mays]
Length=371

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/168 (63%), Positives = 128/168 (76%), Gaps = 0/168 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PPR TN NL+KN DFEEGPY+ P    GVL P    +DHSPLP W VESLKA+KYID E 
Sbjct  189  PPRRTNKNLVKNGDFEEGPYIIPGTKWGVLIPSRVVEDHSPLPGWMVESLKAIKYIDGES  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GRRAVEL+AG+ESA+ Q+ RTV G+ Y L+F +GDASN C GS+++EA+AG  + 
Sbjct  249  FAVPRGRRAVELLAGRESAIAQVIRTVPGRQYVLSFTIGDASNACRGSLMVEAYAGREST  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGP  187
            KV YES G+GG K A L FRA + RTR++FFS++Y TRSDD  SLCGP
Sbjct  309  KVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLCGP  356



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP  T  NL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID+ 
Sbjct  186  FPPMATKDNLVKNSGFEEGPHLLQNSTNGVLLPPKQEDSTSPLPGWIIESLKAVKFIDSA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP+G +AVELVAG+ESA+ QI RTV  + Y ++F VGDA N C GSM++EAFA   T
Sbjct  246  HFNVPYGFKAVELVAGRESAIAQIIRTVPNRLYGVSFTVGDARNGCHGSMMVEAFAAKET  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES G+GG+K A  +F+A   RTR+ F+S++YHTR DD+ SLCGP++D V++V VR
Sbjct  306  LKVPYESHGKGGFKTASFKFKAIEPRTRITFYSSFYHTRVDDYGSLCGPILDQVRVVPVR  365



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/175 (63%), Positives = 132/175 (75%), Gaps = 2/175 (1%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  490
            ++L+N +FEEGPYV P    G+L PP  EDDHSPL  W VESLKAV+YID++HF+VP G+
Sbjct  195  DILQNGNFEEGPYVLPNTSWGILIPPNVEDDHSPLVGWMVESLKAVRYIDSDHFAVPEGK  254

Query  489  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  310
            RAVELVAG+ES+V Q+ +TV GK YDL F VGDA N CEGSM++E  A  ST  VPYESK
Sbjct  255  RAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARNMCEGSMLVEVNASNSTFYVPYESK  314

Query  309  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRNPH  145
            G+GG K A LRF+A   RTR+ F S+YYH +SD   SLCGPVVD V+L  VR PH
Sbjct  315  GKGGSKLALLRFKAETGRTRIRFLSSYYHMKSDFSGSLCGPVVDGVRL--VRVPH  367



>dbj|BAB21293.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB93263.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ12659.1| hypothetical protein OsJ_02574 [Oryza sativa Japonica Group]
 dbj|BAG93001.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87537.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   225 bits (573),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA 
Sbjct  186  YPPTLAKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAA  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RAVELV GKESA+ Q  RTV G  Y L+F VGDA + C GSMV EA+A  ++
Sbjct  246  HFAVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARAS  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GGYK A L F A ANRTRV+F ST+YHT +D   SLCGPV+D   LV +R
Sbjct  306  IKVPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG--SLCGPVIDDASLVGLR  363

Query  153  --NPHRRL  136
                 RRL
Sbjct  364  KKTAGRRL  371



>emb|CDP07813.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   224 bits (572),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+PT  NL+KN DFEEGPY       GVL PP  ED  SPLP W +ESLKAVK+IDA H
Sbjct  198  PPKPTRANLVKNGDFEEGPYRLINSSHGVLLPPSQEDRTSPLPGWIIESLKAVKFIDAMH  257

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP GR A+EL+ G+ES + QI RTV  K Y+LTF VGD  N C GSM++EAFA  STL
Sbjct  258  FNVPSGRAAIELLGGRESVIAQIIRTVPNKEYNLTFSVGDGKNGCHGSMMVEAFAAKSTL  317

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            KVP++S G+G YK    +F A + RTR+ FFS++YHT+ DD+ +LCGPV+D VK+V+ R
Sbjct  318  KVPFQSVGKGQYKTVSFKFTAISARTRLTFFSSFYHTKIDDYGALCGPVLDNVKVVTAR  376



>gb|ABF99456.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAH00287.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  117  PYPTKDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHF  176

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T K
Sbjct  177  SVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQK  236

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  237  VPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  290



>ref|NP_001043549.2| Os01g0611000 [Oryza sativa Japonica Group]
 dbj|BAF05463.2| Os01g0611000, partial [Oryza sativa Japonica Group]
Length=399

 Score =   225 bits (573),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA 
Sbjct  212  YPPTLAKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAA  271

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RAVELV GKESA+ Q  RTV G  Y L+F VGDA + C GSMV EA+A  ++
Sbjct  272  HFAVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARDGCAGSMVAEAYAARAS  331

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GGYK A L F A ANRTRV+F ST+YHT +D   SLCGPV+D   LV +R
Sbjct  332  IKVPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG--SLCGPVIDDASLVGLR  389

Query  153  --NPHRRL  136
                 RRL
Sbjct  390  KKTAGRRL  397



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 134/177 (76%), Gaps = 0/177 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPT  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID +
Sbjct  188  FPPRPTRDNLVKNAGFEEGPHRLINSSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDKK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ Q+ RT+  K Y+LTF VGDA N C GSM++EAFA   T
Sbjct  248  HFNVPFGLAAVELVAGRESAIAQMIRTLPSKCYNLTFAVGDARNGCHGSMMVEAFAAKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  163
            LKVP++S+G+G +K A L+F+A + RTR+ FFS++YHTR DDF SLCGPV+D V++V
Sbjct  308  LKVPFQSQGKGRFKTASLKFKALSARTRLTFFSSFYHTRIDDFGSLCGPVLDEVRVV  364



>ref|XP_010534242.1| PREDICTED: uncharacterized protein LOC104809851 [Tarenaya hassleriana]
Length=365

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 106/177 (60%), Positives = 130/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL++N  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID++HF
Sbjct  188  PLPTRDNLVRNPGFEEGPHRLVNSTGGVLLPPKQEDSTSPLPGWIIESLKAVKFIDSKHF  247

