BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037J06

Length=754
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010099424.1|  Subtilisin-like protease                           280   1e-88   
ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5         285   1e-86   Sesamum indicum [beniseed]
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3         282   4e-86   
ref|XP_007039329.1|  Subtilase family protein                           276   1e-85   
ref|XP_010529680.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    278   1e-84   Tarenaya hassleriana [spider flower]
ref|XP_010529679.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    278   1e-84   Tarenaya hassleriana [spider flower]
ref|XP_010529681.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    276   5e-84   Tarenaya hassleriana [spider flower]
ref|XP_009348696.1|  PREDICTED: subtilisin-like protease SBT5.4         278   5e-84   
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    276   1e-83   Solanum lycopersicum
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    276   1e-83   Solanum lycopersicum
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    276   2e-83   Solanum lycopersicum
ref|XP_010437012.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    274   2e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3         275   6e-83   Camelina sativa [gold-of-pleasure]
emb|CBI23066.3|  unnamed protein product                                273   1e-82   Vitis vinifera
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    274   1e-82   Camelina sativa [gold-of-pleasure]
ref|XP_002317663.1|  subtilase family protein                           274   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3         273   2e-82   Populus euphratica
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    272   3e-82   Tarenaya hassleriana [spider flower]
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5         273   3e-82   Vitis vinifera
ref|XP_008392653.1|  PREDICTED: subtilisin-like protease                266   6e-82   
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg             272   6e-82   Prunus persica
ref|XP_002298974.2|  hypothetical protein POPTR_0001s45470g             271   7e-82   
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg                271   2e-81   Erythranthe guttata [common monkey flower]
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3         271   2e-81   Brassica rapa
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg             271   2e-81   Capsella rubella
ref|XP_002872522.1|  subtilase family protein                           269   5e-81   
gb|KJB74658.1|  hypothetical protein B456_012G000900                    270   6e-81   Gossypium raimondii
ref|XP_002891022.1|  subtilase family protein                           270   6e-81   Arabidopsis lyrata subsp. lyrata
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5         270   7e-81   Vitis vinifera
ref|XP_002518937.1|  Cucumisin precursor, putative                      269   8e-81   Ricinus communis
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg             269   9e-81   Eutrema salsugineum [saltwater cress]
ref|XP_011081356.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    269   9e-81   Sesamum indicum [beniseed]
ref|XP_009348701.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    256   1e-80   Pyrus x bretschneideri [bai li]
gb|KFK28745.1|  hypothetical protein AALP_AA7G041500                    268   1e-80   Arabis alpina [alpine rockcress]
ref|XP_010529677.1|  PREDICTED: subtilisin-like protease SBT3.3         268   2e-80   Tarenaya hassleriana [spider flower]
ref|XP_011081355.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    269   2e-80   Sesamum indicum [beniseed]
emb|CBI23086.3|  unnamed protein product                                269   3e-80   Vitis vinifera
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3         266   3e-80   Pyrus x bretschneideri [bai li]
ref|NP_567359.1|  Subtilase family protein                              267   4e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436465.1|  PREDICTED: subtilisin-like protease SBT3.5         264   5e-80   
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5         267   5e-80   Vitis vinifera
ref|XP_002867837.1|  subtilase family protein                           265   7e-80   
emb|CDX79081.1|  BnaA01g11480D                                          266   1e-79   
emb|CDX82843.1|  BnaC01g12930D                                          266   2e-79   
ref|XP_011038011.1|  PREDICTED: subtilisin-like protease SBT3.5         266   2e-79   Populus euphratica
emb|CDX94251.1|  BnaC02g29110D                                          265   2e-79   
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg             265   2e-79   
ref|XP_009128706.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    263   2e-79   Brassica rapa
ref|XP_010449026.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    258   2e-79   
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3         265   2e-79   Brassica rapa
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3         265   3e-79   Brassica rapa
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg             265   5e-79   
ref|XP_007039203.1|  Subtilase family protein, putative                 264   6e-79   
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                    263   6e-79   Arabis alpina [alpine rockcress]
ref|NP_567360.1|  Subtilase family protein                              264   7e-79   Arabidopsis thaliana [mouse-ear cress]
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                    264   7e-79   Arabis alpina [alpine rockcress]
ref|XP_010434151.1|  PREDICTED: subtilisin-like protease SBT3.3         254   9e-79   
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    263   9e-79   
emb|CDX94043.1|  BnaC07g36770D                                          263   1e-78   
ref|XP_010445236.1|  PREDICTED: subtilisin-like protease SBT3.5         265   1e-78   
ref|XP_002298973.2|  subtilase family protein                           263   1e-78   
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    263   1e-78   Brassica rapa
ref|NP_564414.2|  Subtilase family protein SBT3.3                       263   2e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010434150.1|  PREDICTED: subtilisin-like protease SBT3.3         249   2e-78   Camelina sativa [gold-of-pleasure]
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg             263   2e-78   Prunus persica
emb|CDX93808.1|  BnaA09g24080D                                          262   3e-78   
ref|XP_002867838.1|  subtilase family protein                           260   3e-78   
ref|XP_006287107.1|  hypothetical protein CARUB_v10000269mg             262   3e-78   
gb|KJB52411.1|  hypothetical protein B456_008G260500                    263   5e-78   Gossypium raimondii
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3         262   5e-78   Brassica rapa
ref|XP_002891021.1|  predicted protein                                  262   5e-78   Arabidopsis lyrata subsp. lyrata
ref|XP_006413792.1|  hypothetical protein EUTSA_v10024501mg             261   5e-78   Eutrema salsugineum [saltwater cress]
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    268   6e-78   
ref|NP_567358.1|  Subtilase family protein                              261   8e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         261   8e-78   Brassica rapa
ref|XP_011470880.1|  PREDICTED: subtilisin-like protease SBT3.3         261   9e-78   Fragaria vesca subsp. vesca
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease                261   1e-77   Prunus mume [ume]
emb|CBI23085.3|  unnamed protein product                                267   1e-77   Vitis vinifera
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg             261   1e-77   Eutrema salsugineum [saltwater cress]
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3         260   1e-77   Camelina sativa [gold-of-pleasure]
ref|XP_010449086.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    260   1e-77   Camelina sativa [gold-of-pleasure]
gb|AAD03438.1|  similar to the subtilase family of serine proteas...    260   2e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3         259   3e-77   Brassica rapa
ref|XP_011038010.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    258   4e-77   Populus euphratica
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...    259   4e-77   Sisymbrium irio
gb|AAD03430.1|  similar to the subtilase family of serine proteas...    257   5e-77   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872521.1|  predicted protein                                  259   6e-77   Arabidopsis lyrata subsp. lyrata
ref|XP_010436981.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    257   6e-77   
ref|XP_011470878.1|  PREDICTED: uncharacterized protein LOC101314621    265   7e-77   Fragaria vesca subsp. vesca
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3         258   7e-77   
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    258   8e-77   
ref|XP_010542096.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    259   9e-77   
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5         258   1e-76   Camelina sativa [gold-of-pleasure]
gb|KFK41050.1|  hypothetical protein AALP_AA2G078900                    258   1e-76   Arabis alpina [alpine rockcress]
ref|NP_564869.1|  Subtilase-like protein                                258   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038008.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    258   1e-76   Populus euphratica
ref|XP_010529409.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    258   1e-76   Tarenaya hassleriana [spider flower]
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...    258   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564413.2|  subtilase family protein                              258   1e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    258   1e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010529408.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    258   2e-76   Tarenaya hassleriana [spider flower]
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3         258   2e-76   Camelina sativa [gold-of-pleasure]
gb|AAL24366.1|  subtilisin proteinase-like                              256   2e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010436973.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    257   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3         257   2e-76   Camelina sativa [gold-of-pleasure]
emb|CAB36809.1|  subtilisin proteinase-like                             256   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567361.1|  Subtilase family protein                              257   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397045.1|  hypothetical protein EUTSA_v10028448mg             257   3e-76   Eutrema salsugineum [saltwater cress]
ref|XP_002893749.1|  hypothetical protein ARALYDRAFT_473479             256   4e-76   
emb|CDY54842.1|  BnaC05g51310D                                          262   4e-76   Brassica napus [oilseed rape]
ref|XP_010478713.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    254   4e-76   Camelina sativa [gold-of-pleasure]
ref|NP_567633.2|  Subtilase family protein                              256   4e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006391365.1|  hypothetical protein EUTSA_v10018142mg             256   6e-76   
ref|NP_567632.1|  Subtilase family protein                              256   6e-76   
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg             256   1e-75   Capsella rubella
ref|XP_010499844.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    256   1e-75   
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5         261   1e-75   
ref|XP_009105192.1|  PREDICTED: subtilisin-like protease SBT5.3         255   1e-75   Brassica rapa
ref|XP_010104913.1|  Subtilisin-like protease                           256   1e-75   
ref|NP_001078370.1|  subtilisin-like protease                           254   1e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDY07491.1|  BnaA07g25700D                                          255   1e-75   Brassica napus [oilseed rape]
gb|AAD03431.1|  similar to the subtilase family of serine proteas...    255   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3         256   2e-75   
dbj|BAE98849.1|  subtilisin-like protease -like protein                 254   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5         255   2e-75   
ref|XP_010478712.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    255   2e-75   Camelina sativa [gold-of-pleasure]
ref|XP_010554964.1|  PREDICTED: subtilisin-like protease SBT3.3         254   2e-75   
ref|XP_002874634.1|  subtilase family protein                           255   2e-75   
ref|NP_567362.1|  subtilisin-like protease                              255   2e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CAB40021.1|  subtilisin-like protease-like protein                  255   2e-75   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190697.1|  subtilisin-like protease                           255   3e-75   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg             254   3e-75   Eutrema salsugineum [saltwater cress]
emb|CDX98690.1|  BnaA03g44750D                                          253   4e-75   
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3         254   5e-75   
ref|NP_193895.2|  Subtilase family protein                              253   7e-75   Arabidopsis thaliana [mouse-ear cress]
emb|CDX98693.1|  BnaA03g44780D                                          253   8e-75   
ref|XP_002874635.1|  subtilase family protein                           253   8e-75   
emb|CDX94044.1|  BnaC07g36780D                                          252   1e-74   
ref|XP_002867836.1|  subtilase family protein                           252   2e-74   
ref|NP_174573.1|  Subtilisin-like serine endopeptidase family pro...    251   3e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132975.1|  PREDICTED: subtilisin-like protease SBT5.3         251   4e-74   Brassica rapa
ref|XP_010437025.1|  PREDICTED: subtilisin-like protease SBT3.5         251   4e-74   Camelina sativa [gold-of-pleasure]
emb|CDX84657.1|  BnaA03g15730D                                          251   4e-74   
ref|NP_564412.1|  Subtilase 3.5                                         251   5e-74   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010474133.1|  PREDICTED: subtilisin-like protease SBT3.3         251   5e-74   Camelina sativa [gold-of-pleasure]
gb|KFK41045.1|  hypothetical protein AALP_AA2G078300                    251   6e-74   Arabis alpina [alpine rockcress]
emb|CDX93811.1|  BnaA09g24110D                                          250   9e-74   
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3         250   1e-73   Brassica rapa
ref|XP_010511550.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    248   1e-73   
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg             249   1e-73   
emb|CDY25259.1|  BnaA02g21970D                                          249   2e-73   Brassica napus [oilseed rape]
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg             249   2e-73   Capsella rubella
gb|ADQ37388.1|  unknown                                                 248   2e-73   Capsella rubella
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg             249   2e-73   Capsella rubella
ref|XP_006304869.1|  hypothetical protein CARUB_v10012621mg             249   2e-73   
gb|AID21678.1|  At4g21326p-like protein                                 249   3e-73   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010463200.1|  PREDICTED: subtilisin-like protease SBT3.5         249   3e-73   
gb|AID21628.1|  At4g21326p-like protein                                 249   3e-73   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010511549.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    248   4e-73   Camelina sativa [gold-of-pleasure]
ref|XP_002891020.1|  subtilase family protein                           248   5e-73   
emb|CDY67954.1|  BnaAnng25710D                                          248   5e-73   Brassica napus [oilseed rape]
ref|XP_010419003.1|  PREDICTED: subtilisin-like protease SBT3.3         248   5e-73   
gb|ADQ37345.1|  unknown                                                 247   7e-73   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010480961.1|  PREDICTED: subtilisin-like protease SBT3.5         248   8e-73   
ref|XP_006283179.1|  hypothetical protein CARUB_v10004209mg             248   8e-73   Capsella rubella
emb|CAB87667.1|  subtilisin-like protease-like protein                  247   1e-72   Arabidopsis thaliana [mouse-ear cress]
gb|ABV21208.1|  At4g21326                                               246   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568255.1|  Subtilase family protein                              247   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567625.4|  subtilase 3.12                                        247   1e-72   
ref|XP_002871506.1|  subtilase family protein                           246   2e-72   Arabidopsis lyrata subsp. lyrata
gb|ADQ37356.1|  unknown                                                 245   2e-72   Arabidopsis lyrata [lyrate rockcress]
gb|AID21685.1|  At4g21326p-like protein                                 246   4e-72   Arabidopsis lyrata [lyrate rockcress]
emb|CDX86874.1|  BnaA09g22640D                                          246   4e-72   
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                    246   4e-72   Arabis alpina [alpine rockcress]
gb|AID21653.1|  At4g21326p-like protein                                 245   9e-72   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010538683.1|  PREDICTED: subtilisin-like protease SBT3.5         244   9e-72   Tarenaya hassleriana [spider flower]
gb|AJP61136.1|  At4g21326p-like protein                                 244   9e-72   Arabidopsis halleri
emb|CDX99526.1|  BnaC09g24660D                                          244   1e-71   
gb|AID21581.1|  AT4G21326p                                              244   1e-71   Arabidopsis halleri
emb|CDX91186.1|  BnaC02g04110D                                          244   2e-71   
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg             243   2e-71   
gb|AID21603.1|  At4g21326p-like protein                                 244   2e-71   Arabidopsis halleri
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                    248   3e-71   Arabis alpina [alpine rockcress]
gb|ADQ37368.1|  unknown                                                 242   3e-71   Arabidopsis lyrata [lyrate rockcress]
ref|XP_010470496.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    242   3e-71   Camelina sativa [gold-of-pleasure]
emb|CCI61494.1|  unnamed protein product                                243   3e-71   Arabidopsis halleri
gb|AJP61119.1|  At4g21326p-like protein                                 243   3e-71   Arabidopsis halleri
ref|XP_010470495.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    243   5e-71   Camelina sativa [gold-of-pleasure]
ref|XP_010538146.1|  PREDICTED: subtilisin-like protease SBT3.5         243   9e-71   Tarenaya hassleriana [spider flower]
emb|CDY61569.1|  BnaCnng38020D                                          245   1e-70   Brassica napus [oilseed rape]
emb|CDY65868.1|  BnaAnng21170D                                          240   1e-70   Brassica napus [oilseed rape]
ref|XP_002869894.1|  hypothetical protein ARALYDRAFT_329472             247   2e-70   
emb|CAA20197.1|  putative protein                                       246   2e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg             240   6e-70   Eutrema salsugineum [saltwater cress]
ref|XP_009125836.1|  PREDICTED: subtilisin-like protease SBT5.4         240   6e-70   Brassica rapa
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          240   7e-70   Glycine max [soybeans]
gb|KHN39834.1|  Cucumisin                                               239   8e-70   Glycine soja [wild soybean]
ref|XP_010436935.1|  PREDICTED: subtilisin-like protease SBT3.3         239   8e-70   Camelina sativa [gold-of-pleasure]
ref|XP_002888489.1|  subtilase family protein                           239   9e-70   
ref|NP_564868.2|  Subtilisin-like serine endopeptidase family pro...    239   1e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AAG51763.1|AC066691_3  hypothetical protein; 8963-6048               239   2e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg             239   2e-69   Eutrema salsugineum [saltwater cress]
ref|XP_006286458.1|  hypothetical protein CARUB_v10000288mg             238   3e-69   Capsella rubella
emb|CAB36808.1|  subtilisin-like protease                               238   3e-69   Arabidopsis thaliana [mouse-ear cress]
gb|AID21654.1|  At4g21323p-like protein                                 238   4e-69   Arabidopsis lyrata [lyrate rockcress]
ref|XP_007039330.1|  Subtilase family protein, putative                 239   1e-68   
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080          236   1e-68   
ref|XP_002887016.1|  subtilase family protein                           236   2e-68   Arabidopsis lyrata subsp. lyrata
gb|AID21679.1|  At4g21323p-like protein                                 236   4e-68   Arabidopsis lyrata [lyrate rockcress]
gb|AID21686.1|  At4g21323p-like protein                                 235   5e-68   Arabidopsis lyrata [lyrate rockcress]
gb|ACN35690.1|  unknown                                                 223   6e-68   Zea mays [maize]
emb|CAN80173.1|  hypothetical protein VITISV_018392                     236   6e-68   Vitis vinifera
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like          237   1e-67   
ref|XP_010449088.1|  PREDICTED: subtilisin-like protease SBT3.5         234   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    236   1e-67   
emb|CCI61493.1|  unnamed protein product                                234   1e-67   Arabidopsis halleri
emb|CDY49641.1|  BnaCnng17930D                                          233   1e-67   Brassica napus [oilseed rape]
ref|XP_011079238.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    234   1e-67   Sesamum indicum [beniseed]
ref|XP_008778788.1|  PREDICTED: subtilisin-like protease SBT5.4         226   1e-67   
gb|AID21619.1|  At4g21323p-like protein                                 234   2e-67   Arabidopsis halleri
gb|AID21582.1|  AT4G21323p                                              234   2e-67   Arabidopsis halleri
gb|AID21627.1|  At4g21323p-like protein                                 234   2e-67   Arabidopsis lyrata [lyrate rockcress]
gb|AID21602.1|  At4g21323p-like protein                                 233   4e-67   Arabidopsis halleri
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             232   5e-67   Phaseolus vulgaris [French bean]
emb|CDX93810.1|  BnaA09g24100D                                          231   7e-67   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          232   8e-67   
emb|CDY07492.1|  BnaA07g25710D                                          231   2e-66   Brassica napus [oilseed rape]
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3         231   2e-66   Eucalyptus grandis [rose gum]
ref|XP_009105193.1|  PREDICTED: subtilisin-like protease SBT5.3         231   2e-66   Brassica rapa
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                     231   2e-66   Eucalyptus grandis [rose gum]
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       231   2e-66   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             230   3e-66   
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3         230   3e-66   Eucalyptus grandis [rose gum]
ref|XP_010513580.1|  PREDICTED: subtilisin-like protease SBT3.3         229   4e-66   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       230   8e-66   
gb|AJP61138.1|  At4g21323p-like protein                                 229   8e-66   Arabidopsis halleri
emb|CDX94032.1|  BnaC07g36660D                                          228   1e-65   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                228   2e-65   Prunus mume [ume]
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         228   2e-65   Populus euphratica
emb|CDX94033.1|  BnaC07g36670D                                          228   2e-65   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         228   3e-65   Populus euphratica
emb|CDY58475.1|  BnaA03g58460D                                          228   3e-65   Brassica napus [oilseed rape]
ref|XP_006357625.1|  PREDICTED: subtilisin-like protease-like           223   3e-65   
ref|XP_009137185.1|  PREDICTED: subtilisin-like protease SBT5.4         227   5e-65   Brassica rapa
ref|XP_010109770.1|  hypothetical protein L484_008446                   226   5e-65   
emb|CDY70485.1|  BnaA03g58450D                                          226   5e-65   Brassica napus [oilseed rape]
ref|XP_007042043.1|  Subtilase family protein, putative isoform 2       224   6e-65   
ref|XP_009137186.1|  PREDICTED: subtilisin-like protease SBT5.3         226   6e-65   Brassica rapa
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    226   7e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    226   7e-65   Nelumbo nucifera [Indian lotus]
ref|XP_010919043.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    225   1e-64   
ref|XP_006286616.1|  hypothetical protein CARUB_v10002407mg             225   1e-64   
ref|XP_006580143.1|  PREDICTED: subtilisin-like protease SDD1-lik...    224   1e-64   Glycine max [soybeans]
ref|XP_006351094.1|  PREDICTED: cucumisin-like                          226   1e-64   Solanum tuberosum [potatoes]
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             226   1e-64   
ref|XP_006283139.1|  hypothetical protein CARUB_v10004165mg             226   2e-64   Capsella rubella
ref|XP_011458289.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    223   2e-64   Fragaria vesca subsp. vesca
ref|XP_006413795.1|  hypothetical protein EUTSA_v10024459mg             225   2e-64   
ref|XP_006580142.1|  PREDICTED: subtilisin-like protease SDD1-lik...    224   2e-64   Glycine max [soybeans]
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      225   2e-64   Setaria italica
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       225   2e-64   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    225   2e-64   Elaeis guineensis
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       225   3e-64   
emb|CDY49640.1|  BnaCnng17920D                                          224   3e-64   Brassica napus [oilseed rape]
ref|XP_010495162.1|  PREDICTED: subtilisin-like protease SBT3.3         214   3e-64   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                224   4e-64   Malus domestica [apple tree]
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             224   5e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             224   5e-64   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         224   5e-64   Jatropha curcas
ref|XP_011458287.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    224   5e-64   Fragaria vesca subsp. vesca
ref|XP_011458288.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    224   5e-64   Fragaria vesca subsp. vesca
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    224   5e-64   Glycine max [soybeans]
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    224   6e-64   Glycine max [soybeans]
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    224   6e-64   Pyrus x bretschneideri [bai li]
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    224   7e-64   Pyrus x bretschneideri [bai li]
ref|XP_006423460.1|  hypothetical protein CICLE_v10027857mg             221   7e-64   
ref|XP_010551747.1|  PREDICTED: subtilisin-like protease SBT3.5         223   8e-64   Tarenaya hassleriana [spider flower]
ref|NP_567624.1|  Subtilase family protein                              224   8e-64   Arabidopsis thaliana [mouse-ear cress]
gb|KDO40058.1|  hypothetical protein CISIN_1g006582mg                   221   8e-64   Citrus sinensis [apfelsine]
ref|XP_006289915.1|  hypothetical protein CARUB_v10003531mg             223   9e-64   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     223   1e-63   
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    222   2e-63   
gb|EAZ09847.1|  hypothetical protein OsI_32138                          222   3e-63   
ref|XP_006487362.1|  PREDICTED: subtilisin-like protease SDD1-lik...    221   3e-63   
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      222   3e-63   
ref|XP_008775642.1|  PREDICTED: subtilisin-like protease SBT5.3         221   4e-63   
emb|CBI34615.3|  unnamed protein product                                221   4e-63   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             221   4e-63   
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         221   4e-63   
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    221   5e-63   
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3         221   5e-63   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          221   6e-63   
emb|CBI34614.3|  unnamed protein product                                225   7e-63   
ref|NP_174574.2|  Subtilisin-like serine endopeptidase family pro...    206   9e-63   
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         220   1e-62   
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg             220   1e-62   
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3         220   1e-62   
gb|KCW72614.1|  hypothetical protein EUGRSUZ_E01074                     220   1e-62   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g             220   2e-62   
ref|XP_006413752.1|  hypothetical protein EUTSA_v10027359mg             218   3e-62   
ref|NP_001169390.1|  putative subtilase family protein precursor        218   7e-62   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         218   8e-62   
emb|CDX94252.1|  BnaC02g29120D                                          217   1e-61   
ref|XP_002518939.1|  Cucumisin precursor, putative                      217   1e-61   
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like           217   2e-61   
ref|XP_003614591.1|  Subtilisin-like protease                           215   3e-61   
dbj|BAK05842.1|  predicted protein                                      214   1e-60   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease                213   3e-60   
gb|AET04097.2|  subtilisin-like serine protease                         213   4e-60   
ref|XP_010456502.1|  PREDICTED: subtilisin-like protease SBT3.3         212   9e-60   
ref|XP_006287131.1|  hypothetical protein CARUB_v10000302mg             212   1e-59   
ref|NP_001052081.1|  Os04g0127200                                       210   1e-59   
gb|EEE60418.1|  hypothetical protein OsJ_13612                          211   1e-59   
ref|XP_006387513.1|  hypothetical protein POPTR_0909s00200g             201   2e-59   
emb|CAE76061.1|  B1248C03.20                                            211   3e-59   
gb|AAO61749.1|AF366558_1  subtilisin-like seed-specific protein         199   3e-59   
ref|XP_003629621.1|  Subtilisin-like protease                           211   3e-59   
ref|XP_009391852.1|  PREDICTED: subtilisin-like protease SBT5.3         210   4e-59   
gb|ACF80197.1|  unknown                                                 201   4e-59   
ref|XP_003608829.1|  Subtilisin-like serine protease                    211   4e-59   
gb|AES91026.2|  subtilisin-like serine protease                         210   5e-59   
gb|AES91025.2|  subtilisin-like serine protease                         209   6e-59   
ref|XP_002873539.1|  hypothetical protein ARALYDRAFT_909167             206   7e-59   
ref|XP_006370728.1|  hypothetical protein POPTR_0001s45460g             201   7e-59   
ref|XP_003608828.1|  Subtilisin-like serine protease                    210   7e-59   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like           209   1e-58   
ref|NP_001063751.1|  Os09g0530800                                       209   1e-58   
ref|XP_010439493.1|  PREDICTED: subtilisin-like protease SBT3.5         209   2e-58   
gb|KJB18900.1|  hypothetical protein B456_003G074100                    208   2e-58   
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             208   3e-58   
gb|EEC76687.1|  hypothetical protein OsI_14684                          198   4e-58   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         207   7e-58   
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         206   1e-57   
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      206   1e-57   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      206   2e-57   
ref|XP_010257694.1|  PREDICTED: subtilisin-like protease SBT3.5         205   3e-57   
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3         205   3e-57   
gb|AES91027.2|  subtilisin-like serine protease                         205   3e-57   
ref|XP_010092450.1|  Subtilisin-like protease                           196   3e-57   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1           204   5e-57   
ref|XP_010434193.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    204   6e-57   
ref|XP_010434192.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    204   7e-57   
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             204   7e-57   
gb|AFW55829.1|  putative subtilase family protein                       201   9e-57   
ref|XP_010934028.1|  PREDICTED: subtilisin-like protease SBT3.5         202   2e-56   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           203   2e-56   
ref|XP_010087081.1|  Subtilisin-like protease SDD1                      198   4e-56   
gb|KJB79072.1|  hypothetical protein B456_013G033000                    201   5e-56   
gb|KJB79074.1|  hypothetical protein B456_013G033000                    201   5e-56   
gb|KJB79073.1|  hypothetical protein B456_013G033000                    201   6e-56   
ref|XP_003608830.1|  Subtilisin-like serine protease                    205   6e-56   
ref|NP_001130788.1|  putative subtilase family protein precursor        201   7e-56   
gb|KJB79075.1|  hypothetical protein B456_013G033000                    201   7e-56   
gb|KJB79071.1|  hypothetical protein B456_013G033000                    201   8e-56   
ref|NP_001052082.1|  Os04g0127300                                       199   8e-56   
gb|KJB79077.1|  hypothetical protein B456_013G033000                    201   9e-56   
ref|XP_008663777.1|  PREDICTED: subtilisin-like protease SBT5.3         201   1e-55   
gb|EMT21267.1|  Subtilisin-like protease                                200   1e-55   
gb|EAZ29539.1|  hypothetical protein OsJ_13613                          200   2e-55   
ref|XP_006653124.1|  PREDICTED: subtilisin-like protease-like           200   2e-55   
emb|CAE76069.1|  B1340F09.7                                             200   2e-55   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             200   2e-55   
gb|KHG28029.1|  Subtilisin-like protease SDD1                           200   2e-55   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             200   2e-55   
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           199   3e-55   
tpg|DAA57281.1|  TPA: putative subtilase family protein                 190   4e-55   
ref|XP_007210133.1|  hypothetical protein PRUPE_ppa022964mg             198   4e-55   
ref|XP_003608826.1|  Subtilisin-like protease                           199   4e-55   
gb|KEH35215.1|  subtilisin-like serine protease                         197   6e-55   
ref|XP_008783547.1|  PREDICTED: subtilisin-like protease SBT5.3         198   6e-55   
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like           198   7e-55   
gb|KEH35216.1|  subtilisin-like serine protease                         197   8e-55   
gb|KDP35557.1|  hypothetical protein JCGZ_08995                         198   9e-55   
gb|KCW88587.1|  hypothetical protein EUGRSUZ_A00964                     193   9e-55   
ref|XP_006826300.1|  hypothetical protein AMTR_s00004p00071240          198   1e-54   
ref|XP_003601486.1|  Subtilisin-like protease                           198   1e-54   
gb|KGN55997.1|  hypothetical protein Csa_3G045110                       196   1e-54   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             197   1e-54   
ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    197   2e-54   
gb|EMT29372.1|  Xylem serine proteinase 1                               191   2e-54   
gb|EEE60420.1|  hypothetical protein OsJ_13615                          191   2e-54   
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         197   2e-54   
gb|KJB22186.1|  hypothetical protein B456_004G034100                    197   2e-54   
ref|NP_001052071.1|  Os04g0121100                                       196   3e-54   
emb|CAE01678.2|  OSJNBb0089K24.3                                        196   3e-54   
ref|XP_004515894.1|  PREDICTED: subtilisin-like protease-like           196   4e-54   
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         196   4e-54   
ref|XP_010934029.1|  PREDICTED: subtilisin-like protease SBT3.5         196   5e-54   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         196   5e-54   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         196   6e-54   
ref|XP_006377332.1|  hypothetical protein POPTR_0011s04980g             196   6e-54   
gb|EEC67681.1|  hypothetical protein OsI_35120                          196   7e-54   
gb|KHN01461.1|  Subtilisin-like protease                                188   8e-54   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                195   8e-54   
emb|CAH66111.1|  OSIGBa0115D20.4                                        195   9e-54   
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4         196   9e-54   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      195   1e-53   
gb|EMS68678.1|  Subtilisin-like protease                                195   1e-53   
emb|CAE76073.1|  B1340F09.11                                            191   1e-53   
gb|KCW72613.1|  hypothetical protein EUGRSUZ_E01073                     198   1e-53   
gb|EMS55531.1|  Subtilisin-like protease                                194   1e-53   
emb|CAN62337.1|  hypothetical protein VITISV_004299                     193   1e-53   
ref|XP_006301478.1|  hypothetical protein CARUB_v10021900mg             194   2e-53   
emb|CAE03802.2|  OSJNBa0027H09.2                                        191   2e-53   
ref|XP_003524185.1|  PREDICTED: subtilisin-like protease-like           194   2e-53   
gb|EAY92882.1|  hypothetical protein OsI_14686                          192   2e-53   
ref|XP_009391857.1|  PREDICTED: subtilisin-like protease SBT5.4         194   2e-53   
ref|XP_009391853.1|  PREDICTED: subtilisin-like protease SBT5.3         194   2e-53   
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    197   2e-53   
gb|EMS61069.1|  Subtilisin-like protease                                194   2e-53   
gb|EMT21268.1|  Subtilisin-like protease                                194   3e-53   
gb|KEH31721.1|  subtilisin-like serine protease                         193   3e-53   
ref|XP_006653122.1|  PREDICTED: xylem serine proteinase 1-like          194   3e-53   
ref|XP_006662913.1|  PREDICTED: cucumisin-like                          194   3e-53   
ref|XP_010657502.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    192   3e-53   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease SBT3.5         194   4e-53   
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      193   4e-53   
ref|XP_006475104.1|  PREDICTED: subtilisin-like protease-like           193   5e-53   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      193   5e-53   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5         193   6e-53   
ref|XP_006452710.1|  hypothetical protein CICLE_v10010380mg             193   6e-53   
gb|EYU34388.1|  hypothetical protein MIMGU_mgv1a001745mg                193   7e-53   
gb|EMT12416.1|  Subtilisin-like protease                                185   7e-53   
emb|CBI38006.3|  unnamed protein product                                193   7e-53   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         193   7e-53   
ref|XP_002451942.1|  hypothetical protein SORBIDRAFT_04g010340          186   8e-53   
ref|XP_002266728.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    192   9e-53   
ref|NP_001044505.1|  Os01g0794800                                       192   9e-53   
gb|EAZ13817.1|  hypothetical protein OsJ_03742                          192   1e-52   
gb|KDO76781.1|  hypothetical protein CISIN_1g042478mg                   194   1e-52   
ref|NP_001267495.1|  SUB1 homolog precursor                             192   1e-52   
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         192   1e-52   
gb|EEC68285.1|  hypothetical protein OsI_36335                          192   1e-52   
ref|XP_002320540.2|  subtilisin-like protease family protein            192   1e-52   
ref|XP_009391860.1|  PREDICTED: subtilisin-like protease SBT5.3         192   1e-52   
gb|EEC76686.1|  hypothetical protein OsI_14683                          191   2e-52   
ref|XP_004951230.1|  PREDICTED: subtilisin-like protease-like           191   2e-52   
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5         191   2e-52   
ref|XP_008344750.1|  PREDICTED: subtilisin-like protease                190   2e-52   
gb|EMS63596.1|  Cucumisin                                               191   2e-52   
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         192   2e-52   
dbj|BAJ96374.1|  predicted protein                                      191   3e-52   
dbj|BAJ90143.1|  predicted protein                                      191   3e-52   
ref|NP_001046517.1|  Os02g0269600                                       191   3e-52   
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                191   3e-52   
dbj|BAJ96317.1|  predicted protein                                      191   3e-52   
ref|XP_010676145.1|  PREDICTED: subtilisin-like protease SBT5.4         182   3e-52   
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3         191   3e-52   
ref|XP_002960360.1|  hypothetical protein SELMODRAFT_402550             191   4e-52   
gb|KHN40543.1|  Subtilisin-like protease                                190   4e-52   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         191   5e-52   
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                190   5e-52   
ref|XP_011082896.1|  PREDICTED: subtilisin-like protease SBT5.3         190   5e-52   
ref|XP_002967355.1|  hypothetical protein SELMODRAFT_439868             190   5e-52   
ref|XP_010532509.1|  PREDICTED: cucumisin-like                          190   5e-52   
gb|EMT01683.1|  Subtilisin-like protease                                184   6e-52   
dbj|BAJ94791.1|  predicted protein                                      190   6e-52   
ref|XP_003581117.1|  PREDICTED: subtilisin-like protease SBT3.3         190   7e-52   
ref|XP_004970242.1|  PREDICTED: subtilisin-like protease SDD1-like      190   7e-52   
gb|AFV08661.1|  subtilisin-like protease                                190   7e-52   
ref|XP_002300539.2|  hypothetical protein POPTR_0001s460002g            184   7e-52   
gb|EEC76675.1|  hypothetical protein OsI_14653                          187   7e-52   
ref|XP_002451014.1|  hypothetical protein SORBIDRAFT_05g022620          189   8e-52   
emb|CDY65695.1|  BnaA02g06820D                                          187   8e-52   
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         190   9e-52   
dbj|BAJ34472.1|  unnamed protein product                                185   9e-52   
ref|XP_010539197.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    189   9e-52   
gb|EAZ08215.1|  hypothetical protein OsI_30473                          187   9e-52   
ref|XP_007207992.1|  hypothetical protein PRUPE_ppa015005mg             189   1e-51   
ref|XP_010107369.1|  Subtilisin-like protease                           189   1e-51   
ref|XP_010096499.1|  Subtilisin-like protease                           189   1e-51   
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         189   1e-51   
gb|ADE77855.1|  unknown                                                 184   1e-51   
ref|XP_008674940.1|  PREDICTED: subtilisin-like protease SBT5.3         189   1e-51   
emb|CBI39824.3|  unnamed protein product                                189   1e-51   
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4         189   1e-51   
gb|ADE76648.1|  unknown                                                 184   1e-51   
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...    189   2e-51   
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         189   2e-51   
ref|XP_008797388.1|  PREDICTED: subtilisin-like protease SBT5.3         189   2e-51   
ref|XP_010443761.1|  PREDICTED: subtilisin-like protease SBT5.4         189   2e-51   
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         189   2e-51   
ref|XP_010483626.1|  PREDICTED: subtilisin-like protease SBT5.4         184   2e-51   
gb|AIC80773.1|  subtilase                                               189   2e-51   
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease                189   2e-51   
emb|CDP01740.1|  unnamed protein product                                188   2e-51   
ref|XP_002456475.1|  hypothetical protein SORBIDRAFT_03g037010          188   2e-51   
ref|XP_009610677.1|  PREDICTED: subtilisin-like protease SBT5.4         188   3e-51   
gb|KJB79076.1|  hypothetical protein B456_013G033000                    188   3e-51   
ref|XP_004970243.1|  PREDICTED: subtilisin-like protease SDD1-like      181   3e-51   
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           188   3e-51   
ref|XP_010917817.1|  PREDICTED: subtilisin-like protease SBT3.5         188   3e-51   
ref|XP_006365013.1|  PREDICTED: subtilisin-like protease-like           188   3e-51   
emb|CDY15145.1|  BnaC05g00240D                                          188   3e-51   
ref|XP_010092360.1|  Subtilisin-like protease                           188   3e-51   
ref|XP_004512298.1|  PREDICTED: subtilisin-like protease-like iso...    188   4e-51   
ref|XP_009391854.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    188   4e-51   
ref|XP_009391855.1|  PREDICTED: subtilisin-like protease isoform X2     187   4e-51   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...    187   4e-51   
ref|XP_009784573.1|  PREDICTED: subtilisin-like protease SBT5.4         188   4e-51   