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP+G  A+ELVAGKESA+ Q+ RTV  K Y L+F VGDA N C GSMV+EAFAG  TLK
Sbjct  248  NVPYGEAAIELVAGKESAIAQVIRTVPNKVYSLSFAVGDARNGCHGSMVVEAFAGKDTLK  307

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            VP+ S G G YK A L+F+A   RTR+ FFSTYYHT+ DDF SLCGP++D +++V V
Sbjct  308  VPHNSVGAGHYKTASLKFKALEARTRITFFSTYYHTKKDDFGSLCGPIIDDIRVVPV  364



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 130/176 (74%), Gaps = 0/176 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPT  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID++
Sbjct  186  FPPRPTRDNLVKNPGFEEGPHRLVNTSNGVLLPPRQEDLTSPLPGWIIESLKAVKFIDSK  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RT+  K YDLTF VGDA N C GSM++EAFA   T
Sbjct  246  HFNVPFGLAAVELVAGRESAIAQILRTIPNKVYDLTFSVGDAKNGCHGSMMVEAFAAKDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
             KVP+ES+G+G +K     F+A + RTR+ F+S+YYHTR DDF SLCGPV+D V++
Sbjct  306  FKVPFESQGKGKFKTVSFNFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRV  361



>ref|XP_006845336.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
 gb|ERN07011.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
Length=369

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP PT  NL+KN  FEEGP+V     +G+L PP   D +SPLP W +ES+KAV+Y+D+ 
Sbjct  191  FPPFPTKDNLVKNGGFEEGPHVLKNSTSGILLPPKQNDINSPLPGWIIESIKAVRYLDSH  250

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ Q+ RTV  K Y L+F+VGDA N C GSM++EAFAG  T
Sbjct  251  HFTVPLGAAAVELVAGRESAIAQLIRTVPKKVYTLSFIVGDAKNGCHGSMLVEAFAGKDT  310

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            +KVP+ES+GQGGYK  K+RF A   RTR+ FFS++YHT+ DD  ++CGP+VD VK+
Sbjct  311  VKVPFESRGQGGYKVGKMRFMALEPRTRITFFSSFYHTKVDDPGTMCGPIVDEVKV  366



>gb|KDP43556.1| hypothetical protein JCGZ_16843 [Jatropha curcas]
Length=365

 Score =   222 bits (566),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 104/179 (58%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPT  NL+KN  FEEGP++F     GVL PP   D  SPLP W +ESLKAVK+ID++
Sbjct  186  FPPRPTRYNLVKNPGFEEGPHLFVNSSNGVLLPPRQLDLTSPLPGWIIESLKAVKFIDSK  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF VGDA N C GSM++EAFA   T
Sbjct  246  HFNVPFGLAAVELVAGRESAIAQILRTIPNKVYGLTFSVGDAKNGCHGSMMVEAFAAKDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP+ES+G+G +K    +F+A + RTR+ F+S+YYHTR DDF SLCGPV+D V++  +
Sbjct  306  FKVPFESQGKGKFKTVSFKFKAVSARTRITFYSSYYHTRIDDFGSLCGPVLDQVRVFPI  364



>gb|EAY92272.1| hypothetical protein OsI_13995 [Oryza sativa Indica Group]
Length=363

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  185  PYPTKDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHF  244

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T K
Sbjct  245  SVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQK  304

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  305  VPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  358



>dbj|BAK03627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 114/188 (61%), Positives = 132/188 (70%), Gaps = 4/188 (2%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP  +  N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA 
Sbjct  184  YPPTLSKGNMLKNGGFEEGPYFLPNASWGVLIPPNIEDDHSPLPAWMIMSSKAVKYVDAA  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP G RAVELV GKESA+ Q  RTV G  Y L+F VGD+ + C+GSMV EA+A  ST
Sbjct  244  HFSVPEGARAVELVGGKESALVQEVRTVPGWAYRLSFAVGDSGHDCKGSMVAEAYAARST  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYESKG GGYK A L F A  +RTRV+F S +YH ++D   +LCGPV+D  KLV +R
Sbjct  304  LKVPYESKGAGGYKRAVLDFVAVRDRTRVVFQSAFYHMKADG--TLCGPVIDDAKLVGLR  361

Query  153  N--PHRRL  136
                 RRL
Sbjct  362  KKPAARRL  369



>ref|XP_006389772.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
 gb|ESQ27058.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
Length=372

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPR +  NL+KN  FEEGPYVFPK   GVL PPF ED++SPLP W +ESLKAVKY+D  
Sbjct  189  FPPRFSRYNLIKNGKFEEGPYVFPKAKWGVLIPPFIEDENSPLPGWMIESLKAVKYVDKA  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G RA+ELV GKESA++QI RT   KFY LTF VGDA + CEG M +EAFAG S 
Sbjct  249  HFFVPEGHRAIELVGGKESALSQIVRTSLNKFYALTFNVGDARDACEGPMAVEAFAGRSK  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            + V Y SKG+GG++  +L F+A + RTRV F ST+YHT+SD   SLCGP++D V+LV+VR
Sbjct  309  VMVEYASKGRGGFRRGRLVFKAVSPRTRVTFISTFYHTKSDHSGSLCGPIIDDVRLVAVR  368



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL++N  FE GP+       GVL PP  ED  SPLP W +ESLKAVK+ID++HF
Sbjct  191  PLPTRDNLVRNPSFEVGPHRLVNSTNGVLLPPRQEDVTSPLPGWIIESLKAVKFIDSKHF  250

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G  A+ELVAG+ESAV QI RT+  K Y LTF VGDA N C GSM++EAFA   T+K
Sbjct  251  NVPVGLAAIELVAGRESAVAQIIRTIPNKVYSLTFKVGDAKNGCHGSMMVEAFAAKETVK  310

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVS  160
            VP++S+G+G YK A L+F+AT+ RTR+ FFS+YYHTR+DDF SLCGPV+D V+++S
Sbjct  311  VPFQSQGKGLYKNAILKFKATSRRTRITFFSSYYHTRTDDFGSLCGPVLDDVRVIS  366