>ref|XP_010099424.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB78386.1| Subtilisin-like protease [Morus notabilis]
Length=394

 Score =   280 bits (716),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/240 (61%), Positives = 175/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NIL+A  PSDP    S + F+SGTSMA PHV+GIVALLK+ HPDWSPA IKSAIVTTAW 
Sbjct  153  NILSAVSPSDPKAN-SAFAFMSGTSMAAPHVSGIVALLKSLHPDWSPAAIKSAIVTTAWN  211

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGE IF EGE + KLAD FD+GGGI+N NRA  PGLVYDM T DY++ LCAMGY++
Sbjct  212  TD-PSGELIFAEGEPM-KLADPFDFGGGIVNFNRAADPGLVYDMGTEDYLHYLCAMGYNN  269

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS +    TSC  K  S+LD+N PSITIP L +P  LTRTV NVG  NS+YK +V+PP
Sbjct  270  SAISQLREHPTSCPTKRPSVLDLNLPSITIPSLTKPTKLTRTVRNVGHANSSYKAVVKPP  329

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            +GI + V+P  L F+     ISF V +S+ H   TG+YFGSL W DGVH V  PISV+T+
Sbjct  330  QGIRISVRPRLLTFNATNNTISFTVAVSSTHRVTTGYYFGSLTWTDGVHTVNSPISVRTE  389



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score =   285 bits (729),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 178/241 (74%), Gaps = 4/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            ++LAAY+P+   +    Y+F SGTSMA PH+AGI ALLK+ HP WS A IKSA+VTTAWT
Sbjct  540  DVLAAYVPT--TLSPQGYSFDSGTSMAAPHIAGIAALLKSLHPHWSLAAIKSALVTTAWT  597

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             D  SGEPIF +G+ I KLAD FDYGGG++NPN AR PGLVYD+ T DYVN LCAMGYS 
Sbjct  598  MDPYSGEPIFAKGQ-IPKLADPFDYGGGLVNPNAARTPGLVYDIGTQDYVNYLCAMGYSE  656

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              I+ + G+  SC K   S+LD+N PSIT+P+LK  +T+ +TVTNVG ENS Y+ +V PP
Sbjct  657  TDINQLTGRPKSCKKSSNSVLDLNLPSITVPNLKGSVTIRKTVTNVGDENSKYEAVVVPP  716

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G +V V P  L FSP V+++SF V I+T H   T +YFGSL W+DG H V+IPISV+T+
Sbjct  717  LGTVVKVNPKHLQFSPEVREMSFKVKITTLHNITTEYYFGSLTWSDGKHEVKIPISVRTE  776

Query  33   Y  31
            +
Sbjct  777  F  777



>ref|XP_009350314.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=718

 Score =   282 bits (722),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 150/244 (61%), Positives = 179/244 (73%), Gaps = 5/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA    DP +    +  +SGTSMATPH+AGIVALLK+ HP WSPA +KSA+VTTAW 
Sbjct  474  NILAAS-SYDPTMD-GGFALLSGTSMATPHIAGIVALLKSLHPGWSPAAMKSALVTTAWK  531

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GEPIF EG T  KLAD FDYGGG++NPN+A  PGL+YDM T DY+N LCA GY++
Sbjct  532  TD-PFGEPIFAEG-TGQKLADPFDYGGGLVNPNKAANPGLIYDMGTNDYINYLCAFGYNT  589

Query  390  KAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS++  Q TSC     SILDVN PSITIP+L+ P+TLTRTVTNVGP  STYK  +EPP
Sbjct  590  SAISLLVKQATSCPVIKPSILDVNLPSITIPNLRNPVTLTRTVTNVGPVISTYKTQIEPP  649

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI VVVKP  L F+  VK +SF V +ST +  NT ++FGSL W DGVH V  PISV+T+
Sbjct  650  LGINVVVKPEALVFNSTVKALSFTVAVSTTYQVNTAYFFGSLTWTDGVHAVSSPISVRTQ  709

Query  33   Y*ES  22
              +S
Sbjct  710  IIQS  713



>ref|XP_007039329.1| Subtilase family protein [Theobroma cacao]
 gb|EOY23830.1| Subtilase family protein [Theobroma cacao]
Length=512

 Score =   276 bits (705),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 143/240 (60%), Positives = 174/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            ++LAA  P DP +    +   SGTSMA P ++GI+ALLK+ HP+WSPA I+SAIVTTAW 
Sbjct  267  SLLAASSPLDPFMN-GGFALHSGTSMAAPVISGIIALLKSKHPNWSPAAIRSAIVTTAWK  325