>ref|XP_003564086.1| PREDICTED: uncharacterized protein LOC100845370 [Brachypodium 
distachyon]
Length=393

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV+YIDA HF
Sbjct  215  PYPTKENLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRYIDAAHF  274

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G  AVELVAG+ESA+ Q+ RTV  + Y+++F VGDA N C GSM++EAFAG  TLK
Sbjct  275  SVPSGNYAVELVAGRESAIAQVIRTVPNRAYNVSFAVGDAKNGCHGSMLVEAFAGNVTLK  334

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP+ES G+GG+K A LRF A   RTRV F+S+YYHT++ D VSLCGPV+D VK+
Sbjct  335  VPFESAGKGGFKTASLRFVAGGVRTRVTFYSSYYHTKATDGVSLCGPVLDQVKI  388



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/177 (61%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP+    NLLKN DFEEGPY  P    GVL PP   D +SPLP WT+ SLK+V+YID+ 
Sbjct  188  HPPKANRGNLLKNGDFEEGPYFLPNNLDGVLIPPNQIDRNSPLPGWTILSLKSVRYIDSP  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GR+AVEL+AGKES ++Q A TV   +Y LTFLVGDA+N C+GSM +EA+AG  +
Sbjct  248  HFSVPEGRKAVELLAGKESIISQTATTVPKAYYVLTFLVGDANNTCKGSMAVEAYAGRGS  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  163
            LKV YESKG GG+K AKL F A    TR +F+ST+Y TR+DD  SLCGPV+D V+LV
Sbjct  308  LKVDYESKGLGGFKRAKLVFVALEKVTRFVFYSTFYMTRTDDLSSLCGPVIDDVRLV  364



>ref|XP_004969140.1| PREDICTED: uncharacterized protein LOC101755969 [Setaria italica]
Length=372

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 127/180 (71%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP     N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA 
Sbjct  184  YPPTLVRGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIVSSKAVKYVDAA  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G RAVELV G+ESA+ Q  RTV G  Y L+F VGDA + C GSMV EAFA  +T
Sbjct  244  HFKVPQGARAVELVGGRESALVQEVRTVPGWSYRLSFAVGDAGDGCTGSMVAEAFAARAT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GGYK A L F A ANRTRV+F ST+YH ++D   +LCGP+VD   LV +R
Sbjct  304  VKVPYESKGTGGYKRAVLDFTAIANRTRVVFQSTFYHMKADG--TLCGPLVDDASLVGLR  361



>ref|NP_001051644.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|AAP21410.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99455.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13558.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|EAZ28993.1| hypothetical protein OsJ_13041 [Oryza sativa Japonica Group]
 dbj|BAG86944.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/174 (61%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  215  PYPTKDNLIKNEGFEIGPQVFKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHF  274

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G+ AVELVAG+ESA+ Q+ RTVA + Y+L+F+VGDA N C GSM++EAFAG  T K
Sbjct  275  SVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNGCHGSMLVEAFAGNVTQK  334

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+
Sbjct  335  VPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVSLCGPVLDQVKV  388



>ref|XP_002299934.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
 gb|ABK94155.1| unknown [Populus trichocarpa]
 gb|EEE84739.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
Length=365

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 128/176 (73%), Gaps = 0/176 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP PT  NL+KN  FEEGP+      +GVL PP  ED  SPLP W +ESLKAVK+ID +
Sbjct  186  FPPMPTRDNLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSPLPGWMIESLKAVKFIDKK  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF VGDA N C GSM++EAFA   T
Sbjct  246  HFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTVGDARNGCHGSMMVEAFAAKDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
             KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++
Sbjct  306  FKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRV  361



>ref|XP_011047367.1| PREDICTED: uncharacterized protein LOC105141733 [Populus euphratica]
Length=365

 Score =   219 bits (558),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 129/179 (72%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP PT  NL+KN  FEEGP+      +GVL PP  ED  SPLP W +ESLKAVK+ID +
Sbjct  186  FPPMPTRDNLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSPLPGWMIESLKAVKFIDKK  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF +GDA N C GSM++EAFA   T
Sbjct  246  HFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNGCHGSMMVEAFAAKDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  306  FKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_011013325.1| PREDICTED: uncharacterized protein LOC105117377 [Populus euphratica]
Length=365

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 129/179 (72%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP PT  NL+KN  FEEGP+      +GVL PP  ED  SPLP W +ESLKAVK+ID +
Sbjct  186  FPPMPTRDNLVKNHGFEEGPHRLVNTSSGVLLPPRQEDLTSPLPGWMIESLKAVKFIDKK  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RT+  K Y LTF +GDA N C GSM++EAFA   T
Sbjct  246  HFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARNGCHGSMMVEAFAAKDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF SLCGP++D V++  +
Sbjct  306  FKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFGSLCGPILDEVRVFPI  364



>ref|XP_002276894.1| PREDICTED: uncharacterized protein LOC100258445 [Vitis vinifera]
Length=368

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 131/182 (72%), Gaps = 0/182 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP PT  NL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID +
Sbjct  187  FPPMPTRDNLVKNSGFEEGPHLLINSSNGVLLPPKQEDLTSPLPGWIIESLKAVKFIDKK  246

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVEL+AG+ESA+ Q+ RTV  K Y+LTF +GD  N C G M++EAFA   +
Sbjct  247  HFNVPFGLAAVELLAGRESAIAQVLRTVPNKLYNLTFSIGDGKNGCHGDMMIEAFAAKDS  306

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
             K P++S+G+G +K    +F+A A RTR+ FFS++YHTR DDF SLCGPV+D V++ S+R
Sbjct  307  FKAPFKSRGKGEFKTVSFKFKAIAARTRLTFFSSFYHTRIDDFGSLCGPVLDQVRVFSIR  366

Query  153  NP  148
             P
Sbjct  367  KP  368


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/178 (30%), Positives = 72/178 (40%), Gaps = 32/178 (18%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYI------DAEHF  508
             LL N +FEE P       T +            LP W +    +V+YI          F
Sbjct  28   GLLPNGNFEESPKPTDLKKTVI-------KGKYSLPKWEING--SVEYIAGGPQPGGMFF  78

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +V HG  AV L  G E++++Q      G  Y LTF    AS  C    VL     P T  
Sbjct  79   AVAHGVHAVRL--GNEASISQTIPVKPGSLYALTF---GASRTCAQDEVLRVSVPPQTGD  133

Query  327  VP----YESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            +P    Y+S G   Y      FRAT+N  +V F +T            CGP++D V +
Sbjct  134  LPLQTLYDSFGGDVYA---WGFRATSNEAKVTFHNTGVQED-----PACGPLLDAVAI  183



>gb|EMT06486.1| hypothetical protein F775_26416 [Aegilops tauschii]
Length=370

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP  +  N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+DA 
Sbjct  183  YPPTLSKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDAA  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G RAVELV GKESA+ Q  RTV G  Y L+F VGD+++ C+GSMV EA+A  ST
Sbjct  243  HFKVPEGARAVELVGGKESALVQEVRTVPGWAYRLSFAVGDSADGCKGSMVAEAYAARST  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            LKVPYES G GGYK A L F A  +RTRV+F S +YH ++D   +LCGPV+D  KLV +R
Sbjct  303  LKVPYESNGAGGYKRAVLDFVAVRDRTRVVFQSAFYHMKADG--TLCGPVIDDAKLVGLR  360

Query  153  N--PHRRL  136
                 RRL
Sbjct  361  KKPSARRL  368



>ref|XP_007052493.1| F17A17.37 protein [Theobroma cacao]
 gb|EOX96650.1| F17A17.37 protein [Theobroma cacao]
Length=385

 Score =   219 bits (558),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 132/177 (75%), Gaps = 0/177 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+ID++HF
Sbjct  208  PMPTRDNLVKNPGFEEGPHRLVNSTNGVLLPPRQEDSTSPLPGWIIESLKAVKFIDSKHF  267

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G+ AVELVAG+ESA+ QI RTV  + YDLTF++GDA N C G M++EAFA  +T+K
Sbjct  268  NVPAGKAAVELVAGRESAIAQILRTVPNQLYDLTFIIGDARNGCHGEMMVEAFADKNTVK  327

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            VP+ S+G+G +K A L+F+A   RTR+ FFS+YYHTR +DF SLCGPV+D V++  V
Sbjct  328  VPFTSRGKGEFKTASLKFKAVTARTRITFFSSYYHTRINDFGSLCGPVLDEVRVSPV  384



>ref|XP_009418805.1| PREDICTED: uncharacterized protein LOC103998920 [Musa acuminata 
subsp. malaccensis]
Length=363

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP PT+ NL+KN  FEEGP+VF    TGVL PP  ED  SPLP W +ESLKAV++IDA 
Sbjct  183  FPPMPTHDNLVKNGGFEEGPHVFKNSTTGVLLPPKQEDSTSPLPGWIIESLKAVRFIDAA  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            H+++P G+ A+ELVAG+ESA+ Q+ RT +   Y+L+F+VGDA N C GSM++EAFAG  T
Sbjct  243  HYAIPSGQFAIELVAGRESAIAQVIRTASNTTYNLSFVVGDAKNGCHGSMLVEAFAGNGT  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
             KV ++S+G+GG+K A L F AT +RTR+ F+S+YYHT   +  SLCGP++D V++
Sbjct  303  AKVSFQSQGKGGFKAASLNFTATGSRTRITFYSSYYHTSVSNPGSLCGPLLDQVRV  358



>gb|EYU43005.1| hypothetical protein MIMGU_mgv1a011073mg [Erythranthe guttata]
Length=293

 Score =   216 bits (549),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 133/176 (76%), Gaps = 0/176 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP+P+ VNL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK+ID++
Sbjct  112  FPPKPSRVNLVKNEGFEEGPHLLMNSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFIDSK  171

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+ AVELVAG+ESA+ QI RTV  K Y+L+F+VGDA N C GSM++EAFA  +T
Sbjct  172  HFNVPFGKSAVELVAGRESAIAQIIRTVPNKVYNLSFVVGDAKNGCHGSMLVEAFAAKTT  231

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
             K  ++S+G+G +     +F A ++RTR+ FFS++YHTR DDF SLCGPV+D V++
Sbjct  232  SKAQFKSEGKGKFSTYNFQFTAVSDRTRLTFFSSFYHTRIDDFGSLCGPVLDEVRV  287



>ref|XP_007218161.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19360.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=291

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +P  PT  NL++N  FEE P+       GVL PP   D  SPLP W +ESLKAVK+ID++
Sbjct  112  FPALPTRDNLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSQ  171

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+ AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA N C GSM++EAFAG  T
Sbjct  172  HFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHGSMMVEAFAGKDT  231

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            LKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ +LCGP++D V++  V
Sbjct  232  LKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  290



>ref|XP_008461812.1| PREDICTED: uncharacterized protein LOC103500323 [Cucumis melo]
Length=368

 Score =   217 bits (553),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/174 (60%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT VNL++N  FE GP+       GVL PP  ED  SPLP W +ESLKAVK+ID++HF
Sbjct  191  PLPTTVNLVRNPSFEVGPHRLGNSTNGVLLPPRQEDVTSPLPGWIIESLKAVKFIDSKHF  250

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G  A+ELVAG+ESAV QI RT+  K Y L F VGDA N C GSM++EAFA   T+K
Sbjct  251  NVPDGEAAIELVAGRESAVAQIIRTIPNKVYSLKFKVGDAKNGCHGSMMVEAFAAKETVK  310

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP++S+G+G YK A L+F AT+ RTR+ FFS+YYHTR+DDF SLCGPV+D V +
Sbjct  311  VPFQSEGKGLYKDAILKFTATSPRTRITFFSSYYHTRTDDFGSLCGPVLDDVSV  364