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             D   GEPIF EG    KLAD FD+GGG++NPNRA KPGLVYDM T DYV+ LCA+GY++
Sbjct  326  ND-PLGEPIFAEGSP-RKLADPFDFGGGLVNPNRASKPGLVYDMDTDDYVHYLCAVGYNN  383

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQ  +C     S+LDVN PSITIP+L+   TLTR VTNVGP NSTYK +VEPP
Sbjct  384  SAISKLVGQGIACPSAKPSVLDVNVPSITIPNLRNSATLTRRVTNVGPPNSTYKALVEPP  443

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI V V P+ L F    ++IS+ V +ST H  NTG+YFGSL W DGVHNV IPIS +T+
Sbjct  444  FGITVTVTPNILVFHSTAQEISYQVRVSTSHQVNTGYYFGSLTWTDGVHNVAIPISARTQ  503



>ref|XP_010529680.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Tarenaya 
hassleriana]
Length=707

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 179/240 (75%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA   +D ++    +   SGTSMATP V+GIVALL+A HP+WSPA I+SAIVTTAW 
Sbjct  462  NILAATSLND-SLGAGGFVLKSGTSMATPVVSGIVALLRALHPNWSPAAIRSAIVTTAWK  520

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++NP +A  PGLVYDM T+DY++ +C++GY  
Sbjct  521  TD-PSGEPIFADGSN-RKLADPFDYGGGLVNPEKATDPGLVYDMGTSDYIHYMCSVGYKD  578

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS++ G+ T C H   S+LD+N PSITIPDL   +T+TRTVTNVGP NS YKV+++PP
Sbjct  579  PSISLVVGKATICPHPNPSVLDLNLPSITIPDLSGEVTITRTVTNVGPRNSVYKVVIDPP  638

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ + V P TL F+P  +++SF V +ST H  NTGFYFGSL W D VHNV IP+SV+T+
Sbjct  639  SGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAIPVSVRTQ  698



>ref|XP_010529679.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Tarenaya 
hassleriana]
Length=717

 Score =   278 bits (711),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 179/240 (75%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA   +D ++    +   SGTSMATP V+GIVALL+A HP+WSPA I+SAIVTTAW 
Sbjct  472  NILAATSLND-SLGAGGFVLKSGTSMATPVVSGIVALLRALHPNWSPAAIRSAIVTTAWK  530

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++NP +A  PGLVYDM T+DY++ +C++GY  
Sbjct  531  TD-PSGEPIFADGSN-RKLADPFDYGGGLVNPEKATDPGLVYDMGTSDYIHYMCSVGYKD  588

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS++ G+ T C H   S+LD+N PSITIPDL   +T+TRTVTNVGP NS YKV+++PP
Sbjct  589  PSISLVVGKATICPHPNPSVLDLNLPSITIPDLSGEVTITRTVTNVGPRNSVYKVVIDPP  648

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ + V P TL F+P  +++SF V +ST H  NTGFYFGSL W D VHNV IP+SV+T+
Sbjct  649  SGVHMDVNPKTLVFNPKTERVSFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAIPVSVRTQ  708



>ref|XP_010529681.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X3 [Tarenaya 
hassleriana]
Length=704

 Score =   276 bits (707),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 134/219 (61%), Positives = 169/219 (77%), Gaps = 3/219 (1%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMATP V+GIVALL+A HP+WSPA I+SAIVTTAW TD  SGEPIF +G    KLAD
Sbjct  479  SGTSMATPVVSGIVALLRALHPNWSPAAIRSAIVTTAWKTD-PSGEPIFADGSN-RKLAD  536

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSIL  331
             FDYGGG++NP +A  PGLVYDM T+DY++ +C++GY   +IS++ G+ T C H   S+L
Sbjct  537  PFDYGGGLVNPEKATDPGLVYDMGTSDYIHYMCSVGYKDPSISLVVGKATICPHPNPSVL  596

Query  330  DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
            D+N PSITIPDL   +T+TRTVTNVGP NS YKV+++PP G+ + V P TL F+P  +++
Sbjct  597  DLNLPSITIPDLSGEVTITRTVTNVGPRNSVYKVVIDPPSGVHMDVNPKTLVFNPKTERV  656

Query  150  SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            SF V +ST H  NTGFYFGSL W D VHNV IP+SV+T+
Sbjct  657  SFTVRVSTSHKVNTGFYFGSLTWTDSVHNVAIPVSVRTQ  695



>ref|XP_009348696.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=759

 Score =   278 bits (710),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 177/245 (72%), Gaps = 9/245 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVR-----ISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIV  586
            NILAA  P DP           +   SGTSMA PH+AGIVALLK+ HPDWSPA +KSA+V
Sbjct  509  NILAAK-PYDPTSSNQPPLDGVFALDSGTSMAAPHIAGIVALLKSLHPDWSPAAMKSALV  567

Query  585  TTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCA  406
            TTAW TD   GEPIF EG  + KLAD FDYGGG++NPN+A  PGL+YDM+T DY+N LCA
Sbjct  568  TTAWKTD-PFGEPIFAEGAGL-KLADPFDYGGGLVNPNKAAHPGLIYDMATNDYINYLCA  625

Query  405  MGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKV  229
             GY +  ++ +    TSC  +  SILDVN PSITIP+++ PITLTRTVTN+GP +STYK 
Sbjct  626  FGYDTLTVTQLVEHATSCPVQKPSILDVNLPSITIPNIRNPITLTRTVTNIGPVSSTYKA  685

Query  228  MVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPI  49
             +EPP GI VVV+P TL F+  VKKISF V +ST +  NT ++FGSL W DGVH V  P+
Sbjct  686  QIEPPPGINVVVRPETLVFNSTVKKISFTVEVSTTYRVNTAYFFGSLTWTDGVHAVTSPM  745

Query  48   SVKTK  34
            SV+T+
Sbjct  746  SVRTQ  750



>ref|XP_010318062.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010318063.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
Length=732

 Score =   276 bits (705),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 178/243 (73%), Gaps = 9/243 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA +P+D     + Y F SGTSMA PHV+GIVALLK+ HP WSPA IKSA+VTTAW 
Sbjct  495  NILAAVLPAD-----TPYRFESGTSMAAPHVSGIVALLKSLHPHWSPAAIKSALVTTAWV  549

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEP+ +EG   +KLAD FD+GGG++N N A+ PGLVYDM T DY+  LC+MGY++
Sbjct  550  TDPHSGEPVISEGNP-NKLADPFDFGGGLVNTNGAKDPGLVYDMGTFDYILYLCSMGYNN  608

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS++  Q  SC  K  SILDVN PS+TIP L++ +   RTVTNVGP NS Y+ ++EPP
Sbjct  609  SAISMLIDQAASCPIKRPSILDVNLPSLTIPSLRKKVR--RTVTNVGPVNSKYEAIIEPP  666

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + VKP TL F+ + KKISF +TIST H + T +YFGSL W DG+H VR P SV+ +
Sbjct  667  LGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYYYFGSLTWTDGMHRVRSPTSVRNE  726

Query  33   Y*E  25
            + E
Sbjct  727  FPE  729



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score =   276 bits (707),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 178/243 (73%), Gaps = 9/243 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA +P+D     + Y F SGTSMA PHV+GIVALLK+ HP WSPA IKSA+VTTAW 
Sbjct  527  NILAAVLPAD-----TPYRFESGTSMAAPHVSGIVALLKSLHPHWSPAAIKSALVTTAWV  581

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEP+ +EG   +KLAD FD+GGG++N N A+ PGLVYDM T DY+  LC+MGY++
Sbjct  582  TDPHSGEPVISEGNP-NKLADPFDFGGGLVNTNGAKDPGLVYDMGTFDYILYLCSMGYNN  640

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS++  Q  SC  K  SILDVN PS+TIP L++ +   RTVTNVGP NS Y+ ++EPP
Sbjct  641  SAISMLIDQAASCPIKRPSILDVNLPSLTIPSLRKKVR--RTVTNVGPVNSKYEAIIEPP  698

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + VKP TL F+ + KKISF +TIST H + T +YFGSL W DG+H VR P SV+ +
Sbjct  699  LGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYYYFGSLTWTDGMHRVRSPTSVRNE  758

Query  33   Y*E  25
            + E
Sbjct  759  FPE  761



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   276 bits (707),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 178/243 (73%), Gaps = 9/243 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA +P+D     + Y F SGTSMA PHV+GIVALLK+ HP WSPA IKSA+VTTAW 
Sbjct  535  NILAAVLPAD-----TPYRFESGTSMAAPHVSGIVALLKSLHPHWSPAAIKSALVTTAWV  589

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEP+ +EG   +KLAD FD+GGG++N N A+ PGLVYDM T DY+  LC+MGY++
Sbjct  590  TDPHSGEPVISEGNP-NKLADPFDFGGGLVNTNGAKDPGLVYDMGTFDYILYLCSMGYNN  648

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS++  Q  SC  K  SILDVN PS+TIP L++ +   RTVTNVGP NS Y+ ++EPP
Sbjct  649  SAISMLIDQAASCPIKRPSILDVNLPSLTIPSLRKKVR--RTVTNVGPVNSKYEAIIEPP  706

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + VKP TL F+ + KKISF +TIST H + T +YFGSL W DG+H VR P SV+ +
Sbjct  707  LGITIKVKPETLIFNSSTKKISFTITISTSHKYTTYYYFGSLTWTDGMHRVRSPTSVRNE  766

Query  33   Y*E  25
            + E
Sbjct  767  FPE  769



>ref|XP_010437012.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=666

 Score =   274 bits (700),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 178/243 (73%), Gaps = 4/243 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA    + +V    Y   SGTSMATP +AG+V LLKA HPDWSPA IKSAIVTTAW 
Sbjct  421  NILAA-TSLNSSVSDGGYAMTSGTSMATPVIAGVVVLLKALHPDWSPAAIKSAIVTTAWR  479

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG++NP++A +PGL+YD++T DYV  LC+  Y+ 
Sbjct  480  TD-PSGEPIFADGSS-RKLADPFDYGGGLVNPDKAARPGLIYDINTNDYVLYLCSTDYND  537

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKV++ PP
Sbjct  538  TSISQVVGKKTECPNPKPSVLDLNLPSITIPNLKDKVTLTRTVTNVGPPNSIYKVVINPP  597

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ + VKP+ L F+P  KK+SF VT+ST H  NTG+YFGSL W D V  V IP+SV+T+
Sbjct  598  TGVRMTVKPNILRFNPRTKKVSFTVTVSTTHKVNTGYYFGSLTWTDNVRRVVIPVSVRTQ  657

Query  33   Y*E  25
              E
Sbjct  658  ILE  660



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score =   275 bits (702),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 141/243 (58%), Positives = 178/243 (73%), Gaps = 4/243 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA    + ++    +   SGTSMATP +AG+V LLKA HPDWSPA IKSAIVTTAW 
Sbjct  517  NILAA-TSLNSSISDGGFAMTSGTSMATPIIAGVVVLLKALHPDWSPAAIKSAIVTTAWK  575

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++NP++A +PGL+YD++T DYV  LC+  Y+ 
Sbjct  576  TD-PSGEPIFADGSG-RKLADPFDYGGGLVNPDKAARPGLIYDINTNDYVLYLCSTDYND  633

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKV++ PP
Sbjct  634  TSISQVVGKKTECPNPKPSVLDLNLPSITIPNLKDKVTLTRTVTNVGPPNSIYKVLINPP  693

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ + VKP+ L F+P  KK+SF VT+ST H  NTG+YFGSL W D VH V IP+SV+T+
Sbjct  694  SGVRMTVKPNMLRFNPRTKKVSFTVTVSTTHKVNTGYYFGSLTWTDNVHRVVIPVSVRTQ  753

Query  33   Y*E  25
              E
Sbjct  754  ILE  756



>emb|CBI23066.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   273 bits (697),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 173/244 (71%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             IL A  PSD   + + + F SGTSMATPH+AGIVALLK+ HP WSPA IKSAIVTT WT
Sbjct  454  QILGAVPPSD-LKKNTEFAFHSGTSMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWT  512

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF EG+  +KLAD FD+GGGI+NPNRA  PGLVYDM T DY++ LC +GY++
Sbjct  513  TD-PSGEPIFAEGDP-TKLADPFDFGGGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNN  570

Query  390  KAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AI     Q+  C  G  SILD+N PSITIP L+   +LTR VTNVG  NSTYK  +  P
Sbjct  571  SAIFQFTEQSIRCPTGEHSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISP  630

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + VKP TL F   +K ++F+VT+S+ H  NTG+ FGSL W DGVH VR PISV+T 
Sbjct  631  AGITITVKPDTLIFDSTIKTVTFSVTVSSIHQVNTGYSFGSLTWIDGVHAVRSPISVRTM  690

Query  33   Y*ES  22
              ES
Sbjct  691  IEES  694



>ref|XP_010437005.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=762

 Score =   274 bits (700),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 142/243 (58%), Positives = 178/243 (73%), Gaps = 4/243 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA    + +V    Y   SGTSMATP +AG+V LLKA HPDWSPA IKSAIVTTAW 
Sbjct  517  NILAA-TSLNSSVSDGGYAMTSGTSMATPVIAGVVVLLKALHPDWSPAAIKSAIVTTAWR  575

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG++NP++A +PGL+YD++T DYV  LC+  Y+ 
Sbjct  576  TD-PSGEPIFADGSS-RKLADPFDYGGGLVNPDKAARPGLIYDINTNDYVLYLCSTDYND  633

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKV++ PP
Sbjct  634  TSISQVVGKKTECPNPKPSVLDLNLPSITIPNLKDKVTLTRTVTNVGPPNSIYKVVINPP  693

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ + VKP+ L F+P  KK+SF VT+ST H  NTG+YFGSL W D V  V IP+SV+T+
Sbjct  694  TGVRMTVKPNILRFNPRTKKVSFTVTVSTTHKVNTGYYFGSLTWTDNVRRVVIPVSVRTQ  753

Query  33   Y*E  25
              E
Sbjct  754  ILE  756



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score =   274 bits (700),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 175/241 (73%), Gaps = 4/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P   + +   Y  +SGTSMATPHV+GIVALLKA HPDWSPA IKS+IVTTAW 
Sbjct  528  NILAATSPLRRS-QEGGYTMLSGTSMATPHVSGIVALLKAVHPDWSPAAIKSSIVTTAWR  586

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG    KLAD FDYGGGI+NPN A  PGLVYDM T DY+N LCAM Y++
Sbjct  587  -NNPSGFPIFAEGSP-QKLADTFDYGGGIVNPNGAAYPGLVYDMGTEDYINYLCAMNYNN  644

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G  T C  +  SIL++N PSITIP+L+  ITLTRTVTNVG  NS Y+VM+EPP
Sbjct  645  TAISRLTGNLTVCPIEEPSILNINLPSITIPNLRNSITLTRTVTNVGASNSIYRVMIEPP  704

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G  V VKP+ L F+   KKI+F VT++T H  NT + FGSL W DGVH VR P+SV+T+
Sbjct  705  FGTSVSVKPNVLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGVHIVRSPLSVRTE  764

Query  33   Y  31
            +
Sbjct  765  F  765



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score =   273 bits (699),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 147/243 (60%), Positives = 174/243 (72%), Gaps = 8/243 (3%)
 Frame = -2

Query  750  NILAAYIPSDPAVRIST--YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTA  577
            NILAA   + P  R     Y  +SGTSMATPHV+GIVALLKA HPDWSPA IKS+IVTTA
Sbjct  528  NILAA---TSPLRRFQEGGYTMLSGTSMATPHVSGIVALLKAVHPDWSPAAIKSSIVTTA  584

Query  576  WTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGY  397
            W  +  SG PIF EG    KLAD FDYGGGI+NPN A  PGLVYDM T DY+N LCAM Y
Sbjct  585  WR-NNPSGFPIFAEGSP-QKLADTFDYGGGIVNPNSAAYPGLVYDMGTEDYINYLCAMNY  642

Query  396  SSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVE  220
            ++ AIS + G  T C  +  SIL++N PSITIP+L+  ITLTRTVTNVG  NS Y+VM+E
Sbjct  643  NNTAISRLTGNLTVCPIEEPSILNINLPSITIPNLRNSITLTRTVTNVGASNSIYRVMIE  702

Query  219  PPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            PP G  V VKP+ L F+   KKI+F VT++T H  NT + FGSL W DG H VR P+SV+
Sbjct  703  PPFGTSVSVKPNVLVFNHKTKKITFTVTVTTAHQVNTEYSFGSLTWTDGEHKVRSPLSVR  762

Query  39   TKY  31
            T++
Sbjct  763  TEF  765



>ref|XP_010542106.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=712

 Score =   272 bits (695),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 140/243 (58%), Positives = 177/243 (73%), Gaps = 4/243 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D  +    +N +SGTSMATP V+ IVALL+ +HPDWSPA I+SAIVTTAW 
Sbjct  467  NILAATSPND-VLGDGRFNMMSGTSMATPVVSAIVALLRPSHPDWSPAAIRSAIVTTAWK  525

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++NP +A  PGL+YDM T+DYV+ +C++GY+ 
Sbjct  526  TD-PSGEPIFADGSN-RKLADPFDYGGGLVNPEKAADPGLIYDMGTSDYVHYMCSVGYND  583

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS I    T C +   SILD+N PSITIPDL+  +TLTRTVTNVGP +S YKV+VEPP
Sbjct  584  SSISQIVKNATVCPNPRPSILDLNLPSITIPDLRNEVTLTRTVTNVGPVDSVYKVVVEPP  643

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P  + F+   K++SF V +ST H  N+GFYFGSL W +  HNV IP+SV+T+
Sbjct  644  LGVSVTVTPDMIVFNSTTKRVSFTVRVSTGHKVNSGFYFGSLTWTESAHNVTIPLSVRTQ  703

Query  33   Y*E  25
              E
Sbjct  704  ILE  706



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   273 bits (698),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 173/244 (71%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             IL A  PSD   + + + F SGTSMATPH+AGIVALLK+ HP WSPA IKSAIVTT WT
Sbjct  531  QILGAVPPSD-LKKNTEFAFHSGTSMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWT  589

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF EG+  +KLAD FD+GGGI+NPNRA  PGLVYDM T DY++ LC +GY++
Sbjct  590  TD-PSGEPIFAEGDP-TKLADPFDFGGGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNN  647

Query  390  KAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AI     Q+  C  G  SILD+N PSITIP L+   +LTR VTNVG  NSTYK  +  P
Sbjct  648  SAIFQFTEQSIRCPTGEHSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISP  707

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + VKP TL F   +K ++F+VT+S+ H  NTG+ FGSL W DGVH VR PISV+T 
Sbjct  708  AGITITVKPDTLIFDSTIKTVTFSVTVSSIHQVNTGYSFGSLTWIDGVHAVRSPISVRTM  767

Query  33   Y*ES  22
              ES
Sbjct  768  IEES  771



>ref|XP_008392653.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=499

 Score =   266 bits (679),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 138/241 (57%), Positives = 172/241 (71%), Gaps = 4/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P    V    Y  +SGTSM+TPHV GIVAL+K  HP+WSPA IKSA+VTTAW 
Sbjct  251  NILAATSPLYSFVE-GGYAMMSGTSMSTPHVTGIVALIKRMHPNWSPAAIKSALVTTAWR  309

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG    KLA++FD+GGG++NPN A +PGLVYDM   DY+  LCA  Y++
Sbjct  310  -NGPSGLPIFAEGSP-QKLANSFDFGGGLVNPNGAAEPGLVYDMGAADYMEYLCARAYNN  367

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G+ T+C  K  SILDVN PS+TIP L+ P+T+ RTVTNVG   S YK  +EPP
Sbjct  368  SAISRLTGKKTTCPVKKPSILDVNLPSVTIPSLRNPVTVKRTVTNVGAPESIYKATIEPP  427

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G IV V P+ L F+  V+K++F +TIS  H  NTG+YFGSL W DGVH VRIP+SV+T+
Sbjct  428  FGTIVYVNPTALVFNSTVEKLTFTITISAIHEMNTGYYFGSLTWVDGVHAVRIPLSVRTE  487

Query  33   Y  31
            +
Sbjct  488  F  488



>ref|XP_007210725.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
 gb|EMJ11924.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
Length=783

 Score =   272 bits (696),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 142/240 (59%), Positives = 174/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILA   P D +     +   SGTSMATPHV+GIVALLKA H +WSPA I+SA+VTTAW 
Sbjct  538  SILAGSSPYD-SFMDGGFALHSGTSMATPHVSGIVALLKALHSNWSPAAIRSALVTTAWK  596

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GEPIF EG    K+A+ FDYGGG++NPN+A  PGL+YDM T DY+  LCA+GY++
Sbjct  597  TD-PFGEPIFAEGSP-QKVANPFDYGGGLVNPNKAADPGLIYDMGTEDYIKYLCAVGYNT  654

Query  390  KAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQTT+C     S+LDVN PSITIP+L+  ITLTR+VTNVGP NS YK  ++PP
Sbjct  655  SAISQLVGQTTACSMVKPSVLDVNLPSITIPNLRENITLTRSVTNVGPVNSVYKANIDPP  714

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI V V+P TL F+  +K ISF V +ST H  NTG+YFGSL W DG H V  PISV+T+
Sbjct  715  PGISVAVRPETLVFNSTIKTISFTVAVSTTHQVNTGYYFGSLTWTDGEHLVTSPISVRTQ  774



>ref|XP_002298974.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
 gb|EEE83779.2| hypothetical protein POPTR_0001s45470g [Populus trichocarpa]
Length=749

 Score =   271 bits (694),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 145/240 (60%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D   +   Y   SGTSMA PHVAGI ALLKA HPDWSPA IKSA+VTTAWT
Sbjct  504  NILAAASPLD-TFQDGGYVMQSGTSMAAPHVAGIGALLKAIHPDWSPAAIKSALVTTAWT  562

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF+EG    KLA+ FD+GGGI NPN A  PGLVYDM T DY+N LCAM Y+ 
Sbjct  563  -NHPSGFPIFSEGSP-QKLANPFDFGGGIANPNGAADPGLVYDMGTADYINYLCAMDYNI  620

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G  T C ++  SILDVN PSITIP+L+   TLTRTVTNVG  NS Y+ ++EPP
Sbjct  621  TAISRLTGLPTVCPYEELSILDVNLPSITIPNLRNSTTLTRTVTNVGTSNSIYRAVIEPP  680

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G  V VKP+ L F+   KKI+F VT++T H  NTG++FGS+ W DGVH VR P+SV+T+
Sbjct  681  FGTSVSVKPNVLAFNHKTKKITFTVTVTTAHQVNTGYFFGSITWTDGVHTVRSPLSVRTE  740



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score =   271 bits (693),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/222 (61%), Positives = 167/222 (75%), Gaps = 3/222 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            +  +SGTSMATPH+AGIVALL+A HPDWSPA ++SA+ TTAWT+D   G P+F EG+   
Sbjct  552  FTMMSGTSMATPHIAGIVALLRALHPDWSPAGLRSALTTTAWTSD-PYGTPMFAEGDP-H  609

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKG  343
            KLAD FDYGGGI NPN A  PGL+YDM TTDY+N LCAM Y+S AIS + GQ   C +K 
Sbjct  610  KLADPFDYGGGIANPNGASCPGLIYDMDTTDYINYLCAMEYNSSAISRLTGQPIMCPNKT  669

Query  342  FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
            F ILDVN PSITIP L+    L+RTVTNVGP NS Y+V+VEPP G +V V P  L F+ +
Sbjct  670  FPILDVNLPSITIPYLRNSTVLSRTVTNVGPTNSIYRVVVEPPTGTLVFVTPPILIFNSH  729

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            +KKI++ VT+ + H    G+YFGSLIW DGVH+VR PI+V++
Sbjct  730  IKKITYQVTVISVHPLIGGYYFGSLIWTDGVHDVRSPIAVRS  771



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D       ++ ++GTSMA P ++G+VALLKA HPDWSPA IKSAIVTTAW 
Sbjct  529  SILAATSP-DSNSSAGGFDILAGTSMAAPVISGVVALLKAMHPDWSPAAIKSAIVTTAWR  587

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGG++NP +A  PGL+YDM   DY+  LC+ GY+ 
Sbjct  588  TD-PFGEQIFAEGSS-RKVADPFDYGGGLVNPEKAADPGLIYDMGPKDYILYLCSAGYND  645

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + GQ T C +   S+LDVN PS+TIP+LK  + LTRTVTNVGP NS YKV+VEPP
Sbjct  646  SSISQLVGQVTVCSNPKPSVLDVNLPSLTIPNLKEEVNLTRTVTNVGPVNSVYKVVVEPP  705

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ VVV P  L F+   K +SF V +ST H  NTGFYFGSLIW D VHNV IP+SV+T+
Sbjct  706  LGVRVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGFYFGSLIWRDSVHNVTIPVSVRTQ  765



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score =   271 bits (692),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 177/239 (74%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            ILAA  P +  + +  +  +SGTSM+TP ++G++ALLK+ HPDWSPA  +SAIVTTAW T
Sbjct  526  ILAATSP-NSTMSVGGFGILSGTSMSTPAISGVIALLKSLHPDWSPAAFRSAIVTTAWRT  584

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D   GE IF +G +  K+AD FDYGGG++NP +A +PGL+YDM + DY+  LC+ GY+  
Sbjct  585  D-PFGEQIFAKGSS-GKVADPFDYGGGLVNPEKAAEPGLIYDMGSEDYILYLCSAGYNDS  642

Query  387  AISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            +IS + G+ T C +   S+LDVN PSITIP+LK  + LTRTVTNVGP +S YKV+VEPP 
Sbjct  643  SISQLVGKVTVCSNPKPSVLDVNLPSITIPNLKDEVNLTRTVTNVGPVDSIYKVVVEPPL  702

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+IVVVKP TL F+   K++SF V +ST H  NTGFYFGSL W D VHNV IP+SV+T+
Sbjct  703  GVIVVVKPETLVFNSKFKRVSFTVRVSTTHKTNTGFYFGSLTWTDSVHNVIIPVSVRTQ  761



>ref|XP_002872522.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48781.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score =   269 bits (688),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 177/240 (74%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P + ++    +  +SGTSMATP V+G+V LLK+ HPDWSP+ IKSAIVTTAW 
Sbjct  492  NILAAISP-NSSINDGGFAMMSGTSMATPVVSGVVVLLKSLHPDWSPSAIKSAIVTTAWR  550

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG+INP +A KPGL+YDM+T DYV  +C++ YS 
Sbjct  551  TD-PSGEPIFADGSS-RKLADPFDYGGGLINPEKAVKPGLIYDMTTDDYVMYMCSVDYSD  608

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+TT C +   S+LD+N PSITIP+L+  +TLTRTVTNVGP NS YKV+++PP
Sbjct  609  ISISRVLGKTTVCPNPKPSVLDLNLPSITIPNLRGEVTLTRTVTNVGPVNSVYKVVIDPP  668

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P+ L F     K SF V +ST H  NTG+YFGSL W D +HNV IP+SV+T+
Sbjct  669  TGVNVAVTPTELVFDSTTTKRSFTVRVSTTHKVNTGYYFGSLTWTDNLHNVAIPVSVRTQ  728



>gb|KJB74658.1| hypothetical protein B456_012G000900 [Gossypium raimondii]
Length=778

 Score =   270 bits (689),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 148/244 (61%), Positives = 172/244 (70%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             ILAA  P D       + F+SGTSMATPHV+GIVALLK+ +PDWSPA IKSAI+TT  T
Sbjct  536  QILAAIPPFDETT-TGAFAFLSGTSMATPHVSGIVALLKSLYPDWSPAAIKSAIITTGLT  594

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            + +S G PIF EGE   KLAD FD+GGGI+NPN A  PGLVYDM+T +YV+ LCAMGY++
Sbjct  595  SHQSGG-PIFAEGEP-PKLADPFDFGGGIVNPNSAADPGLVYDMNTENYVHYLCAMGYNN  652

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              I  +      C  K  SILDVN PSITIP+LK+P  LTRTVTNVGP NS YK  VE  
Sbjct  653  SDIFQLTEHPVVCPSKQPSILDVNLPSITIPNLKKPTILTRTVTNVGPVNSKYKASVEFA  712

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI V V+P TL FS   K ISF+V IS+ H  N G+YFGSL W DGVH VR PISV+T+
Sbjct  713  SGINVAVRPETLIFSSRTKAISFSVMISSAHNVNAGYYFGSLTWTDGVHVVRSPISVRTE  772

Query  33   Y*ES  22
              ES
Sbjct  773  VGES  776



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   270 bits (689),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 171/239 (72%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            ILAA  P+D  + +  +  +SGTSMATP ++G++ALLKA HPDWSPA  +SAIVTTAW T
Sbjct  530  ILAATSPND-TLNVGGFAMLSGTSMATPVISGVIALLKALHPDWSPAAFRSAIVTTAWRT  588

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D   GE IF EG +  K+AD FDYGGG++NP +A +PGL+YDM   DY+  LC+  Y+  
Sbjct  589  D-PFGEQIFAEGSS-RKVADPFDYGGGLVNPEKAAEPGLIYDMGPQDYILYLCSADYNES  646

Query  387  AISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            +IS + GQ T C +   S+LDVN PSITIP+LK  +T  RTVTNVGP NS YKV VEPP 
Sbjct  647  SISQLVGQVTVCSNPKPSVLDVNLPSITIPNLKDEVTDARTVTNVGPSNSVYKVAVEPPL  706

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ VVV P TL F+   K +SF V +ST H  NTGFYFGSL W D VHNV IP+SV+T+
Sbjct  707  GVRVVVTPETLVFNSKTKSVSFTVLVSTTHKINTGFYFGSLTWTDSVHNVVIPLSVRTQ  765



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   270 bits (689),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 174/244 (71%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             IL A +PSD   + + + F SGTSMATPH+AGIVALLK+ HP WSPA IKSAIVTT WT
Sbjct  531  QILGAVLPSD-LKKNTEFAFHSGTSMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWT  589

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF EG+  +KLAD FD+GGGI+NPNRA  PGLVYDM T DY++ LC +GY++
Sbjct  590  TD-PSGEPIFAEGDP-TKLADPFDFGGGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNN  647

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AI     Q+  C  +  SILD+N PSITIP L+   +LTR VTNVG  NSTYK  +  P
Sbjct  648  SAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISP  707

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + VKP TL F+  +K ++F+VT+S+ H  NT + FGSL W DGVH V+ PISV+T 
Sbjct  708  AGITITVKPDTLIFNSTIKTVTFSVTVSSIHQVNTEYSFGSLTWVDGVHAVKSPISVRTM  767

Query  33   Y*ES  22
              ES
Sbjct  768  IEES  771



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score =   269 bits (688),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 143/239 (60%), Positives = 172/239 (72%), Gaps = 4/239 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P DP    + Y   SGTSM+ PH++GIVALLKA HPDWSPA IKSA+VTTAW 
Sbjct  533  NILAATSPLDP-FEDNGYTMHSGTSMSAPHISGIVALLKALHPDWSPAAIKSALVTTAWR  591

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG +  KLA+ FD GGGI NPN A  PGLVYDM T DYV+ LCAMGY+ 
Sbjct  592  -NHPSGYPIFAEGSS-QKLANPFDIGGGIANPNGAANPGLVYDMGTPDYVHYLCAMGYNH  649

Query  390  KAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQ   C K   SILD+N PSITIP+L++ +TLTRTVTNVG  NS Y+V++EPP
Sbjct  650  TAISSLTGQPVVCPKNETSILDINLPSITIPNLRKSVTLTRTVTNVGALNSIYRVVIEPP  709

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             G  + VKP +L FS   KKI+F VT++  +  NTG+YFGSL W +GVH V  P+SV+T
Sbjct  710  FGTYISVKPDSLVFSRKTKKITFTVTVTAANQVNTGYYFGSLSWTNGVHTVASPMSVRT  768



>ref|XP_006397048.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
 gb|ESQ38501.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
Length=764

 Score =   269 bits (687),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 178/240 (74%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA   +D +  +  ++  SGTSMATP V+G+V LLK+ HP WSP+ IKSAIVTTAW 
Sbjct  519  NILAATSLNDSS-SVRGFSMKSGTSMATPVVSGVVVLLKSLHPHWSPSAIKSAIVTTAWK  577

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG++NP +A KPGLVYDM+T DY+  LCA  YS 
Sbjct  578  TD-PSGEPIFADGSS-RKLADPFDYGGGLVNPEKAAKPGLVYDMTTHDYILYLCAADYSD  635

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS +AG+ T C +   S+LD+N PSITIP+L+  +TLTRTVTNVGP NS YKV+++PP
Sbjct  636  ISISRVAGKATVCPNPKPSVLDLNLPSITIPNLRDEVTLTRTVTNVGPVNSVYKVVIDPP  695

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V+V P+ L F+    K+SF V +ST H  NTG++FGSL W D +HNV IP+SV+T+
Sbjct  696  MGVNVIVTPTKLVFNSTATKLSFTVKVSTTHKVNTGYFFGSLTWTDNLHNVAIPVSVRTQ  755



>ref|XP_011081356.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Sesamum 
indicum]
Length=782

 Score =   269 bits (688),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 163/221 (74%), Gaps = 2/221 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            +  +SGTSMATPH+AGIVALL+A H DWSPA I+SA+ TTAW +D   G PIF EG+   
Sbjct  554  FTMLSGTSMATPHIAGIVALLRALHADWSPAAIRSALTTTAWMSD-PYGVPIFAEGDP-H  611

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FD+GGGI NPN A  PGLVYDM  +DY+N LC+M Y++ AIS + G+  +C K  
Sbjct  612  KLADPFDFGGGIANPNGAACPGLVYDMDESDYINYLCSMEYNNSAISRLTGKPVTCPKTV  671

Query  339  SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNV  160
            S+LDVN PSITIP L    TLTRTVTNVG  NS Y V+VEPP G IV+V P  L F+   
Sbjct  672  SLLDVNLPSITIPYLGNSTTLTRTVTNVGATNSIYHVIVEPPTGTIVLVNPPILIFNSMT  731

Query  159  KKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            KKISF VT+S+ H  + G+YFGSLIW DGVH+VR PISV+T
Sbjct  732  KKISFTVTVSSMHQLSAGYYFGSLIWTDGVHDVRSPISVRT  772



>ref|XP_009348701.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease Glyma18g48580 
[Pyrus x bretschneideri]
Length=298

 Score =   256 bits (654),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 132/231 (57%), Positives = 167/231 (72%), Gaps = 4/231 (2%)
 Frame = -2

Query  723  DPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPI  544
            DPA+    +  +SGTSMATPH+AG VALLK+  PDWS A +KSA+VTTAW TD   GEPI
Sbjct  62   DPAMD-GGFALLSGTSMATPHIAGHVALLKSLQPDWSLAAMKSALVTTAWKTD-PFGEPI  119

Query  543  FNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQ  364
            F EG    KLAD FDYG G++NPN+A  PGL+Y+M   DY+N LCA GY++ AIS++  Q
Sbjct  120  FAEGAA-QKLADLFDYGEGLVNPNKAANPGLIYNMDINDYINYLCAFGYNTSAISLLVKQ  178

Query  363  TTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKP  187
             TSC     SILDVN PSITIP+L+ P+T TR+VTNVG  NSTYK  ++P  G  V+V+P
Sbjct  179  ATSCPVPKPSILDVNLPSITIPNLRNPLTPTRSVTNVGHGNSTYKAXIDPSPGTNVLVRP  238

Query  186  STLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             TL F+  VK IS++V +ST +  NT ++FGSL W DGV+ V  PISV+T+
Sbjct  239  ETLVFNSTVKTISYSVAVSTTYRVNTAYFFGSLTWTDGVYAVTSPISVRTQ  289



>gb|KFK28745.1| hypothetical protein AALP_AA7G041500 [Arabis alpina]
Length=764

 Score =   268 bits (686),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 174/241 (72%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP      +  +SGTSMATP V+GI+ALLK+ HP WSPA I+SA+VTTAW 
Sbjct  522  SILAALSPLDPEEH-DGFGLVSGTSMATPVVSGIIALLKSLHPKWSPAAIRSALVTTAWR  580

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    K+AD FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+ 
Sbjct  581  TS-PSGEPIFAEGSN-KKIADPFDYGGGLVNPEKAAKPGLVYDMGIEDYINYMCSAGYND  638

Query  390  KAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     SILD+N PSITIP+L++ +TLTRTVTNVGP  S YK ++E P
Sbjct  639  SSISRVVGKKTKCQTPKPSILDINLPSITIPNLEQEVTLTRTVTNVGPIKSVYKAVIESP  698

Query  213  KGIIVVVKPSTLNFSPNVKK-ISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+ L FS + K+ ++F+V   T H  NTG++FGSL W DGVH+V+IP+SVKT
Sbjct  699  LGITLTVNPTILVFSSSAKRLLTFSVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVKT  758

Query  36   K  34
            K
Sbjct  759  K  759



>ref|XP_010529677.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=767

 Score =   268 bits (686),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 172/240 (72%), Gaps = 8/240 (3%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D       +   SGTSMATP V+GIVALL+  HPDWSPA I+SA+VTTAW 
Sbjct  526  NILAATSPDD-----GGFAMKSGTSMATPVVSGIVALLRGLHPDWSPAAIRSALVTTAWK  580

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++NP +A  PGLVYDM T+DY+  +C+ GY+ 
Sbjct  581  TD-PSGEPIFADGSN-RKLADPFDYGGGLVNPEKATDPGLVYDMGTSDYILYMCSAGYAD  638

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ TSC +   SILD+N PSITIP+L+  +TLTRTVTNVGP +S YKV++EPP
Sbjct  639  SSISQLIGKPTSCPNPKPSILDLNLPSITIPNLRDEVTLTRTVTNVGPRDSVYKVVMEPP  698

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P TL F+   K++SF V ++T H  N+GFYFG L W D V  V IP+SV+T+
Sbjct  699  SGVRVDVNPKTLVFNSETKRVSFTVRVTTAHKVNSGFYFGRLTWTDSVREVTIPVSVRTQ  758



>ref|XP_011081355.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Sesamum 
indicum]
Length=805

 Score =   269 bits (687),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 163/221 (74%), Gaps = 2/221 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            +  +SGTSMATPH+AGIVALL+A H DWSPA I+SA+ TTAW +D   G PIF EG+   
Sbjct  577  FTMLSGTSMATPHIAGIVALLRALHADWSPAAIRSALTTTAWMSD-PYGVPIFAEGDP-H  634

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FD+GGGI NPN A  PGLVYDM  +DY+N LC+M Y++ AIS + G+  +C K  
Sbjct  635  KLADPFDFGGGIANPNGAACPGLVYDMDESDYINYLCSMEYNNSAISRLTGKPVTCPKTV  694

Query  339  SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNV  160
            S+LDVN PSITIP L    TLTRTVTNVG  NS Y V+VEPP G IV+V P  L F+   
Sbjct  695  SLLDVNLPSITIPYLGNSTTLTRTVTNVGATNSIYHVIVEPPTGTIVLVNPPILIFNSMT  754

Query  159  KKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            KKISF VT+S+ H  + G+YFGSLIW DGVH+VR PISV+T
Sbjct  755  KKISFTVTVSSMHQLSAGYYFGSLIWTDGVHDVRSPISVRT  795



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 174/244 (71%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             IL A +PSD   + + + F SGTSMATPH+AGIVALLK+ HP WSPA IKSAIVTT WT
Sbjct  597  QILGAVLPSD-LKKNTEFAFHSGTSMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWT  655

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF EG+  +KLAD FD+GGGI+NPNRA  PGLVYDM T DY++ LC +GY++
Sbjct  656  TD-PSGEPIFAEGDP-TKLADPFDFGGGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNN  713

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AI     Q+  C  +  SILD+N PSITIP L+   +LTR VTNVG  NSTYK  +  P
Sbjct  714  SAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISP  773

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + VKP TL F+  +K ++F+VT+S+ H  NT + FGSL W DGVH V+ PISV+T 
Sbjct  774  AGITITVKPDTLIFNSTIKTVTFSVTVSSIHQVNTEYSFGSLTWVDGVHAVKSPISVRTM  833

Query  33   Y*ES  22
              ES
Sbjct  834  IEES  837



>ref|XP_009344070.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=699

 Score =   266 bits (680),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 171/241 (71%), Gaps = 4/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P         Y  +SGTSM+TPHV GIVAL+K  HP+WSPA IKSA+VTTAW 
Sbjct  453  NILAATSPLYSFAE-GGYAMMSGTSMSTPHVTGIVALIKRMHPNWSPAAIKSALVTTAWR  511

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG    KLA++FD+GGG++NPN A  PGLVYDM   DY+  LCA GY++
Sbjct  512  -NGPSGLPIFAEGSP-QKLANSFDFGGGLVNPNGAADPGLVYDMGAADYMEYLCARGYNN  569

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G+ T+C  K  SILDVN PS+TIP L+ PIT+ RTVTNVG   S YK  +EPP
Sbjct  570  SAISRLTGKNTTCPVKKPSILDVNLPSVTIPSLRNPITVKRTVTNVGAPESIYKATIEPP  629

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G IV V P+ L F+  V+K++F +TIS  H  NTG+YFGSL W DGVH VRIP+SVKT+
Sbjct  630  FGTIVYVNPTALVFNSTVEKLTFTITISAIHEMNTGYYFGSLTWVDGVHAVRIPLSVKTE  689