>gb|KJB24990.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=385

 Score =   218 bits (554),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+HF
Sbjct  208  PRATRYNLVKNNGFEEGPHRLVNSTNGVLLPPRQEDFTSPLPGWIIESLKAVKFIDAKHF  267

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T+K
Sbjct  268  NVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNGCNGEMMVEAFAAKHTVK  327

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF SLCGPV+D V++
Sbjct  328  VPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGSLCGPVLDEVRV  381



>ref|XP_003569339.1| PREDICTED: uncharacterized protein LOC100821501 [Brachypodium 
distachyon]
Length=370

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 131/188 (70%), Gaps = 4/188 (2%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP  +  N+LKN  FEEGPY  P    GVL PP  EDDHSPLPAW + S KAVKY+D+ 
Sbjct  183  YPPTLSKGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPAWMIMSSKAVKYVDSA  242

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF VP G RAVELV GKESA+ Q  RTV G  Y LTF VGDA++ C GSMV EA+A  + 
Sbjct  243  HFRVPEGTRAVELVGGKESALVQEVRTVPGWTYRLTFAVGDAADGCTGSMVAEAYAARAI  302

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPY+SKG GG+K A L F A  NRTR++F ST+YH ++D   +LCGPV+D  KLV ++
Sbjct  303  VKVPYDSKGAGGFKRAVLDFAAVGNRTRIVFQSTFYHMKADG--TLCGPVIDDAKLVGLK  360

Query  153  N--PHRRL  136
                 RRL
Sbjct  361  KKPAARRL  368



>gb|EMT25156.1| hypothetical protein F775_26385 [Aegilops tauschii]
Length=397

 Score =   218 bits (554),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 131/178 (74%), Gaps = 0/178 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV+YIDA HF
Sbjct  219  PYPTKDNLIKNDGFEIGPQVFKNSSVGVLLPPKQKDVTSPLPGWIIESLKAVRYIDAAHF  278

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA N C GSM++EAFA   T K
Sbjct  279  SVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNGCHGSMLVEAFAANVTQK  338

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            VP+ES G+GG+K A LRF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+V ++
Sbjct  339  VPFESTGKGGFKAASLRFVAAGVRTRVTFYSSYYHTKVTDGVSLCGPVLDQVKIVPMK  396



>ref|XP_008245331.1| PREDICTED: uncharacterized protein LOC103343457 [Prunus mume]
Length=373

 Score =   217 bits (553),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/173 (58%), Positives = 128/173 (74%), Gaps = 0/173 (0%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  490
             L+KN  FE GP+VF    TG+L PP  +D  SPLP W +ESLK VKYID +HFSVP G 
Sbjct  200  TLVKNGGFESGPHVFKNFSTGILLPPKAKDQISPLPGWIIESLKPVKYIDKKHFSVPGGL  259

Query  489  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  310
             A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA N C GSM++EAFAG  TLKVPY S+
Sbjct  260  AAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNACHGSMMVEAFAGKETLKVPYTSQ  319

Query  309  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF  +CGPV+D V ++ V +
Sbjct  320  GKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGHMCGPVLDNVIVLPVSS  372



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 132/176 (75%), Gaps = 0/176 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +P  PT  NL++N  FEE P+       GVL PP   D  SPLP W +ESLKAVK+IDA+
Sbjct  189  FPVLPTRDNLVRNPGFEEAPHRLMNSSHGVLLPPKQLDATSPLPGWIIESLKAVKFIDAK  248

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+ AVELVAG+ESA+ Q+ RTV  K Y L+F +GDA N C GSM++EAFAG  T
Sbjct  249  HFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTIGDARNGCHGSMMVEAFAGKDT  308

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            LKVP+ S+G+GG+K A  +F+AT+ RTR+ FFS++YHTR+DD+ +LCGP++D VK+
Sbjct  309  LKVPFNSQGKGGFKNASFKFKATSFRTRITFFSSFYHTRTDDYGALCGPILDEVKV  364



>ref|XP_002455939.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
 gb|EES01059.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
Length=375

 Score =   217 bits (553),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 107/180 (59%), Positives = 126/180 (70%), Gaps = 2/180 (1%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP     N+LKN  FEEGPY  P    GVL PP  EDDHSPLP W + S KAVKY+DA 
Sbjct  184  YPPTLARGNMLKNGGFEEGPYFLPNASWGVLVPPNIEDDHSPLPGWMIASSKAVKYVDAA  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G RAVELV G+ESA+ Q  RTV G  Y L F VGD+ + C GSMV EA+A  +T
Sbjct  244  HFAVPQGARAVELVGGRESALVQEVRTVPGWSYRLAFAVGDSGDGCTGSMVAEAYAARAT  303

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +KVPYESKG GGYK A L F A ANRTRV+F ST+YH ++D   +LCGP+VD   +V +R
Sbjct  304  VKVPYESKGTGGYKRAVLDFTAVANRTRVVFQSTFYHMKADG--TLCGPLVDDASVVGLR  361



>dbj|BAJ89665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   218 bits (554),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 131/178 (74%), Gaps = 0/178 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV+YIDA HF
Sbjct  215  PYPTKDNLIKNDGFEIGPQVFKNSSVGVLLPPKQKDVTSPLPGWIIESLKAVRYIDAAHF  274

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+++VGDA N C GSM++EAFA   T K
Sbjct  275  SVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNGCHGSMLVEAFAANVTQK  334

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            VP+ES G+GG+K + LRF A   RTRV F+S+YYHT+  D VSLCGPV+D VK+V ++
Sbjct  335  VPFESTGKGGFKASSLRFVAAGARTRVTFYSSYYHTKVTDGVSLCGPVLDQVKIVPLK  392



>gb|KHG12815.1| DNA-directed RNA polymerase subunit beta'' [Gossypium arboreum]
Length=385

 Score =   217 bits (553),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+HF
Sbjct  208  PRATRYNLVKNSGFEEGPHRLVNSTNGVLLPPRQEDFTSPLPGWIIESLKAVKFIDAKHF  267

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T+K
Sbjct  268  NVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFVIGDARNGCNGEMMVEAFAAKHTVK  327