Query  33   Y  31
            +
Sbjct  690  F  690



>ref|NP_567359.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03440.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=48.3, E=2.3e-12, n=4) [Arabidopsis thaliana]
 emb|CAB40045.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78175.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82893.1| Subtilase family protein [Arabidopsis thaliana]
Length=756

 Score =   267 bits (682),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 176/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+  ++    +  +SGTSMATP V+G+V LLK+ HPDWSP+ IKSAIVTTAW 
Sbjct  511  NILAAISPNS-SINDGGFAMMSGTSMATPVVSGVVVLLKSLHPDWSPSAIKSAIVTTAWR  569

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG+INP +A KPGL+YDM+T DYV  +C++ YS 
Sbjct  570  TD-PSGEPIFADGSS-RKLADPFDYGGGLINPEKAVKPGLIYDMTTDDYVMYMCSVDYSD  627

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+L+  +TLTRTVTNVGP NS YKV+++PP
Sbjct  628  ISISRVLGKITVCPNPKPSVLDLNLPSITIPNLRGEVTLTRTVTNVGPVNSVYKVVIDPP  687

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI V V P+ L F     K SF V +ST H  NTG+YFGSL W D +HNV IP+SV+T+
Sbjct  688  TGINVAVTPAELVFDYTTTKRSFTVRVSTTHKVNTGYYFGSLTWTDNMHNVAIPVSVRTQ  747



>ref|XP_010436465.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=629

 Score =   264 bits (675),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 163/218 (75%), Gaps = 3/218 (1%)
 Frame = -2

Query  684  GTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLADA  505
            GTS ATP V+G+V LLKA HPDWSPA +KSAI+T+AW TD  SG+PIF EG+   KLAD 
Sbjct  410  GTSFATPVVSGLVVLLKALHPDWSPAALKSAIMTSAWKTD-PSGDPIFAEGQP-RKLADP  467

Query  504  FDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILD  328
            FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI+I+ G+ T C     SILD
Sbjct  468  FDYGAGLVNMERAKDPGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILD  527

Query  327  VNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKIS  148
             N+P+ITIPDL+  +TLTRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL FS N KK+ 
Sbjct  528  FNYPAITIPDLEEEVTLTRTVTNVGPVDSVYRAVVEPPQGVKIVVEPETLVFSSNTKKLG  587

Query  147  FNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            F V +S+ H  NTG++FGS  W DG  NV IP+SV+T+
Sbjct  588  FKVRVSSSHKSNTGYFFGSFTWTDGTRNVTIPLSVRTR  625



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   267 bits (683),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 171/244 (70%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             IL A  PSD   + + + F SGTSMATPH+AGIVALLK+ HP WSPA IKSAIVTT WT
Sbjct  531  QILGAVPPSD-LKKNTEFAFHSGTSMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWT  589

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF EG+  +KLAD FD+GGGI+NPNRA  PGLVYDM T DY++ LC +GY++
Sbjct  590  TD-PSGEPIFAEGDP-TKLADPFDFGGGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNN  647

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AI     Q+  C  +  SILD+N PSITIP L+   +LTR VTNVG  NSTYK  +  P
Sbjct  648  SAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISP  707

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G  + VKP TL F   +K ++F+VT+S+    NTG+ FGSL W DGVH VR PISV+T 
Sbjct  708  AGTTITVKPDTLIFDSTIKTVTFSVTVSSIQQVNTGYSFGSLTWIDGVHAVRSPISVRTM  767

Query  33   Y*ES  22
              ES
Sbjct  768  IKES  771



>ref|XP_002867837.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44096.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score =   265 bits (676),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 175/241 (73%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP    + +   SGTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTTAW 
Sbjct  427  SILAAVSPLDPDA-YNGFGLHSGTSMSTPVVSGIIALLKSLHPNWSPAAMRSALVTTAWR  485

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+ 
Sbjct  486  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIDDYINYMCSAGYND  543

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C   G SILD+N PSITIP+L++ +TLTRTVTNVGP  S YK ++EPP
Sbjct  544  SSISRVLGKKTNCPIPGPSILDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIEPP  603

Query  213  KGIIVVVKPSTLNFSPNVKK-ISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL F    K+ ++F+V   T H  N G++FGSL W DGVH+V IP+SVKT
Sbjct  604  LGITLTVNPTTLVFKSAAKRVVTFSVKAKTSHKVNGGYFFGSLTWTDGVHDVTIPVSVKT  663

Query  36   K  34
            +
Sbjct  664  E  664



>emb|CDX79081.1| BnaA01g11480D [Brassica napus]
Length=751

 Score =   266 bits (680),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P +P    + +  +SGTSM+TP V+GI ALLK  HPDWSPA I+SA+VTTAW 
Sbjct  511  NILAALTPLNPDSH-NGFGLLSGTSMSTPVVSGITALLKCLHPDWSPAAIRSALVTTAWR  569

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T +S GEPIF EG    KLAD FDYGGG++NP  A  PGLVYDM   DY++ +C+ GY+ 
Sbjct  570  TSKS-GEPIFAEGSN-KKLADPFDYGGGLVNPESAADPGLVYDMGIKDYISYMCSAGYND  627

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C   G SILD+N PSITIP+L + +TLTRT+TNVGP NS YK +++ P
Sbjct  628  TSISRVLGKKTNCPSPGASILDINLPSITIPNLDQEVTLTRTLTNVGPNNSVYKAVIKSP  687

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + V P+TL F    + +S+ VT  T H  NTG++FGSL W DGVH+VRIP+SV+TK
Sbjct  688  LGITLTVSPTTLVFGSG-EVLSYAVTAKTSHKVNTGYFFGSLTWTDGVHDVRIPVSVQTK  746



>emb|CDX82843.1| BnaC01g12930D [Brassica napus]
Length=766

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/239 (56%), Positives = 171/239 (72%), Gaps = 5/239 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P DP      +  +SGTSM+TP V+GI ALLK  HPDWSPA I+SA+VTTAW 
Sbjct  526  NILAALSPLDPDSH-KGFGLLSGTSMSTPVVSGITALLKCLHPDWSPAAIRSALVTTAWR  584

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T +S GEPIF EG    KLAD FDYGGG++NP  A  PGLVYDM   DY++ +C+ GY+ 
Sbjct  585  TSKS-GEPIFAEGSN-KKLADPFDYGGGLVNPESAADPGLVYDMGIKDYISYMCSAGYND  642

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C   G SILD+N PSITIP+L + +TLTRT+TNVGP NS YK ++E P
Sbjct  643  TSISRVLGKKTNCPSPGASILDINVPSITIPNLDQEVTLTRTLTNVGPNNSVYKAVIESP  702

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             G+ + V P+TL F    + +S+ VT  T H  NTG++FGSL W DGVH+VRIP+SV+T
Sbjct  703  LGVTLTVSPTTLVFDSG-EVLSYAVTAKTSHKVNTGYFFGSLTWTDGVHDVRIPVSVQT  760



>ref|XP_011038011.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=781

 Score =   266 bits (679),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 138/244 (57%), Positives = 176/244 (72%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P+ P      ++ +SGTS +TPHV+GIVALLKA  P+WSPA I+SAIVTTAW 
Sbjct  536  SILAASSPAYP-FEAGGFSILSGTSFSTPHVSGIVALLKAIQPNWSPAAIRSAIVTTAWK  594

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            +D   GEPIF+EG T  KLAD FD+GGG++NPN+A +PGLVYDM T DY++ LCA+GY+ 
Sbjct  595  SD-PYGEPIFSEGSTW-KLADPFDFGGGLVNPNKAAEPGLVYDMGTNDYIHYLCAVGYND  652

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS++ G+ T+C     SILDVN PSITIP+L + + LTRTV NVG  NS YK ++ PP
Sbjct  653  SSISLVVGKVTTCPGTKPSILDVNLPSITIPNLSKSVVLTRTVKNVGSVNSMYKSLIVPP  712

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI V V+P TL F+    ++SF VT +T H  NT FYFGSL W DG H V  PISV+T+
Sbjct  713  IGISVSVRPQTLIFNSTTNRVSFKVTFTTTHKVNTRFYFGSLTWTDGFHAVTSPISVRTQ  772

Query  33   Y*ES  22
              +S
Sbjct  773  IIQS  776



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA HPDWSPA I+SAIVTTAW TD   GE I  EG +  KL
Sbjct  534  MLSGTSMAAPVISGVVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIDAEGSS-RKL  591

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-S  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +CA+GY+  +IS + G+ T+C     S
Sbjct  592  ADPFDYGGGLVNPEKAVKPGLVYDLGLQDYVLYMCAVGYNDSSISQLVGERTTCSNPRPS  651

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIPDLK  +TLTRTVTNVGP NS YKV VEPP GI V V P  L F+   K
Sbjct  652  VLDLNLPSITIPDLKEEVTLTRTVTNVGPLNSVYKVKVEPPLGIQVTVVPKKLVFNSKTK  711

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             +S+ V +ST H  NTGFYFGSL W+D VHNV IP+SV+T+
Sbjct  712  TLSYQVRVSTRHKINTGFYFGSLTWSDSVHNVIIPLSVRTQ  752



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 137/240 (57%), Positives = 176/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+  ++    +   +GTSMATP V+G+V LLK+ HP+WSPA IKSAIVTTAW 
Sbjct  517  NILAAVSPNS-SISDGGFAMTTGTSMATPVVSGVVVLLKSLHPNWSPAAIKSAIVTTAWR  575

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG+INP +A +PGL+YDM+  DYV  LC+  Y+ 
Sbjct  576  TD-PSGEPIFADGSS-RKLADPFDYGGGLINPEKAARPGLIYDMTIDDYVLYLCSTDYND  633

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+TT C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKV+++PP
Sbjct  634  TSISQVLGKTTICPNPKPSVLDLNLPSITIPNLKDEVTLTRTVTNVGPPNSIYKVVIDPP  693

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ ++V P  L F+   KK+SF V +ST H  N G+YFGSL W D VHNV IP+SV+T+
Sbjct  694  MGVNMIVTPKWLVFNSMTKKVSFKVRVSTTHKVNNGYYFGSLTWTDKVHNVVIPVSVRTQ  753



>ref|XP_009128706.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X3 [Brassica 
rapa]
Length=643

 Score =   263 bits (671),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 166/221 (75%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA HPDWSPA I+SAIVTTAW TD   GE I  EG +  KL
Sbjct  416  MLSGTSMAAPVISGVVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIDAEGSS-RKL  473

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-S  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T+C     S
Sbjct  474  ADPFDYGGGLVNPEKAVKPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPS  533

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIPDLK  +TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   K
Sbjct  534  VLDLNLPSITIPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTK  593

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+S++V +ST H  NTGFYFGSL W+D VH+V IP+SV+T+
Sbjct  594  KLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVIIPLSVRTQ  634



>ref|XP_010449026.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=471

 Score =   258 bits (660),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 172/241 (71%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D   + + +   SGTSMATP V+GI+ALLK+ HP+WSPA I+SA+VTTAW 
Sbjct  229  SILAASSPLD-LEQHNGFKLDSGTSMATPVVSGIIALLKSLHPNWSPAAIRSALVTTAWR  287

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+ 
Sbjct  288  T-SPSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIKDYINYMCSAGYND  345

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+   C     SILD+N PSITIP+L++ +TL RTVTNVGP  S YK ++E P
Sbjct  346  SSISRVLGKKNKCPTPEPSILDINLPSITIPNLEKEVTLKRTVTNVGPIKSVYKAVIESP  405

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + VKP+TL F+    ++ +F+V   T H  N+G++FGSL W DGVHNV IP+SVKT
Sbjct  406  LGITLTVKPTTLVFNSAANRVLTFSVQAKTSHKVNSGYFFGSLTWTDGVHNVTIPVSVKT  465

Query  36   K  34
            K
Sbjct  466  K  466



>ref|XP_009128710.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=764

 Score =   265 bits (677),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 176/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA   +D +  ++ ++  SGTSMATP V+GIV LLK+ HP WSP+ IKSAIVTTAW 
Sbjct  519  NILAATSLND-SFSVNGFSMKSGTSMATPVVSGIVVLLKSLHPHWSPSAIKSAIVTTAWK  577

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG++NP RA KPGLVYDM+T DYV  LCA  YS 
Sbjct  578  TD-PSGEPIFADGSS-RKLADPFDYGGGLVNPERAAKPGLVYDMATHDYVLYLCAADYSD  635

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     S+LD+N PSITIP+L+  +TLTRTVTNVGP NS YKV++ PP
Sbjct  636  MSISRVLGKATVCPTPKPSVLDLNLPSITIPNLRDEVTLTRTVTNVGPLNSVYKVVINPP  695

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P+T  F+    K+SF V ++T H  NTG++FGSL W+D +HNV IP+SV+T+
Sbjct  696  TGVNVGVTPTTFVFNSTATKLSFTVRVTTTHRVNTGYFFGSLTWSDNMHNVAIPLSVRTQ  755



>ref|XP_009135013.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=751

 Score =   265 bits (677),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 173/239 (72%), Gaps = 5/239 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P +P    + +  +SGTSM+TP V+GI ALLK  HPDWSPA I+SA+VTTAW 
Sbjct  511  NILAALNPLNPDSH-NGFGLLSGTSMSTPVVSGITALLKCLHPDWSPAAIRSALVTTAWR  569

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T +S GEPIF EG +  KLAD FDYGGG++NP  A  PGLVYDM   DY++ +C+ GY+ 
Sbjct  570  TSKS-GEPIFAEGSS-KKLADPFDYGGGLVNPESAADPGLVYDMGIKDYISYMCSAGYND  627

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C   G SILD+N PSITIP+L + +TLTRT+TNVGP NS YK ++E P
Sbjct  628  TSISRVLGKKTNCPSPGASILDINLPSITIPNLDQEVTLTRTLTNVGPNNSVYKAVIESP  687

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             G+ + V P+TL F    + +S+ VT  T H  NTG++FGSL W DGVH+VRIP+SV+T
Sbjct  688  LGVTLTVSPTTLVFGSG-EVLSYAVTAKTSHEVNTGYFFGSLTWTDGVHDVRIPVSVQT  745



>ref|XP_006306827.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
 gb|EOA39725.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
Length=769

 Score =   265 bits (676),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 142/242 (59%), Positives = 174/242 (72%), Gaps = 8/242 (3%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D    +  ++ ++GTSMA P +AG+VALLKA HP+WSPA  +SAIVTTAW 
Sbjct  524  SILAATSP-DSNNSVGGFDILAGTSMAAPVIAGVVALLKALHPNWSPAAFRSAIVTTAWR  582

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  KLAD FDYGGGI+NP +A  PGL+YDM T DY+  LC+ GY+ 
Sbjct  583  TD-PFGEQIFAEGSS-RKLADPFDYGGGIVNPEKAADPGLIYDMGTQDYILYLCSAGYND  640

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C     S+LDVN PSITIP+LK  +TLTRTVTNVG  +S YKV+VEPP
Sbjct  641  SSISQLTGKVTACSNPRPSVLDVNLPSITIPNLKDEVTLTRTVTNVGLADSVYKVVVEPP  700

Query  213  KGIIVVVKPSTLNFSPNVKKIS--FNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
             GI V V P TL F  N KKIS  F V +ST H  NTGFYFGSL+W D +HNV IP+SV+
Sbjct  701  LGIRVAVTPETLVF--NTKKISVPFTVRVSTTHKINTGFYFGSLMWTDSMHNVTIPVSVR  758

Query  39   TK  34
            T+
Sbjct  759  TQ  760



>ref|XP_007039203.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23704.1| Subtilase family protein, putative [Theobroma cacao]
Length=776

 Score =   264 bits (675),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 146/243 (60%), Positives = 167/243 (69%), Gaps = 5/243 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            ILAA  P  P      + F SGTSMATPHV+GIVALLK+ +PDWSPA IKSAIVTTA + 
Sbjct  536  ILAASPPDRPTN--GAFAFRSGTSMATPHVSGIVALLKSLYPDWSPAAIKSAIVTTALSA  593

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D+S G PIF EGE  SKLAD FD+GGGI+NPN A  PGLVYDM+T DY   LCAMGY+  
Sbjct  594  DQSGG-PIFAEGEP-SKLADPFDFGGGIVNPNGAADPGLVYDMNTEDYGQYLCAMGYNDS  651

Query  387  AISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            AI  +      C  K  S+LDVN PSITIP L++P  LTRTVTNVGP NS YK  VE   
Sbjct  652  AIFQLTQHPIVCPSKQPSVLDVNLPSITIPSLRKPTILTRTVTNVGPVNSKYKANVEFAS  711

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTKY  31
            GI + V+P  L FS   K I+F V IS+ H  N G+YFGSL W DG H VR PISV+T+ 
Sbjct  712  GINIAVRPEILIFSSKTKTITFTVMISSAHNVNAGYYFGSLTWTDGGHVVRSPISVRTEV  771

Query  30   *ES  22
             ES
Sbjct  772  GES  774



>gb|KFK45042.1| hypothetical protein AALP_AA1G336600 [Arabis alpina]
Length=741

 Score =   263 bits (673),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P+D       ++  SGTSMA P ++G+V+LLKA HPDWSPA  +SAIVTTAW 
Sbjct  496  SILAATSPND-TFNDRGFSMKSGTSMAAPVISGVVSLLKALHPDWSPAAFRSAIVTTAWR  554

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG    K+ D FDYGGGI+NP +A +PGL+YDM + DY+  LC+ GY+ 
Sbjct  555  TD-PLGEQIFAEGSP-CKVVDPFDYGGGIVNPEKAAEPGLIYDMGSEDYIIYLCSAGYND  612

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LDVN PSITIP+LK  + LTRTVTNVGP +S YKV+VEPP
Sbjct  613  SSISQLVGRVTVCSNPKPSVLDVNLPSITIPNLKDEVNLTRTVTNVGPVDSVYKVVVEPP  672

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P  L F+   K++SF V +ST H  NTGFYFGSLIW D VHNV IP+S++T+
Sbjct  673  LGVRVAVTPEMLMFNSTTKRVSFTVRVSTTHKINTGFYFGSLIWTDSVHNVTIPVSIRTQ  732



>ref|NP_567360.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03437.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=50.7, E=4.7e-13, n=3) [Arabidopsis thaliana]
 emb|CAB40046.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78176.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82894.1| Subtilase family protein [Arabidopsis thaliana]
Length=747

 Score =   264 bits (674),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 133/229 (58%), Positives = 169/229 (74%), Gaps = 3/229 (1%)
 Frame = -2

Query  717  AVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFN  538
            A+    +  +SGTSMATP V+G+V LLK+ HPDWSP+ IKSAIVTTAW TD  SGEPIF 
Sbjct  512  AINDGGFAMMSGTSMATPVVSGVVVLLKSLHPDWSPSAIKSAIVTTAWRTD-PSGEPIFA  570

Query  537  EGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTT  358
            +G +  KLAD FDYGGG+INP +A KPGL+YDM+T DYV  +C++ YS  +IS + G+ T
Sbjct  571  DGSS-RKLADPFDYGGGLINPEKAVKPGLIYDMTTDDYVMYMCSVDYSDISISRVLGKIT  629

Query  357  SC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPST  181
             C +   S+LD+N PSITIP+L+  +TLTRTVTNVGP NS YKV+++PP G+ V V P+ 
Sbjct  630  VCPNPKPSVLDLNLPSITIPNLRGEVTLTRTVTNVGPVNSVYKVVIDPPTGVNVAVTPTE  689

Query  180  LNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            L F     K SF V +ST H  NTG+YFGSL W D +HNV IP+SV+T+
Sbjct  690  LVFDSTTTKRSFTVRVSTTHKVNTGYYFGSLTWTDTLHNVAIPVSVRTQ  738



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score =   264 bits (675),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 137/239 (57%), Positives = 170/239 (71%), Gaps = 4/239 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D    I  ++ ++GTSMA P ++G+VALLKA HPDWSPA  +SAIVTTAW 
Sbjct  531  SILAATSP-DSNSSIGRFDILAGTSMAAPVISGVVALLKALHPDWSPAAFRSAIVTTAWR  589

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGGI+NP +A +PGL+YDM   DY+  LC+  Y+ 
Sbjct  590  TD-PFGEQIFAEGSS-RKVADPFDYGGGIVNPEKAAEPGLIYDMGPEDYILYLCSASYND  647

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LDVN PSITIP+LK  + LTRTVTNVGP +S YKV+VEPP
Sbjct  648  SSISQLVGKVTVCSNPKPSVLDVNLPSITIPNLKDEVNLTRTVTNVGPVDSVYKVVVEPP  707

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             G+ V V P TL F+   K+ SF   +ST H  NTGFYFGSLIW D VHNV IP+SV+T
Sbjct  708  LGVRVAVTPETLVFNSTTKRASFTARVSTIHKINTGFYFGSLIWTDSVHNVTIPVSVRT  766



>ref|XP_010434151.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=374

 Score =   254 bits (648),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 131/241 (54%), Positives = 169/241 (70%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP    + +   SGTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTTAW 
Sbjct  134  SILAALSPLDPDAH-NGFGLDSGTSMSTPVVSGIIALLKSLHPNWSPAAMRSALVTTAWR  192

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T  S  EPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY++ +C+ GY+ 
Sbjct  193  TSPSR-EPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIEDYISYMCSAGYND  250

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G    C     SILD+N PSITIP+ ++ +TLTRTVTNVGP  S YK ++E P
Sbjct  251  SSISRVLGNKNKCPTPDPSILDINLPSITIPNFEKEVTLTRTVTNVGPIKSVYKAVIESP  310

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL F+    ++ +F+V   T H  NTG++FGSL W DGVHNV IP+SVKT
Sbjct  311  LGITLTVNPTTLVFNSAANRVLTFSVKAKTSHKVNTGYFFGSLTWTDGVHNVTIPVSVKT  370

Query  36   K  34
            K
Sbjct  371  K  371



>ref|XP_009128705.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128707.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
 ref|XP_009128709.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brassica 
rapa]
Length=723

 Score =   263 bits (672),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 166/221 (75%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA HPDWSPA I+SAIVTTAW TD   GE I  EG +  KL
Sbjct  496  MLSGTSMAAPVISGVVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIDAEGSS-RKL  553

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-S  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T+C     S
Sbjct  554  ADPFDYGGGLVNPEKAVKPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPS  613

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIPDLK  +TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   K
Sbjct  614  VLDLNLPSITIPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTK  673

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+S++V +ST H  NTGFYFGSL W+D VH+V IP+SV+T+
Sbjct  674  KLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVIIPLSVRTQ  714



>emb|CDX94043.1| BnaC07g36770D [Brassica napus]
Length=773

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 136/241 (56%), Positives = 171/241 (71%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  PSDP      +   SGTSM TP V+GI+ALLK+ HPDWSPA  +SA+VTTAW 
Sbjct  531  SILAALSPSDPNGH-DGFGLDSGTSMVTPVVSGIIALLKSLHPDWSPAAFRSALVTTAWR  589

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP RA  PGLVYDM   DY+N +C+ GY+ 
Sbjct  590  T-SPSGEPIFAEGSN-KKLADPFDYGGGLVNPQRAADPGLVYDMGIEDYINYMCSKGYND  647

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     SILD+N PSITIP++++ +TLTR+VTNVGP  S YK ++E P
Sbjct  648  SSISRVLGKKTKCPTPKPSILDMNLPSITIPNIEKEVTLTRSVTNVGPIKSVYKAVIESP  707

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL FS   KK+ SF V   T H  NTG++FGSL W DGVH+V+IP+SV+T
Sbjct  708  LGITLTVNPTTLVFSSEDKKVLSFTVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQT  767

Query  36   K  34
            +
Sbjct  768  R  768



>ref|XP_010445236.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=856

 Score =   265 bits (677),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 165/223 (74%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP V+G+VALLKA HPDWSPA +KSAI+T+AW TD  SG+PIF EG+   
Sbjct  632  YILGTGTSFATPVVSGLVALLKALHPDWSPAALKSAIMTSAWKTD-PSGDPIFAEGQP-R  689

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI+I+ G+ T C    
Sbjct  690  KLADPFDYGAGLVNMERAKDPGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPL  749

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  750  PSILDFNYPAITIPDLEEEVTITRTVTNVGPVDSVYRAVVEPPQGVKIVVEPETLVFEQN  809

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTG++FGS  W DG  NV IP+SV+T+
Sbjct  810  TKKLGFKVRVSSSHKSNTGYFFGSFTWTDGTRNVTIPLSVRTR  852



>ref|XP_002298973.2| subtilase family protein [Populus trichocarpa]
 gb|EEE83778.2| subtilase family protein [Populus trichocarpa]
Length=786

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 144/240 (60%), Positives = 174/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D   +   Y   SGTSMATPHV+GI ALLKA HPDWSPA IKSAIVTTAW 
Sbjct  541  NILAATSPLD-RFQDGGYVMHSGTSMATPHVSGIAALLKAIHPDWSPASIKSAIVTTAWI  599

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG    KLAD FDYGGGI NPN A  PGLVYDM T DYVN LCAM Y++
Sbjct  600  -NNPSGFPIFAEGSP-QKLADPFDYGGGIANPNGAAHPGLVYDMGTDDYVNYLCAMDYNN  657

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G+ T C  +G SIL++N PSITIP+L+  +TLTRTVTNVG  NS Y+V++E P
Sbjct  658  TAISRLTGKPTVCPTEGPSILNINLPSITIPNLRNSVTLTRTVTNVGASNSIYRVVIEAP  717

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
                V+V+P  L F+   KKI+F+VT++T +  NTG++FGS+ W DGVH VR P+SV+T+
Sbjct  718  FCCSVLVEPYVLVFNYTTKKITFSVTVNTTYQVNTGYFFGSITWIDGVHTVRSPLSVRTE  777



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score =   263 bits (673),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 166/221 (75%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA HPDWSPA I+SAIVTTAW TD   GE I  EG +  KL
Sbjct  552  MLSGTSMAAPVISGVVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIDAEGSS-RKL  609

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-S  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T+C     S
Sbjct  610  ADPFDYGGGLVNPEKAVKPGLVYDLDLEDYVLYMCSVGYNDSSISQLVGERTTCSNPRPS  669

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIPDLK  +TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   K
Sbjct  670  VLDLNLPSITIPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTK  729

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+S++V +ST H  NTGFYFGSL W+D VH+V IP+SV+T+
Sbjct  730  KLSYHVRVSTRHKINTGFYFGSLTWSDSVHDVIIPLSVRTQ  770



>ref|NP_564414.2| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
 sp|Q9MAP5.1|SBT33_ARATH RecName: Full=Subtilisin-like protease SBT3.3; AltName: Full=Subtilase 
subfamily 3 member 3; Short=AtSBT3.3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31276.1|AC006424_5 Third of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAM20591.1| subtilase, putative [Arabidopsis thaliana]
 gb|AAQ56790.1| At1g32960 [Arabidopsis thaliana]
 gb|AEE31544.1| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
Length=777

 Score =   263 bits (672),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 172/239 (72%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            ILAA  P+D  + +  +  +SGTSMATP ++G++ALLKA HP+WSPA  +SAIVTTAW T
Sbjct  533  ILAATSPND-TLNVGGFAMLSGTSMATPVISGVIALLKALHPEWSPAAFRSAIVTTAWRT  591

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D   GE IF EG +  K++D FDYGGGI+NP +A +PGL+YDM   DY+  LC+ GY+  
Sbjct  592  D-PFGEQIFAEGSS-RKVSDPFDYGGGIVNPEKAAEPGLIYDMGPQDYILYLCSAGYNDS  649

Query  387  AISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            +IS + GQ T C +   S+LDVN PSITIP+LK  +TLTRTVTNVG  +S YKV VEPP 
Sbjct  650  SISQLVGQITVCSNPKPSVLDVNLPSITIPNLKDEVTLTRTVTNVGLVDSVYKVSVEPPL  709

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ VVV P TL F+     +SF V +ST H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  710  GVRVVVTPETLVFNSKTISVSFTVRVSTTHKINTGYYFGSLTWTDSVHNVVIPLSVRTQ  768



>ref|XP_010434150.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=257

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 129/242 (53%), Positives = 172/242 (71%), Gaps = 6/242 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P  P    + +  +SGTS++TP V+GI+ALLK+ HP+WSP  ++SA+VTTAW 
Sbjct  14   HILAASSPLHPNAH-NGFGLLSGTSLSTPVVSGIIALLKSLHPNWSPVALRSALVTTAWR  72

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KP LVYDM   DY++ +CA+GY+ 
Sbjct  73   TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPELVYDMEIEDYISYMCAVGYND  130

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSI-TIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
             +IS + G+   C     S+LD+N PSI TIP+L++ +TLT+TVTNVGP  S YK ++E 
Sbjct  131  SSISRVLGKKNKCPTPEPSVLDINLPSIVTIPNLEKEVTLTKTVTNVGPIKSVYKAVIES  190

Query  216  PKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P GI + VKP+TL F+    ++ +F+V   T H  NTG++FGSL W DGVHNV IP+SVK
Sbjct  191  PLGITLTVKPTTLVFNSAANRVLTFSVKAKTSHKVNTGYFFGSLTWTDGVHNVTIPVSVK  250

Query  39   TK  34
            TK
Sbjct  251  TK  252



>ref|XP_007210025.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
 gb|EMJ11224.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
Length=773

 Score =   263 bits (671),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 171/241 (71%), Gaps = 4/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D A+    Y   SGTSM+TPHVAGIVALLKA HP+WSPA IKSA+VTTAW 
Sbjct  527  NILAATSPLD-ALGEGGYVMHSGTSMSTPHVAGIVALLKAMHPNWSPAAIKSALVTTAWR  585

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG    KLA+ FD+GGGI+NPN A  PGLVYD+    Y+  LC+ GY++
Sbjct  586  -NGPSGLPIFAEGSP-QKLANPFDFGGGIMNPNGAADPGLVYDIGKAGYMQYLCSRGYNN  643

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQ T C  K  SILD+N PSITIP LK PIT+ R+VTNVG   S Y+  +E P
Sbjct  644  SAISRLVGQNTKCPIKKPSILDMNLPSITIPSLKNPITIKRSVTNVGAPESIYRATIETP  703

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G IV V P+ L F+  V+K+ F +TIST H  NTG+YFGSL W DGVH V+IP+SV+T+
Sbjct  704  FGTIVSVNPNALVFNSTVRKLDFTITISTIHRMNTGYYFGSLSWADGVHVVKIPLSVRTE  763

Query  33   Y  31
            +
Sbjct  764  F  764



>emb|CDX93808.1| BnaA09g24080D [Brassica napus]
Length=748

 Score =   262 bits (669),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P +       +   SGTSMA P ++G+VALLKA HP+WSPA ++SAIVTTAW 
Sbjct  503  NILAATSP-NVTNNAGGFAMYSGTSMAAPVISGVVALLKALHPNWSPAALRSAIVTTAWR  561

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGE +  EG +  K AD FDYGGG++NP +A +PGL+YDM   DY+  LC+ GY+ 
Sbjct  562  TD-PSGEQLPAEGSS-RKAADPFDYGGGLVNPEKAAEPGLIYDMGPKDYILYLCSAGYND  619

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKV+VEPP
Sbjct  620  SSISQLVGKVTVCSNPKPSVLDMNLPSITIPNLKEKVTLTRTVTNVGPVNSVYKVVVEPP  679

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ VVV P  L F+   K++SF V  ST H  NTG+YFGSLIW D VHNV IP+SV+T+
Sbjct  680  LGVRVVVTPKKLVFNSKTKRVSFKVRASTTHKINTGYYFGSLIWTDNVHNVTIPVSVRTQ  739



>ref|XP_002867838.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44097.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=658

 Score =   260 bits (664),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 175/240 (73%), Gaps = 5/240 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            ILAA    DP    + +  +SGTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTTAW T
Sbjct  417  ILAAVSSLDPYAY-NGFGLLSGTSMSTPVVSGIIALLKSLHPNWSPAAMRSALVTTAWRT  475

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
               SGEPIF EG    KLAD+FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+  
Sbjct  476  S-PSGEPIFAEGSN-KKLADSFDYGGGLVNPEKAAKPGLVYDMGINDYINYMCSAGYNDS  533

Query  387  AISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            +IS + G+ T C     S+LD+N PSITIP+L++ +TLTRTVTNVGP  S YK +++PP 
Sbjct  534  SISRVLGKKTKCPIPEPSMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIKPPL  593

Query  210  GIIVVVKPSTLNFSPNVKK-ISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            GI + V P+TL F+   K+ ++F+V   T H  N+G++FGSL W DGVH+V IP+SVKT+
Sbjct  594  GITLTVNPTTLVFNSAAKRSLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVTIPVSVKTE  653



>ref|XP_006287107.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
 gb|EOA20005.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
Length=780

 Score =   262 bits (670),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMATP ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  553  MMSGTSMATPAISGVVALLKALHRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKL  610

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C+ GY+  +IS + G+ T C +   S
Sbjct  611  ADPFDYGGGLVNPEKAAKPGLVYDLGLEDYVLYMCSAGYNESSISQLVGKATICSNPKLS  670

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            ILD N PSITIP+LK  +TLTRT+TNVGP +S Y+V+VEPP G  V V+P TL F+   K
Sbjct  671  ILDFNLPSITIPNLKDEVTLTRTLTNVGPLDSVYRVVVEPPLGFQVTVEPKTLVFNSQTK  730

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            ++SF V IST H  NTG+YFGSL W+D VHNV I +SV+T+
Sbjct  731  RVSFKVRISTTHKINTGYYFGSLTWSDSVHNVTIHVSVRTQ  771



>gb|KJB52411.1| hypothetical protein B456_008G260500 [Gossypium raimondii]
Length=822

 Score =   263 bits (671),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 173/244 (71%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA    D  +    Y   SGTSMATPHV+GIVALLKA HPDWSPA IKSA+VTTA T
Sbjct  577  NILAATSQLDQWMD-GGYAIHSGTSMATPHVSGIVALLKAIHPDWSPAAIKSALVTTART  635

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             D +SG P+F EG    KLA+ FD+GGGI+NPN A  PGLVYDM  +DY++ LCAMGY++
Sbjct  636  KD-ASGFPLFAEGSP-KKLANPFDFGGGIVNPNGAADPGLVYDMGLSDYIHYLCAMGYNN  693

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQ+T+C  +  S LDVN PSITI  L+  +TLTRTVTNVG  NS Y+  +EPP
Sbjct  694  SAISRLTGQSTACPAEKPSFLDVNLPSITISSLRSSVTLTRTVTNVGSPNSIYRADIEPP  753

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V VKP  L F+   KKISFNVT+      NTG++FGSL W +  + VRIP+SVKT+
Sbjct  754  TGMTVTVKPHILVFNSRTKKISFNVTVCATKQVNTGYFFGSLTWRNEQNAVRIPLSVKTE  813

Query  33   Y*ES  22
              ES
Sbjct  814  ILES  817



>ref|XP_009137202.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=771

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 171/241 (71%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP      +   SGTSM+TP V+GI+ALLK+ HPDWSPA  +SA+VTTAW 
Sbjct  529  SILAALSPFDPNGH-DGFGLASGTSMSTPVVSGIIALLKSLHPDWSPAAFRSALVTTAWR  587

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP RA  PGLVYDM   DY+N +C+ GY+ 
Sbjct  588  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPQRAAHPGLVYDMGIEDYINYMCSKGYND  645

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     SILD+N PSITIP++++ +TLTR+VTNVGP  S YK ++E P
Sbjct  646  SSISRVIGKKTKCPTPKPSILDMNLPSITIPNIEKEVTLTRSVTNVGPIKSIYKAVIESP  705

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL FS   KK+ SF V   T H  NTG++FGSL W DGVH+V+IP+SV+T
Sbjct  706  LGITLTVNPTTLVFSSEDKKVLSFTVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQT  765

Query  36   K  34
            +
Sbjct  766  R  766



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   262 bits (669),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 173/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P +  +    +  +SGTSMA P ++G++ALLK+ HPDWSPA  +SAIVTTAW 
Sbjct  529  SILAATSP-NKNLNAGGFVMLSGTSMAAPVISGVIALLKSLHPDWSPAAFRSAIVTTAWR  587

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGG++NP +A +PGL+YDM   DY+  LC+ GY+ 
Sbjct  588  TD-PFGEQIFAEGSS-QKVADPFDYGGGLVNPEKAAEPGLIYDMGPQDYILYLCSAGYNE  645

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS++ G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKV+VEPP
Sbjct  646  SSISLLVGKVTVCSNPKPSVLDINLPSITIPNLKDEVTLTRTVTNVGPVNSVYKVVVEPP  705

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P+TL F+   K +SF V +ST H  NTG+ FGSL W D VHNV IP+SV+T+
Sbjct  706  LGVRVAVTPATLVFNSKTKSVSFRVRVSTKHKINTGYLFGSLTWTDSVHNVVIPVSVRTQ  765



>ref|XP_006413792.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
 gb|ESQ55245.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
Length=748

 Score =   261 bits (667),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 129/239 (54%), Positives = 172/239 (72%), Gaps = 5/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL A +  +P  +   +   +GTS ATP V+GIVALL+A HPDWSPA +KSA++TTAW +
Sbjct  512  ILGADVSDNPHAK--GFAIATGTSFATPVVSGIVALLRALHPDWSPAALKSALMTTAWRS  569

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D  +GEPIF EG    KLAD FDYG G++N  RAR PGLVYDM+  DY++  CA GY+  
Sbjct  570  D-PNGEPIFAEGFP-RKLADPFDYGAGLVNAERARDPGLVYDMNLDDYIHYFCASGYNDT  627

Query  387  AISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            AIS++ G+ T C     SILD+N+P+ITIPD+K  ++L+RTVTNVGP +S Y+ +VEPP 
Sbjct  628  AISVLTGKPTKCSSPLPSILDLNYPAITIPDIKEEVSLSRTVTNVGPVDSVYRAVVEPPP  687

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            GI +VV+P TL F+ + KK+ F V +ST +  NTG++FGS  W DG  NV IP+SV+T+
Sbjct  688  GIKIVVEPETLVFNSSTKKLGFKVRVSTSYKSNTGYFFGSFTWTDGTRNVTIPLSVRTR  746



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score =   268 bits (684),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 141/244 (58%), Positives = 176/244 (72%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P +  V    Y  +SGTSMATPHV+G+VALLKA HPDWSPA IKSA+VTTAW 
Sbjct  539  NILAATGPLN-RVMDGGYAMLSGTSMATPHVSGVVALLKALHPDWSPAAIKSALVTTAWR  597

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG    KLAD FD+GGGI+NPN A  PGLVYD+  TD++  LCA+GY++
Sbjct  598  -NGPSGLPIFAEGFP-KKLADPFDFGGGIVNPNGATDPGLVYDVGATDHIYYLCAVGYNN  655

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQ+  C  +  SILDVN PSITIP+L+   TLTRTVTNVG   S Y+V+++PP
Sbjct  656  SAISQLTGQSIVCPSERPSILDVNLPSITIPNLRNSTTLTRTVTNVGAPESIYRVVIQPP  715

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+++ V P  L F+   K I+F VT+S+ H  NTG+YFGSL W DGVH VR P+SV+T+
Sbjct  716  IGVVITVNPDVLVFNSMTKSITFKVTVSSTHHVNTGYYFGSLTWTDGVHEVRSPLSVRTE  775

Query  33   Y*ES  22
              +S
Sbjct  776  IIQS  779


 Score =   267 bits (682),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 143/244 (59%), Positives = 174/244 (71%), Gaps = 9/244 (4%)
 Frame = -2

Query  750   NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             +ILAA  P DP +    +   SGTSMATPH++GIVALLKA HP WSP  IKSA+VTTAW 
Sbjct  1248  SILAASSPLDPFMD-GGFALHSGTSMATPHISGIVALLKALHPSWSPVAIKSALVTTAWR  1306

Query  570   TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             TD   GEPIF EG    KLAD FDYGGGI+NPN+A +PGLVYDM T+DY++ LC++GY++
Sbjct  1307  TD-PLGEPIFVEGSP-RKLADPFDYGGGIVNPNKAAEPGLVYDMGTSDYIHYLCSVGYNN  1364

Query  390   KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              AIS +  Q T C +   SILDVN PSITI +L++  TLTR VTNVGP+NS YK M+EPP
Sbjct  1365  SAISQLVEQPTICPNTKASILDVNLPSITISNLRKSTTLTRKVTNVGPQNSMYKAMIEPP  1424

Query  213   KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              GI V V+P  L F+   +     V +ST H  NTG+YFGSL W DGVH V  PISV+T+
Sbjct  1425  LGIPVTVRPDILVFNSTXQ-----VEVSTAHQVNTGYYFGSLTWMDGVHTVSSPISVRTQ  1479

Query  33    Y*ES  22
               +S
Sbjct  1480  LIQS  1483



>ref|NP_567358.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40044.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78174.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82892.1| Subtilase family protein [Arabidopsis thaliana]
Length=765

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 164/221 (74%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F+SGTSMATP ++GIVALLKA HPDWSPA I+SAIVTTAW TD   GE IF EG +  K 
Sbjct  538  FLSGTSMATPTISGIVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIFAEG-SPRKP  595

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S
Sbjct  596  ADPFDYGGGLVNPEKATKPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSYPKPS  655

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TL RT+TNVGP  S Y+V VEPP G  V V P TL F+   K
Sbjct  656  VLDFNLPSITIPNLKEEVTLPRTLTNVGPLESVYRVAVEPPLGTQVTVTPETLVFNSTTK  715

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            ++SF V++ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  716  RVSFKVSVSTTHKINTGYYFGSLTWSDSLHNVTIPLSVRTQ  756



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   261 bits (667),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P +       +   SGTSMA P ++G+VALLKA HP+WSPA ++SAIVTTAW 
Sbjct  529  NILAATSP-NVTNNAGGFAMYSGTSMAAPVISGVVALLKALHPNWSPAALRSAIVTTAWR  587