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP+ S+G+G +K A L F+A   RTR+ F+S+YYHTRSDDF SLCGPV+D V++
Sbjct  328  VPFTSRGKGEFKAASLMFKADTARTRITFYSSYYHTRSDDFGSLCGPVLDEVRV  381



>gb|KJB24991.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=414

 Score =   218 bits (554),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 129/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            PR T  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+HF
Sbjct  237  PRATRYNLVKNNGFEEGPHRLVNSTNGVLLPPRQEDFTSPLPGWIIESLKAVKFIDAKHF  296

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            +VP G  AVELVAG+ESA+ QI RT+  K Y++TF++GDA N C G M++EAFA   T+K
Sbjct  297  NVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARNGCNGEMMVEAFAAKHTVK  356

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            VP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF SLCGPV+D V++
Sbjct  357  VPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFGSLCGPVLDEVRV  410



>ref|XP_004981346.1| PREDICTED: uncharacterized protein LOC101768647 [Setaria italica]
Length=389

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 129/175 (74%), Gaps = 0/175 (0%)
 Frame = -2

Query  687  PRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHF  508
            P PT  NL+KN  FE GP VF     GVL PP  +D  SPLP W +ESLKAV++IDA HF
Sbjct  209  PYPTKDNLIKNAGFEIGPQVFKNSSVGVLLPPKQKDTTSPLPGWIIESLKAVRFIDAAHF  268

Query  507  SVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLK  328
            SVP G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T K
Sbjct  269  SVPEGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNGCHGSMLVEAFAGNVTQK  328

Query  327  VPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLV  163
            VP+ES G+G +K A  RF A+  RTR+ F+S+YYHT++ D VSLCGPV+D VK+V
Sbjct  329  VPFESAGKGAFKAAGFRFVASGVRTRLTFYSSYYHTKASDGVSLCGPVLDQVKVV  383



>gb|AGV54808.1| hypothetical protein [Phaseolus vulgaris]
Length=367

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP PT VNL+KN  FEEGP+       GVL PP  +D  SPLP W +ESLKAVK+ID++
Sbjct  188  YPPMPTRVNLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSPLPGWIIESLKAVKFIDSK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ Q+ RT   K Y++TF VGDA N C GSM++EAFA   T
Sbjct  248  HFNVPFGLGAVELVAGRESAIAQVIRTDTNKVYNITFSVGDAKNGCNGSMMVEAFAAKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP++S+G+G ++    +F+A A RTR+ F+S++YHTRSDD+ SLCGPV+D V +  V
Sbjct  308  FKVPFKSEGKGTFRTVSFKFKAIAKRTRLTFYSSFYHTRSDDYGSLCGPVIDQVIVFPV  366



>ref|XP_007148907.1| hypothetical protein PHAVU_005G024100g [Phaseolus vulgaris]
 gb|ESW20901.1| hypothetical protein PHAVU_005G024100g [Phaseolus vulgaris]
Length=367

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP PT VNL+KN  FEEGP+       GVL PP  +D  SPLP W +ESLKAVK+ID++
Sbjct  188  YPPMPTRVNLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSPLPGWIIESLKAVKFIDSK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ Q+ RT   K Y++TF VGDA N C GSM++EAFA   T
Sbjct  248  HFNVPFGLGAVELVAGRESAIAQVIRTDTNKVYNITFSVGDAKNGCNGSMMVEAFAAKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP++S+G+G ++    +F+A A RTR+ F+S++YHTRSDD+ SLCGPV+D V +  V
Sbjct  308  FKVPFKSEGKGTFRTVSFKFKAIAKRTRLTFYSSFYHTRSDDYGSLCGPVIDQVIVFPV  366



>ref|XP_009758716.1| PREDICTED: uncharacterized protein LOC104211372 [Nicotiana sylvestris]
Length=366

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPT VNL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK++D+ 
Sbjct  187  FPPRPTRVNLVKNPGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSA  246

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+ AVEL+AG+ESA+ QI RTV  K Y   F VGDA N C G M++EAFA   T
Sbjct  247  HFNVPFGQAAVELLAGRESAIAQIIRTVPKKVYAFAFTVGDAKNGCHGDMMVEAFAAKET  306

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP++S+G+G +K    +F A A+RTR+ F+S+YYHT+ +D+ SLCGPVVD VK+  V
Sbjct  307  FKVPFKSQGKGSFKTVSFKFTAIADRTRITFYSSYYHTKINDYGSLCGPVVDEVKVTPV  365



>ref|NP_001241275.1| uncharacterized protein LOC100796094 precursor [Glycine max]
 ref|XP_006597038.1| PREDICTED: uncharacterized protein LOC100796094 isoform X1 [Glycine 
max]
 gb|ACU18215.1| unknown [Glycine max]
Length=367

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP PT VNL+KN  FEEGP+       GVL PP  +D  SPLP W +ESLKAVK+ID++
Sbjct  188  YPPMPTRVNLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSPLPGWIIESLKAVKFIDSK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RTV  K Y++TF VGDA N C GSM++EAFA   T
Sbjct  248  HFNVPFGLGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNGCHGSMMVEAFAAKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  172
             KVP++S+G+G  K    +F+A A RTR+ F+S++YHTR DD+ SLCGPV+D V
Sbjct  308  FKVPFKSEGKGTSKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGSLCGPVIDQV  361



>ref|NP_001239749.1| uncharacterized protein LOC100804119 precursor [Glycine max]
 gb|ACU23170.1| unknown [Glycine max]
 gb|KHM99195.1| hypothetical protein glysoja_035460 [Glycine soja]
Length=367

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 130/179 (73%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP PT VNL+KN  FEEGP+       GVL PP  +D  SPLP W +ESLKAVK+ID++
Sbjct  188  YPPMPTRVNLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSPLPGWIIESLKAVKFIDSK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RTV  K Y++TF VGDA N C GSM++EAFA   T
Sbjct  248  HFNVPFGLGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNGCHGSMMVEAFAAKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             K P++S+G+G +K    +F+A A RTR+ F+S++YHTR DD+ SLCGPVVD V +  V
Sbjct  308  FKAPFKSEGKGTFKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGSLCGPVVDQVIVFPV  366