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGE +  EG +  K AD FDYGGG++NP +A +PGL+YDM   DY+  LC+ GY+ 
Sbjct  588  TD-PSGEQLPAEGSS-RKAADPFDYGGGLVNPEKAAEPGLIYDMGPKDYILYLCSAGYND  645

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKV+VEPP
Sbjct  646  SSISQLVGKVTVCSNPKPSVLDMNLPSITIPNLKEKVTLTRTVTNVGPVNSVYKVVVEPP  705

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ VVV P  L F+   K++SF V  ST H  NTG+YFGSLIW D VHNV IP+SV+T+
Sbjct  706  LGVRVVVTPKKLVFNSKTKRVSFKVRASTTHKINTGYYFGSLIWTDNVHNVTIPVSVRTQ  765



>ref|XP_011470880.1| PREDICTED: subtilisin-like protease SBT3.3 [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   261 bits (667),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 137/241 (57%), Positives = 171/241 (71%), Gaps = 4/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D +   + Y   SGTSM+TPHVAGIVAL+KA HP+WSPA I+SA+VTTAW+
Sbjct  535  NILAATSPLD-SFADAGYVMHSGTSMSTPHVAGIVALIKAVHPNWSPAAIRSALVTTAWS  593

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
               S   PIF EG    KLA+ FD+GGGI+NPN A  PGLVYDM   DY++ LCAM Y++
Sbjct  594  NGPSR-LPIFAEGSP-QKLANPFDFGGGIVNPNAASNPGLVYDMGAADYMHYLCAMDYNN  651

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              I+ + GQ T+C  K  S+LD+N PSITIP L   IT+TRTVTNVG   S Y+  ++PP
Sbjct  652  SDITRLTGQATTCPMKRPSLLDINLPSITIPSLGNSITVTRTVTNVGAPKSVYEATIDPP  711

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G +V VKP+ L F+  VKK++F + IST H  NTG+YFGSL W D VH VRIP+SV+T 
Sbjct  712  LGTVVSVKPNLLVFNSTVKKLTFEIVISTTHQMNTGYYFGSLTWTDRVHAVRIPLSVRTN  771

Query  33   Y  31
            +
Sbjct  772  F  772



>ref|XP_008239249.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239250.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239251.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 140/241 (58%), Positives = 170/241 (71%), Gaps = 4/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D A+    +   SGTSM+TPHVAGIVALLKA HP+WSPA IKSA+VTTAW 
Sbjct  527  NILAATSPLD-ALGEGGHVMHSGTSMSTPHVAGIVALLKAMHPNWSPAAIKSALVTTAWR  585

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG    KLA+ FD+GGGI+NPN A  PGLVYD+    Y+  LC+ GY++
Sbjct  586  -NGPSGLPIFAEGSP-QKLANPFDFGGGIMNPNGAADPGLVYDIGKAGYMQYLCSRGYNN  643

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQ T C  K  SILD+N PSITIP LK PIT+ R+VTNVG   S Y+  +E P
Sbjct  644  SAISRLVGQNTKCPIKKPSILDMNLPSITIPSLKNPITIKRSVTNVGAPESIYRATIETP  703

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G IV V P+ L F+  V+K+ F +TIS  H  NTG+YFGSL W DGVH VRIP+SV+T+
Sbjct  704  FGTIVSVNPNALVFNSTVRKLDFTITISAIHRMNTGYYFGSLSWADGVHVVRIPLSVRTE  763

Query  33   Y  31
            +
Sbjct  764  F  764



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score =   267 bits (683),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 142/244 (58%), Positives = 171/244 (70%), Gaps = 4/244 (2%)
 Frame = -2

Query  750   NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
              IL A  PSD   + + + F SGTSMATPH+AGIVALLK+ HP WSPA IKSAIVTT WT
Sbjct  1639  QILGAVPPSD-LKKNTEFAFHSGTSMATPHIAGIVALLKSLHPHWSPAAIKSAIVTTGWT  1697

Query  570   TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             TD  SGEPIF EG+  +KLAD FD+GGGI+NPNRA  PGLVYDM T DY++ LC +GY++
Sbjct  1698  TD-PSGEPIFAEGDP-TKLADPFDFGGGIVNPNRAADPGLVYDMGTADYIHYLCTLGYNN  1755

Query  390   KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              AI     Q+  C  +  SILD+N PSITIP L+   +LTR VTNVG  NSTYK  +  P
Sbjct  1756  SAIFQFTEQSIRCPTREHSILDLNLPSITIPSLQNSTSLTRNVTNVGAVNSTYKASIISP  1815

Query  213   KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              G  + VKP TL F   +K ++F+VT+S+    NTG+ FGSL W DGVH VR PISV+T 
Sbjct  1816  AGTTITVKPDTLIFDSTIKTVTFSVTVSSIQQVNTGYSFGSLTWIDGVHAVRSPISVRTM  1875

Query  33    Y*ES  22
               ES
Sbjct  1876  IKES  1879


 Score =   252 bits (643),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 127/222 (57%), Positives = 165/222 (74%), Gaps = 3/222 (1%)
 Frame = -2

Query  699   YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
             Y  +SGTSMATPHV+G VALL+A + +WSPA IKSAIVTTAWTTD  SGEP+F EG+ + 
Sbjct  907   YYLMSGTSMATPHVSGAVALLRALNREWSPAAIKSAIVTTAWTTD-PSGEPVFAEGQPM-  964

Query  519   KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
             KLAD FD+GGGI+NPN A  PGLVYDM   D +  LCAMGY++ AI+ + G+ TSC    
Sbjct  965   KLADPFDFGGGILNPNGAGNPGLVYDMGKDDCILYLCAMGYNNSAIAKVTGRPTSCPCNR  1024

Query  339   -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
              SILDVN PSITIP+L+  ++LTR+VTNVG  +S Y  +++PP G+ + ++P  L F+  
Sbjct  1025  PSILDVNLPSITIPNLQYSVSLTRSVTNVGAVDSEYNAVIDPPPGVTIKLEPDRLVFNSK  1084

Query  162   VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             ++ I+F V +S+    +TGF FGSL W+DG H VRIPISV+T
Sbjct  1085  IRTITFRVMVSSARRVSTGFSFGSLAWSDGEHAVRIPISVRT  1126



>ref|XP_006415136.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
 gb|ESQ33489.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
Length=782

 Score =   261 bits (666),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            ++ ++GTSMA P ++G+VALLKA HP+WSPA  +SAIVTTAW TD   GE IF EG +  
Sbjct  553  FDILAGTSMAAPVISGVVALLKALHPNWSPAAFRSAIVTTAWRTD-PFGEQIFAEGSS-R  610

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKG  343
            K+AD FDYGGG++N  +A  PG +YDM T DY+  LC+ GY+  +IS + G+ T C +  
Sbjct  611  KVADPFDYGGGLVNAEKAADPGFIYDMGTKDYILYLCSAGYNDSSISQLVGKVTVCSNPK  670

Query  342  FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+ DVN PSITIP+LK  +TLTRTVTNVGP +S YKV+VEPP G+ VVV P TL F+  
Sbjct  671  PSVFDVNLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVVVEPPFGVRVVVTPETLRFNSK  730

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             K +SF V +ST H  NTGF+FGSLIW D +HNV IP+SV+T+
Sbjct  731  TKSVSFKVRVSTTHKINTGFFFGSLIWTDSLHNVTIPVSVRTQ  773



>ref|XP_010421967.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 134/240 (56%), Positives = 173/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+  ++    +  +SGTSM+TP V+G+V LLK+ HPDWSPA IKSAIVTTAW 
Sbjct  516  NILAAISPNS-SINDGGFAMMSGTSMSTPVVSGVVVLLKSLHPDWSPAAIKSAIVTTAWK  574

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG+INP +A KPGL+YDM+T DY+  LC+  YS 
Sbjct  575  TD-PSGEPIFADGSS-RKLADPFDYGGGLINPEKAVKPGLIYDMTTDDYILYLCSAEYSD  632

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+L+  +T  RTVTNVGP  S YKV+++PP
Sbjct  633  VSISRVLGKATVCPNPKPSVLDLNLPSITIPNLREEVTFKRTVTNVGPLKSIYKVVIDPP  692

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P+ L F     K+SF V +ST H  NTG+YFGSL W + +HNV IP+SV+T+
Sbjct  693  TGVNVTVTPTELVFDSTNTKLSFTVRVSTTHKVNTGYYFGSLTWTNDLHNVVIPVSVRTQ  752



>ref|XP_010449086.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010449087.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=755

 Score =   260 bits (665),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 125/218 (57%), Positives = 161/218 (74%), Gaps = 3/218 (1%)
 Frame = -2

Query  684  GTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLADA  505
            GTS ATP V+G+V LLKA HPDWSPA +KSAI+T+AW TD  SG+PIF EG+   KLAD 
Sbjct  536  GTSFATPVVSGLVVLLKALHPDWSPAALKSAIMTSAWKTD-PSGDPIFAEGQP-RKLADP  593

Query  504  FDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILD  328
            FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI+I+ G+ T C     SILD
Sbjct  594  FDYGAGLVNMERAKDPGLVYDMNVDDYIHFFCASGYNETAITILVGKPTRCSSPLPSILD  653

Query  327  VNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKIS  148
             N+P+ITIPDLK  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P  L F  N KK+ 
Sbjct  654  FNYPAITIPDLKEEVTITRTVTNVGPVDSVYRAVVEPPEGVKIVVEPEALVFDWNTKKLG  713

Query  147  FNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            F V +S+ H  NTG++FGS  W DG  NV IP+SV+T+
Sbjct  714  FKVRVSSSHKSNTGYFFGSFTWTDGTRNVTIPLSVRTR  751



>gb|AAD03438.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=49.7, E=9.2e-13, n=3) [Arabidopsis thaliana]
Length=774

 Score =   260 bits (665),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F+SGTSMATP ++GIVALLKA HPDWSPA I+SAIVTTAW TD   GE IF EG    K 
Sbjct  547  FLSGTSMATPTISGIVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKP  604

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S
Sbjct  605  ADPFDYGGGLVNPEKATKPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSYPKPS  664

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TL RT+TNVGP  S Y+V VEPP G  V V P TL F+   K
Sbjct  665  VLDFNLPSITIPNLKEEVTLPRTLTNVGPLESVYRVAVEPPLGTQVTVTPETLVFNSTTK  724

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            ++SF V++ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  725  RVSFKVSVSTTHKINTGYYFGSLTWSDSLHNVTIPLSVRTQ  765



>ref|XP_009137200.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=766

 Score =   259 bits (663),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 174/241 (72%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D +     +   +GTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTTAW 
Sbjct  524  SILAALSPFD-SREHDGFGLDTGTSMSTPVVSGIIALLKSLHPNWSPAAVRSALVTTAWR  582

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+ 
Sbjct  583  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPQKASKPGLVYDMGIQDYINYMCSAGYND  640

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   SILD+N PSITIP+L++ +TLTRTVTNVGP  S YK ++E P
Sbjct  641  SSISGMVGKITKCPNPKPSILDMNLPSITIPNLEKKVTLTRTVTNVGPIKSVYKAVIESP  700

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL FS   K++ +F V   T H  NTG++FGSL W DGVH+V+IP+SV+T
Sbjct  701  LGITLTVTPNTLVFSSAAKRVLTFKVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQT  760

Query  36   K  34
            K
Sbjct  761  K  761



>ref|XP_011038010.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Populus 
euphratica]
Length=704

 Score =   258 bits (659),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D   + S Y   SGTSMATPH++GI ALLKA HPDWSPA IKSA VTTAW 
Sbjct  459  NILAATSPLD-RFQDSGYVMHSGTSMATPHISGITALLKAMHPDWSPAAIKSAFVTTAWI  517

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG  + KLAD FDYGGGI NPN A  PGLVYDM + DYVN LCAM Y++
Sbjct  518  NN-PSGFPIFAEGSPL-KLADPFDYGGGIANPNGAAHPGLVYDMGSDDYVNYLCAMDYNN  575

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G+ T C  +G SIL++N PSITIP+L+  +TLTRTVTN G  NS Y+V++E P
Sbjct  576  TAISRLTGKPTVCPTEGPSILNINLPSITIPNLRNSVTLTRTVTNAGASNSIYRVVIEAP  635

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
                V V+P  L F+   KK +F+VT++T +  NTG++FGS+ W DGVH VR P+SV+T+
Sbjct  636  FCCSVSVEPHVLVFNHTTKKNTFSVTVNTTYQVNTGYFFGSITWIDGVHTVRSPLSVRTE  695



>gb|AGN12874.1| putative transcription factor DYSFUNCTIONAL TAPETUM 1 [Sisymbrium 
irio]
Length=775

 Score =   259 bits (662),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 129/240 (54%), Positives = 169/240 (70%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            N+L A I  DP      +  + GTS A P V GIVALL++ HPDWSPA +KSA++TTAW 
Sbjct  538  NVLGADIIVDPQYS-PGFAIVQGTSFAAPAVTGIVALLRSLHPDWSPAALKSAMMTTAWK  596

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   G+PIF EG +  KLAD FDYG G++N  RA+ PGLVYDM+  DY++ LCA  Y+ 
Sbjct  597  TD-PHGDPIFAEG-SPRKLADPFDYGAGLVNAERAKDPGLVYDMNIDDYIHFLCASSYNE  654

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS++ G+ T C     SILDVN+P+ITIP+LK  + +TRTVTNVGP +S Y+ +VE P
Sbjct  655  TAISVLTGKPTKCSSPLPSILDVNYPAITIPELKDEVNITRTVTNVGPVDSVYRAVVEAP  714

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            +G+ +VV+P TL FS + KK+ F V +ST H  NTG++FGS  W DG  NV IP+SV+T+
Sbjct  715  EGVKIVVEPQTLVFSSSTKKLGFKVRVSTSHKSNTGYFFGSFTWTDGTRNVTIPLSVRTR  774



>gb|AAD03430.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 47.5, E=3.8e-12, n=2) [Arabidopsis thaliana]
Length=685

 Score =   257 bits (657),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F+SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  458  FLSGTSMAAPTISGVVALLKALHRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKL  515

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S
Sbjct  516  ADPFDYGGGLVNPEKAAKPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSNPKPS  575

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TLTRT+TNVG   S YKV++EPP GI V V P TL F+   K
Sbjct  576  VLDFNLPSITIPNLKDEVTLTRTLTNVGQLESVYKVVIEPPIGIQVTVTPETLLFNSTTK  635

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            ++SF V +ST H  NTG++FGSL W+D +HNV IP+SV+T+
Sbjct  636  RVSFKVKVSTTHKINTGYFFGSLTWSDSLHNVTIPLSVRTQ  676



>ref|XP_002872521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=766

 Score =   259 bits (661),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F+SGTSMATP ++G+VALLKA HPDWSPA I+SAIVTTAW TD   GE IF EG    K 
Sbjct  539  FLSGTSMATPTISGVVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKP  596

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S
Sbjct  597  ADPFDYGGGLVNPEKATKPGLVYDLGLEDYVLYMCSIGYNESSISQLVGKGTVCSNPKPS  656

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TLTRT+TNVGP +S Y+V VE P GI V V P TL F+   K
Sbjct  657  VLDFNLPSITIPNLKEEVTLTRTLTNVGPLDSVYRVAVELPLGIQVTVTPETLVFNSTTK  716

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             +SF V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  717  GVSFKVRVSTTHKINTGYYFGSLTWSDSLHNVTIPLSVRTQ  757



>ref|XP_010436981.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Camelina 
sativa]
Length=667

 Score =   257 bits (656),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 174/244 (71%), Gaps = 5/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+  ++    +  +SGTSMATP V G+V LL++ +P WSP+ IKSAIVTTAW 
Sbjct  421  NILAAISPNS-SINDGGFAMMSGTSMATPVVTGVVVLLRSLYPHWSPSAIKSAIVTTAWK  479

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCA-MGYS  394
            TD  SGEPIF +G    KLAD FDYGGG++NP +A +PGL+YDM+  DYV+ LC+   Y+
Sbjct  480  TD-PSGEPIFADGSN-RKLADPFDYGGGLVNPEKAARPGLIYDMTIDDYVSYLCSTYNYN  537

Query  393  SKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
              +IS + G  T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKVM++P
Sbjct  538  DASISQVLGNKTVCPNPKPSVLDLNLPSITIPNLKDEVTLTRTVTNVGPLNSIYKVMIDP  597

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            P GI + V P TL F+   K +SF V +ST H  NTG+YFGSL W D +HNV IP+SV+T
Sbjct  598  PIGISMTVTPHTLQFNSTTKIVSFKVRVSTRHKVNTGYYFGSLTWTDNLHNVVIPVSVRT  657

Query  36   KY*E  25
            +  E
Sbjct  658  QILE  661



>ref|XP_011470878.1| PREDICTED: uncharacterized protein LOC101314621 [Fragaria vesca 
subsp. vesca]
Length=1534

 Score =   265 bits (676),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 172/241 (71%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP +    +   SGTSMATPHV+GIVALLKA H +WSPA I+SAIVTTAW 
Sbjct  538  SILAASAPFDPYMN-GGFALHSGTSMATPHVSGIVALLKALHSNWSPAAIRSAIVTTAWR  596

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GEPIF EG    KLAD FDYGGGI+NPN+A  PGLVYD+   DY+  LCA+GY++
Sbjct  597  TD-PFGEPIFAEGSP-QKLADPFDYGGGIVNPNKAADPGLVYDLGVYDYILYLCAVGYNN  654

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              IS + G +T+C     S+LDVN PSIT+P+L+  ITLTR+VTNVGP NSTYK  + PP
Sbjct  655  SEISQLVGNSTTCSSTKPSVLDVNLPSITVPNLRENITLTRSVTNVGPVNSTYKARISPP  714

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGV-HNVRIPISVKT  37
             GI V V P TL F+ N++ I F V +ST H  NTG+YFGSL W D   H V IP+SV+T
Sbjct  715  WGISVAVSPETLVFNSNIETIYFTVEVSTTHEVNTGYYFGSLAWTDEWGHVVTIPMSVRT  774

Query  36   K  34
            +
Sbjct  775  Q  775


 Score =   209 bits (532),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/243 (47%), Positives = 166/243 (68%), Gaps = 3/243 (1%)
 Frame = -2

Query  750   NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             +ILAA+ P +   + + Y  +SGTSMA PHV GIVAL+K+ H DWSPA IKSA+VTTA  
Sbjct  1291  DILAAFRPHEKK-QSNGYALLSGTSMACPHVTGIVALIKSVHQDWSPAAIKSALVTTASQ  1349

Query  570   TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             T  + G  I  +G+T  K+AD FD GGG ++PN+A  PGL+Y+ +T DY+  LC++GYS+
Sbjct  1350  TG-TDGTSISAQGQT-RKVADPFDIGGGHVDPNKAMDPGLIYNATTNDYIQFLCSLGYST  1407

Query  390   KAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
              +++ +   T +C      +++N PSI+IP+L+R  T+TRTVTNVG  +S Y+VMV+ P 
Sbjct  1408  ASLTRLTNTTITCLTKADAINLNLPSISIPNLERTSTVTRTVTNVGKIDSKYRVMVQAPP  1467

Query  210   GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTKY  31
             G+ + VKP TL+F+   + +S+ VT  +    N G+ FGSL W DG H+VRIPI+++   
Sbjct  1468  GVEMTVKPPTLSFNITAQILSYKVTFFSTQKVNGGYKFGSLTWTDGEHDVRIPIAIRVTA  1527

Query  30    *ES  22
              ES
Sbjct  1528  FES  1530



>ref|XP_010470055.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=750

 Score =   258 bits (660),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 130/219 (59%), Positives = 164/219 (75%), Gaps = 3/219 (1%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMATP V+G+V LLK+ +P WSPA I+SAIVTTAW TD  SGEPIF +G +  KLAD
Sbjct  525  SGTSMATPVVSGVVVLLKSLYPHWSPAAIRSAIVTTAWKTD-PSGEPIFADGSS-HKLAD  582

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-GFSIL  331
             FDYGGG++NP +A +PGL+YDM+  DYV  LC+  Y++ ++S I  + T C K   S+L
Sbjct  583  PFDYGGGLVNPEKAARPGLIYDMTIDDYVLYLCSTYYNNVSVSQILEKKTVCPKPTRSVL  642

Query  330  DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
            D+N PSITIP+LK  +TLTRTVTNVGP NS YKVM++PP G+ + V P TL F+   K +
Sbjct  643  DLNLPSITIPNLKDEVTLTRTVTNVGPLNSIYKVMIDPPIGVSMTVTPYTLEFNSTTKNV  702

Query  150  SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            SF V +ST H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  703  SFKVRVSTTHKVNTGYYFGSLTWTDSVHNVVIPVSVRTQ  741