>gb|KHN45084.1| hypothetical protein glysoja_040000 [Glycine soja]
Length=367

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/174 (59%), Positives = 128/174 (74%), Gaps = 0/174 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            YPP PT VNL+KN  FEEGP+       GVL PP  +D  SPLP W +ESLKAVK+ID++
Sbjct  188  YPPMPTRVNLVKNPGFEEGPFPIFNSTNGVLLPPQQQDGFSPLPGWIIESLKAVKFIDSK  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RTV  K Y++TF VGDA N C GSM++EAFA   T
Sbjct  248  HFNVPFGLGAVELVAGRESAIAQIIRTVTNKVYNITFSVGDAKNGCHGSMMVEAFAAKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  172
             KVP++S+G+G  K    +F+A A RTR+ F+S++YHTR DD+ SLCGPV+D V
Sbjct  308  FKVPFKSEGKGTSKTVSFKFKAIAPRTRLTFYSSFYHTRIDDYGSLCGPVIDQV  361



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 134/179 (75%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +P  PT  NL++N  FEE P+       GVL PP   D  SPLP W +ESLKAVK+ID++
Sbjct  188  FPALPTRDNLVRNPGFEEAPHRLFNSSHGVLLPPKQLDVTSPLPGWIIESLKAVKFIDSQ  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+ AVELVAG+ESA+ Q+ RTV  K YDL+F+VGDA N C GSM++EAFAG  T
Sbjct  248  HFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARNGCHGSMMVEAFAGKDT  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
            LKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ +LCGP++D V++  V
Sbjct  308  LKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYGALCGPILDQVRVYPV  366



>ref|XP_006345424.1| PREDICTED: uncharacterized protein LOC102582371 [Solanum tuberosum]
Length=367

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPT VNL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK++D+ 
Sbjct  188  FPPRPTRVNLVKNAGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSA  247

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+ AVEL+AG+ESA+ QI RTV  K Y  TF VGDA N C G M++EAFA   T
Sbjct  248  HFNVPFGQAAVELLAGRESALAQIIRTVPKKVYAFTFSVGDAKNGCHGDMMVEAFAAKET  307

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP++S+G+G +K    +F A A+RTR+ F+S++YHT+ +D+ +LCGPVVD VK+  V
Sbjct  308  FKVPFKSQGKGSFKTVSFKFTAIADRTRITFYSSFYHTKINDYGALCGPVVDEVKVTPV  366



>ref|XP_008776092.1| PREDICTED: uncharacterized protein LOC103696299 [Phoenix dactylifera]
Length=369

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP PT  NL+KN  FEEGP+VF    TGVL PP  +D  SPLP W +ESLKAV+++D+ H
Sbjct  187  PPMPTRDNLVKNGGFEEGPHVFKNSTTGVLLPPKQQDVTSPLPGWIIESLKAVRFVDSAH  246

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            FSVP G+ AVELVAG+ESA+ Q+ RT+  K+Y+L+F+VGDA N C G+M +EAFAG STL
Sbjct  247  FSVPVGQYAVELVAGRESAIAQVIRTIQYKYYNLSFVVGDAKNGCHGAMQVEAFAGNSTL  306

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
             V   S G+GG+K A L+F A ++RTR+ F+S +YHTR D   SLCGPV+D V++  +  
Sbjct  307  SVALRSHGKGGFKAASLKFMAISSRTRLTFYSYHYHTRVDQPGSLCGPVLDQVRVYPLPR  366

Query  150  PHR  142
             HR
Sbjct  367  LHR  369



>gb|KHN11697.1| hypothetical protein glysoja_006150 [Glycine soja]
Length=367

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 0/173 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP+PT  NL+KN  FEEGP+       GVL PP  ED  SPLP W +ESLKAVK+IDA+H
Sbjct  189  PPKPTRANLVKNPGFEEGPFPIFNSTNGVLLPPEQEDHVSPLPGWMIESLKAVKFIDAKH  248

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F+VP G+ AVEL+AG+ES + QI RTV  K Y++ F +GDA N C GSM++EAFA   TL
Sbjct  249  FNVPFGQGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDARNGCHGSMMIEAFAAKDTL  308

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFV  172
            KVP++S+G+G +K    +FRA  NRTR+ F+S++YHTR  D+ SLCGPV+D V
Sbjct  309  KVPFKSEGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDYGSLCGPVIDQV  361



>ref|XP_011048055.1| PREDICTED: uncharacterized protein LOC105142230 [Populus euphratica]
Length=365

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            P R T  NL+KN  FE GP++F    TGVL PP  +D  SPLP W +ESLK VKYID++H
Sbjct  187  PLRRTIGNLVKNGGFEVGPHMFKNFSTGVLLPPKQQDQISPLPGWIIESLKPVKYIDSKH  246

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            F VP G  A+ELVAG+ESAV QI RT+  KFY+LTF VGDA N C GSM++EAFA   T+
Sbjct  247  FFVPEGFAAIELVAGRESAVAQIIRTIPDKFYNLTFTVGDAKNACHGSMMVEAFAAKETV  306

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
            KVPY S+G+GGYK A LRF+A + RTR+ F+S YYHT+  D+  +CGPV+D V +
Sbjct  307  KVPYVSQGKGGYKTAILRFQAISARTRITFYSAYYHTKLHDYGHMCGPVLDDVSV  361



>ref|XP_004229647.1| PREDICTED: uncharacterized protein LOC101251618 [Solanum lycopersicum]
Length=402

 Score =   216 bits (549),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 131/179 (73%), Gaps = 0/179 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPT VNL+KN  FEEGP++      GVL PP  ED  SPLP W +ESLKAVK++D+ 
Sbjct  223  FPPRPTRVNLVKNAGFEEGPHLLINSSHGVLLPPKQEDLTSPLPGWIIESLKAVKFLDSA  282

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G+ AVEL+AG+ESA+ QI RTV  K Y  TF VGDA N C G M++EAFA   T
Sbjct  283  HFNVPFGQAAVELLAGRESALAQIIRTVPKKVYAFTFSVGDAKNGCHGDMMVEAFAAKET  342

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSV  157
             KVP++S+G+G +K    +F A A+RTR+ F+S++YHT+ +D+ +LCGPVVD VK+  V
Sbjct  343  FKVPFKSQGKGSFKTVSFKFTAIADRTRITFYSSFYHTKINDYGALCGPVVDEVKVTPV  401



>ref|XP_010937268.1| PREDICTED: uncharacterized protein LOC105056672 [Elaeis guineensis]
Length=368

 Score =   214 bits (546),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = -2

Query  690  PPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEH  511
            PP PT  NL+KN  FEEGP+VF     GVL PP  ED  SPLP W +ESLKAV+++D+ H
Sbjct  186  PPMPTRDNLVKNGGFEEGPHVFKNSTAGVLLPPKQEDVTSPLPGWIIESLKAVRFVDSAH  245

Query  510  FSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTL  331
            FSVP G+ AVELVAG+ESA+ Q+ RT+  K+Y+LTF+VGDA N C G+M +EAFAG ST+
Sbjct  246  FSVPVGQFAVELVAGRESAIAQVIRTIQYKYYNLTFVVGDAKNGCHGAMQVEAFAGNSTV  305

Query  330  KVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
             + + S G+GG+K A L+F A ++RTR+ F+S +YHTR D+  SLCGPV+D V++  +  
Sbjct  306  SIAFLSHGKGGFKAASLKFMAISSRTRITFYSFHYHTRRDEPGSLCGPVLDQVRVYPLAG  365

Query  150  PHR  142
             H 
Sbjct  366  VHH  368



>ref|XP_007201993.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
 gb|EMJ03192.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
Length=384

 Score =   215 bits (547),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/173 (57%), Positives = 127/173 (73%), Gaps = 0/173 (0%)
 Frame = -2

Query  669  NLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSVPHGR  490
             L+KN  FE GP+VF    TG+L PP  +D  SPLP W +ESLK VKYID +HF VP G 
Sbjct  211  TLVKNGGFESGPHVFKNFSTGILLPPKAKDQISPLPGWIIESLKPVKYIDKKHFQVPGGL  270

Query  489  RAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVPYESK  310
             A+ELVAG+ESA+ QI RT+  KFY+LTF +GDA N C GSM++EAFAG  TLKVPY S+
Sbjct  271  AAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKNACHGSMMVEAFAGKETLKVPYMSQ  330

Query  309  GQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVRN  151
            G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF  +CGPV+D V ++ V +
Sbjct  331  GKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFGHMCGPVLDNVIVLPVSS  383



>ref|XP_010445004.1| PREDICTED: uncharacterized protein LOC104727612, partial [Camelina 
sativa]
Length=325

 Score =   213 bits (541),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PPRPTN N+LKN  FEEGP+V P   +GVL PP + DDHSPLP W VESLKAVKY+D++
Sbjct  184  FPPRPTNKNILKNGGFEEGPWVLPNTTSGVLIPPNSIDDHSPLPGWMVESLKAVKYLDSD  243

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HFSVP GRRAVELVAGKESAV Q+ RT+ GK Y L+F VGDASN C GSM++EAFAG  T
Sbjct  244  HFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASNACAGSMIVEAFAGKDT  303

Query  333  LKVPYESKGQGGYKPAKLRF  274
            +KVPYESKG+GG+K A LRF
Sbjct  304  IKVPYESKGKGGFKRASLRF  323



>ref|XP_002313314.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
 gb|EEE87269.1| hypothetical protein POPTR_0009s06370g [Populus trichocarpa]
Length=365

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 125/176 (71%), Gaps = 0/176 (0%)
 Frame = -2

Query  693  YPPRPTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAE  514
            +PP PT  NL++N  FEEGP+       G+L PP  ED  SPLP W +ESLKAVK+ID  
Sbjct  186  FPPMPTRDNLVRNHGFEEGPHRLVNTSNGILLPPRQEDLTSPLPGWIIESLKAVKFIDKR  245

Query  513  HFSVPHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPST  334
            HF+VP G  AVELVAG+ESA+ QI RT   K Y L F +GDA N C GSM++EAFA   T
Sbjct  246  HFNVPFGLAAVELVAGRESAIAQILRTTPNKVYSLAFTIGDARNGCHGSMMVEAFAAGDT  305

Query  333  LKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKL  166
             KVP+ESKG+G  K A  +F+A + RTR+ F+S+YYHTR DD+ SLCGP++D V++
Sbjct  306  FKVPFESKGKGESKSASFKFKAISARTRITFYSSYYHTRIDDYGSLCGPILDEVRV  361



>ref|XP_002466246.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
 gb|EER93244.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
Length=386

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 128/176 (73%), Gaps = 0/176 (0%)
 Frame = -2

Query  681  PTNVNLLKNWDFEEGPYVFPKVDTGVLCPPFTEDDHSPLPAWTVESLKAVKYIDAEHFSV  502
            PT  NL+KN  FE GP V      GVL PP  +D  SPLP W +ESLKAV++IDA HFSV
Sbjct  210  PTKDNLIKNDGFEIGPQVLKNSTVGVLLPPKQKDATSPLPGWIIESLKAVRFIDAAHFSV  269

Query  501  PHGRRAVELVAGKESAVTQIARTVAGKFYDLTFLVGDASNKCEGSMVLEAFAGPSTLKVP  322
            P G+ AVELVAG+ESA+ Q+ RTV  + Y+L+F VGDA N C GSM++EAFAG  T KVP
Sbjct  270  PAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNGCHGSMLVEAFAGNVTQKVP  329

Query  321  YESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLCGPVVDFVKLVSVR  154
            +ES G+GG+K A  RF A   RTR+ F+S+YYHT+  D VSLCGPV+D VK+V V+
Sbjct  330  FESAGKGGFKAAAFRFVAAGARTRLTFYSSYYHTKVTDGVSLCGPVLDQVKVVPVK  385



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1171852487340