>ref|XP_010449025.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=775

 Score =   258 bits (660),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 134/241 (56%), Positives = 172/241 (71%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D   + + +   SGTSMATP V+GI+ALLK+ HP+WSPA I+SA+VTTAW 
Sbjct  533  SILAASSPLDLE-QHNGFKLDSGTSMATPVVSGIIALLKSLHPNWSPAAIRSALVTTAWR  591

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+ 
Sbjct  592  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIKDYINYMCSAGYND  649

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+   C     SILD+N PSITIP+L++ +TL RTVTNVGP  S YK ++E P
Sbjct  650  SSISRVLGKKNKCPTPEPSILDINLPSITIPNLEKEVTLKRTVTNVGPIKSVYKAVIESP  709

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + VKP+TL F+    ++ +F+V   T H  N+G++FGSL W DGVHNV IP+SVKT
Sbjct  710  LGITLTVKPTTLVFNSAANRVLTFSVQAKTSHKVNSGYFFGSLTWTDGVHNVTIPVSVKT  769

Query  36   K  34
            K
Sbjct  770  K  770



>ref|XP_010542096.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=812

 Score =   259 bits (662),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 133/241 (55%), Positives = 174/241 (72%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P++       +  +SGTSMA P ++G+ +LL+A HPDWSPA I+SA+VTTAW 
Sbjct  566  NILAATSPNE-TFNDGGFVMMSGTSMAAPVISGVASLLRALHPDWSPAAIRSALVTTAWR  624

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GEPI  EG    KLAD FDYGGG++NP +A +PGLVYDM   DY+  LC+ GY+ 
Sbjct  625  TD-PYGEPISAEGSP-RKLADPFDYGGGLVNPEKAAEPGLVYDMGIDDYILYLCSAGYND  682

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C +   SILD+N PSITIPDL+  +TL+RTVTNVGP +S YK++VE P
Sbjct  683  SSISQLVGKGTACPNPKPSILDLNLPSITIPDLRDEVTLSRTVTNVGPADSVYKILVENP  742

Query  213  KGIIVVVKPSTLNF-SPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI V V+P TL F +   ++++F V +ST H  NTGFYFGSL W+D VHNV IP+SV+T
Sbjct  743  LGIDVEVRPDTLVFNNSTARRVAFTVRVSTKHKINTGFYFGSLTWSDSVHNVTIPVSVRT  802

Query  36   K  34
            +
Sbjct  803  Q  803



>ref|XP_010461118.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=771

 Score =   258 bits (660),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       ++  SGTSM+TP VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  526  NILAATSPND-TFYDRGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWR  584

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A KPGLVYDM   DYV  LC++GY+ 
Sbjct  585  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTD  642

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVGP  S YK ++E P
Sbjct  643  SSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGPVGSVYKAVIEAP  702

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V PSTL F+   +K+SF V + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  703  MGVNVTVTPSTLVFNAKTRKLSFKVRVVTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQ  762



>gb|KFK41050.1| hypothetical protein AALP_AA2G078900 [Arabis alpina]
Length=757

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 158/223 (71%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSMATP V+GIV LL+   PDWSPA I+SA+VTTAW TD   GEPIF+EG T  
Sbjct  531  YKFMSGTSMATPVVSGIVGLLRQIRPDWSPAAIRSALVTTAWRTD-PFGEPIFSEGST-R  588

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKG  343
            KLAD FDYGGG+INP +  +PGLVYDM   DYV+ LC+  Y   +IS + GQ   C    
Sbjct  589  KLADPFDYGGGLINPGKVAEPGLVYDMGIDDYVHYLCSADYDDASISKLLGQAYKCPWPK  648

Query  342  FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD N PSITIP L   +TLTRTVTNVGP  S Y+ +VEPP GI + V P+TL F  N
Sbjct  649  PSMLDFNMPSITIPSLTGEVTLTRTVTNVGPSGSVYRPIVEPPSGIELEVNPNTLIFGSN  708

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              KI+F+V + T H  N+ FYFGSL W DGVHNV IP+SV+TK
Sbjct  709  TTKITFSVRVRTNHKVNSDFYFGSLCWTDGVHNVTIPVSVRTK  751



>ref|NP_564869.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAG51764.1|AC066691_4 subtilisin-like protein; 10849-13974 [Arabidopsis thaliana]
 gb|AEE34478.1| Subtilase-like protein [Arabidopsis thaliana]
Length=753

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/224 (58%), Positives = 160/224 (71%), Gaps = 3/224 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSMATP V+GIV LL+  HP WSPA I+SA+VTTAW TD  SGEPIF+EG T  
Sbjct  527  YKFMSGTSMATPAVSGIVGLLRQTHPHWSPAAIRSALVTTAWKTD-PSGEPIFSEGST-R  584

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK-G  343
            KLAD FDYGGG+INP +   PGL+YDM   DY++ LC+  Y   +IS + G+T +C    
Sbjct  585  KLADPFDYGGGLINPEKVTHPGLIYDMGIDDYLHYLCSAEYDDDSISKLLGKTYNCTSPK  644

Query  342  FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD N PSITIP L   +T+TRTV NVGP  S Y+ ++E P GI + VKP TL F  N
Sbjct  645  PSMLDFNLPSITIPSLTGEVTVTRTVRNVGPARSVYRPVIESPLGIELDVKPKTLVFGSN  704

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTKY  31
            + KI+F+V + + H  NT FYFGSL W DGVHNV IP+SV+TK+
Sbjct  705  ITKITFSVRVKSSHRVNTDFYFGSLCWTDGVHNVTIPVSVRTKF  748



>ref|XP_011038008.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
 ref|XP_011038009.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=775

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 140/240 (58%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D   + S Y   SGTSMATPH++GI ALLKA HPDWSPA IKSA VTTAW 
Sbjct  530  NILAATSPLD-RFQDSGYVMHSGTSMATPHISGITALLKAMHPDWSPAAIKSAFVTTAWI  588

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             +  SG PIF EG  + KLAD FDYGGGI NPN A  PGLVYDM + DYVN LCAM Y++
Sbjct  589  NN-PSGFPIFAEGSPL-KLADPFDYGGGIANPNGAAHPGLVYDMGSDDYVNYLCAMDYNN  646

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G+ T C  +G SIL++N PSITIP+L+  +TLTRTVTN G  NS Y+V++E P
Sbjct  647  TAISRLTGKPTVCPTEGPSILNINLPSITIPNLRNSVTLTRTVTNAGASNSIYRVVIEAP  706

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
                V V+P  L F+   KK +F+VT++T +  NTG++FGS+ W DGVH VR P+SV+T+
Sbjct  707  FCCSVSVEPHVLVFNHTTKKNTFSVTVNTTYQVNTGYFFGSITWIDGVHTVRSPLSVRTE  766



>ref|XP_010529409.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Tarenaya 
hassleriana]
Length=761

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 170/240 (71%), Gaps = 5/240 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL+A  P +     + +   +GTSM+TP ++GI ALLKA HP WSPA I+SA+VTTAW T
Sbjct  519  ILSALSPDNDKAD-NGFGMETGTSMSTPVISGIAALLKALHPRWSPAAIRSAMVTTAWRT  577

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
               SGEPIF EG +  KLAD FDYGGG++NP +A KPGLVYDM  +DYV+ LC+ GY+  
Sbjct  578  S-PSGEPIFAEGSS-KKLADPFDYGGGLVNPEKAAKPGLVYDMFMSDYVHYLCSTGYNDS  635

Query  387  AISIIAGQTTSC--HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
            +IS + G+T +C   +  SILDVN PSITIPD+K  + + RTVTNVGP NS Y+ ++EPP
Sbjct  636  SISNVVGETVTCPTDRKPSILDVNLPSITIPDIKDEVLVRRTVTNVGPVNSVYEAVIEPP  695

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI V   P  L F    K+++F V IST H  NTG+ FGSL W DGVH+VRIP+SV+T+
Sbjct  696  LGINVEATPKKLVFDSRNKRVTFVVKISTRHEVNTGYLFGSLTWTDGVHDVRIPLSVRTR  755



>gb|AAF31277.1|AC006424_6 Second of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
Length=763

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P+D  +    +   SGTSMA P ++G++ALLK+ HPDWSPA  +SAIVTTAW 
Sbjct  518  SILAATSPND-TLNAGGFVMRSGTSMAAPVISGVIALLKSLHPDWSPAAFRSAIVTTAWR  576

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE I  E  ++ K+ D FDYGGG++NP +A +PGL+ DM + DYV  LC+ GY+ 
Sbjct  577  TD-PFGEQIAAESSSL-KVPDPFDYGGGLVNPEKAAEPGLILDMDSQDYVLYLCSAGYND  634

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP +S YKV+VEPP
Sbjct  635  SSISRLVGKVTVCSNPKPSVLDINLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVLVEPP  694

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI VVV P TL F+   K +SF V +ST H  NTGFYFGSL W D +HNV IP+SV+T+
Sbjct  695  LGIQVVVTPETLVFNSKTKSVSFTVIVSTTHKINTGFYFGSLTWTDSIHNVVIPVSVRTQ  754



>ref|NP_564413.2| subtilase family protein [Arabidopsis thaliana]
 gb|AEE31543.1| subtilase family protein [Arabidopsis thaliana]
Length=773

 Score =   258 bits (659),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P+D  +    +   SGTSMA P ++G++ALLK+ HPDWSPA  +SAIVTTAW 
Sbjct  528  SILAATSPND-TLNAGGFVMRSGTSMAAPVISGVIALLKSLHPDWSPAAFRSAIVTTAWR  586

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE I  E  ++ K+ D FDYGGG++NP +A +PGL+ DM + DYV  LC+ GY+ 
Sbjct  587  TD-PFGEQIAAESSSL-KVPDPFDYGGGLVNPEKAAEPGLILDMDSQDYVLYLCSAGYND  644

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP +S YKV+VEPP
Sbjct  645  SSISRLVGKVTVCSNPKPSVLDINLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVLVEPP  704

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI VVV P TL F+   K +SF V +ST H  NTGFYFGSL W D +HNV IP+SV+T+
Sbjct  705  LGIQVVVTPETLVFNSKTKSVSFTVIVSTTHKINTGFYFGSLTWTDSIHNVVIPVSVRTQ  764



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 171/239 (72%), Gaps = 5/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            ILAA  P +  +    +  +SGTSMATP ++G++ALLKA HPDWSPA  +SAIVTTAW T
Sbjct  512  ILAATSP-NSTLSAGGFAILSGTSMATPAISGVIALLKALHPDWSPAAFRSAIVTTAWRT  570

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D   GE IF EG + SK+AD FDYGGG++NP +A +PGL+YDM + DY   LC+ GY+  
Sbjct  571  D-PFGEQIFAEG-SFSKVADPFDYGGGLVNPEKAAEPGLIYDMGSEDYKLYLCSAGYNDS  628

Query  387  AISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            +IS + G+ T C +   S+LDVN PSITIP+LK  +TLTRTVTNVGP +S YKV+VEPP 
Sbjct  629  SISQLVGEVTVCSNPKPSVLDVNLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVVVEPPL  688

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+IVVV P  L F+   K +SF V +ST H  NTG Y  SL W D VHNV IP+SV+T+
Sbjct  689  GVIVVVTPEILVFNSKFKSVSFTVRVSTTHKINTG-YXSSLTWTDSVHNVIIPVSVRTQ  746



>ref|XP_010529408.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Tarenaya 
hassleriana]
Length=765

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 170/240 (71%), Gaps = 5/240 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL+A  P +     + +   +GTSM+TP ++GI ALLKA HP WSPA I+SA+VTTAW T
Sbjct  523  ILSALSPDNDKAD-NGFGMETGTSMSTPVISGIAALLKALHPRWSPAAIRSAMVTTAWRT  581

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
               SGEPIF EG +  KLAD FDYGGG++NP +A KPGLVYDM  +DYV+ LC+ GY+  
Sbjct  582  S-PSGEPIFAEGSS-KKLADPFDYGGGLVNPEKAAKPGLVYDMFMSDYVHYLCSTGYNDS  639

Query  387  AISIIAGQTTSC--HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
            +IS + G+T +C   +  SILDVN PSITIPD+K  + + RTVTNVGP NS Y+ ++EPP
Sbjct  640  SISNVVGETVTCPTDRKPSILDVNLPSITIPDIKDEVLVRRTVTNVGPVNSVYEAVIEPP  699

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI V   P  L F    K+++F V IST H  NTG+ FGSL W DGVH+VRIP+SV+T+
Sbjct  700  LGINVEATPKKLVFDSRNKRVTFVVKISTRHEVNTGYLFGSLTWTDGVHDVRIPLSVRTR  759



>ref|XP_010455450.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score =   258 bits (658),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+  ++    +  +SGTSM+TP V+G+V LLK+ HPDWSPA IKSAIVTTAW 
Sbjct  518  NILAAISPNS-SLNDGGFAMMSGTSMSTPVVSGVVVLLKSLHPDWSPAAIKSAIVTTAWK  576

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG+INP +A  PGL+YDM+T DY+  LC+  YS 
Sbjct  577  TD-PSGEPIFADGSS-RKLADPFDYGGGLINPEKAVNPGLIYDMTTDDYILYLCSAEYSD  634

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+L+  +T  RTVTNVGP  S YKV+++PP
Sbjct  635  VSISRVLGKATVCPNPKPSVLDLNLPSITIPNLRDEVTFKRTVTNVGPLKSVYKVVIDPP  694

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P+ L F     K+SF V +ST H  NTG+YFGSL W + +HNV IP+SV+T+
Sbjct  695  TGVNVTVTPTELVFDSTNTKLSFTVRVSTTHKVNTGYYFGSLTWTNDLHNVVIPVSVRTQ  754



>gb|AAL24366.1| subtilisin proteinase-like [Arabidopsis thaliana]
 gb|AAM91203.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=703

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 174/240 (73%), Gaps = 5/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P +P  + + +  +SGTSM+TP V+GI+ALLK+ HP WSPA ++SA+VTTAW 
Sbjct  463  SILAAISPLNPEEQ-NGFGLLSGTSMSTPVVSGIIALLKSLHPKWSPAAVRSALVTTAWR  521

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+  +C+ GY+ 
Sbjct  522  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIVDYIKYMCSAGYND  579

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C     S+LD+N PSITIP+L++ +TLTRTVTNVGP  S Y+ ++E P
Sbjct  580  SSISRVLGKKTNCPIPKPSMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYRAVIESP  639

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL F    K++ +F+V   T H  NTG++FGSL W+DGVH+V IP+SVKT
Sbjct  640  LGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVIIPVSVKT  699



>ref|XP_010436973.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=758

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 136/244 (56%), Positives = 174/244 (71%), Gaps = 5/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+  ++    +  +SGTSMATP V G+V LL++ +P WSP+ IKSAIVTTAW 
Sbjct  512  NILAAISPNS-SINDGGFAMMSGTSMATPVVTGVVVLLRSLYPHWSPSAIKSAIVTTAWK  570

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCA-MGYS  394
            TD  SGEPIF +G    KLAD FDYGGG++NP +A +PGL+YDM+  DYV+ LC+   Y+
Sbjct  571  TD-PSGEPIFADGSN-RKLADPFDYGGGLVNPEKAARPGLIYDMTIDDYVSYLCSTYNYN  628

Query  393  SKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
              +IS + G  T C +   S+LD+N PSITIP+LK  +TLTRTVTNVGP NS YKVM++P
Sbjct  629  DASISQVLGNKTVCPNPKPSVLDLNLPSITIPNLKDEVTLTRTVTNVGPLNSIYKVMIDP  688

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            P GI + V P TL F+   K +SF V +ST H  NTG+YFGSL W D +HNV IP+SV+T
Sbjct  689  PIGISMTVTPHTLQFNSTTKIVSFKVRVSTRHKVNTGYYFGSLTWTDNLHNVVIPVSVRT  748

Query  36   KY*E  25
            +  E
Sbjct  749  QILE  752



>ref|XP_010421968.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=759

 Score =   257 bits (657),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 164/219 (75%), Gaps = 3/219 (1%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMATP V G+V LLK+ +P WSPA ++SAIVTTAW TD  SGEPIF +G +  KLAD
Sbjct  534  SGTSMATPVVTGVVVLLKSLYPHWSPAAVRSAIVTTAWKTD-PSGEPIFADGSS-RKLAD  591

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSIL  331
             FDYGGG++NP +A +PGL+YDM+  DYV+ LC+  Y++ +IS +  + T C +   S+L
Sbjct  592  PFDYGGGLVNPEKAARPGLIYDMTIADYVSYLCSTYYNNVSISQVLEKKTVCPNPKPSVL  651

Query  330  DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
            D+N PSITIP+LK  +TLTRTVTNVGP NS YKVM++PP G+ + V P TL FS   K +
Sbjct  652  DLNLPSITIPNLKDEVTLTRTVTNVGPLNSIYKVMIDPPIGVSMTVTPDTLEFSSTTKIV  711

Query  150  SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            SF V +ST H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  712  SFKVRVSTRHKVNTGYYFGSLTWTDSVHNVVIPVSVRTQ  750



>emb|CAB36809.1| subtilisin proteinase-like [Arabidopsis thaliana]
 emb|CAB81272.1| subtilisin proteinase-like [Arabidopsis thaliana]
Length=718

 Score =   256 bits (654),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 174/240 (73%), Gaps = 5/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P +P  + + +  +SGTSM+TP V+GI+ALLK+ HP WSPA ++SA+VTTAW 
Sbjct  478  SILAAISPLNPEEQ-NGFGLLSGTSMSTPVVSGIIALLKSLHPKWSPAAVRSALVTTAWR  536

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+  +C+ GY+ 
Sbjct  537  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIVDYIKYMCSAGYND  594

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C     S+LD+N PSITIP+L++ +TLTRTVTNVGP  S Y+ ++E P
Sbjct  595  SSISRVLGKKTNCPIPKPSMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYRAVIESP  654

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL F    K++ +F+V   T H  NTG++FGSL W+DGVH+V IP+SVKT
Sbjct  655  LGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVIIPVSVKT  714



>ref|NP_567361.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40047.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78177.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82895.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score =   257 bits (657),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 163/221 (74%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F+SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  548  FLSGTSMAAPTISGVVALLKALHRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKL  605

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T C +   S
Sbjct  606  ADPFDYGGGLVNPEKAAKPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSNPKPS  665

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TLTRT+TNVG   S YKV++EPP GI V V P TL F+   K
Sbjct  666  VLDFNLPSITIPNLKDEVTLTRTLTNVGQLESVYKVVIEPPIGIQVTVTPETLLFNSTTK  725

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            ++SF V +ST H  NTG++FGSL W+D +HNV IP+SV+T+
Sbjct  726  RVSFKVKVSTTHKINTGYFFGSLTWSDSLHNVTIPLSVRTQ  766



>ref|XP_006397045.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
 gb|ESQ38498.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
Length=777

 Score =   257 bits (656),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 132/230 (57%), Positives = 164/230 (71%), Gaps = 8/230 (3%)
 Frame = -2

Query  705  STYN-----FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIF  541
            ST+N      +SGTSMA P ++G+VALLK  H DWSPA I+SAIVTTAW TD   GE IF
Sbjct  541  STFNDRGFIMLSGTSMAAPVISGVVALLKTLHRDWSPAAIRSAIVTTAWRTD-PFGEQIF  599

Query  540  NEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQT  361
             +G    KLAD FDYGGG++NP +A KPGLVYD+   DYV  LC+ GY+  +IS + G++
Sbjct  600  ADGSP-RKLADPFDYGGGLVNPEKAAKPGLVYDLGLEDYVLYLCSAGYNESSISQLVGKS  658

Query  360  TSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPS  184
            T C     S+LD N PSITIP+L   +TLTR++TNVGP NS YKV VEPP G  V V P 
Sbjct  659  TVCSNPRPSVLDFNLPSITIPNLNEEVTLTRSLTNVGPLNSVYKVAVEPPLGFQVTVTPE  718

Query  183  TLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            TL F+   K++SF VT+ST H  NTG+YFGSL W+D VH+V IP+SV+T+
Sbjct  719  TLVFNSATKRVSFQVTVSTTHKINTGYYFGSLTWSDSVHDVTIPLSVRTQ  768



>ref|XP_002893749.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70008.1| hypothetical protein ARALYDRAFT_473479 [Arabidopsis lyrata subsp. 
lyrata]
Length=717

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 169/240 (70%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       +   SGTSM+TP VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  472  NILAATSPND-TFYDRGFAMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWR  530

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A KPGLVYDM   DYV  LC++GY+ 
Sbjct  531  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTD  588

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVGP  S YK ++E P
Sbjct  589  SSITRLVRKKTVCANPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGPVGSVYKAVIEAP  648

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P TL F+   +K+SF V + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  649  MGVNVTVTPRTLVFNAKTRKLSFKVRVITNHRVNTGYYFGSLTWTDSVHNVVIPVSVRTQ  708



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score =   262 bits (670),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/237 (57%), Positives = 167/237 (70%), Gaps = 4/237 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D       ++ ++GTSMA P ++G+VALLKA HPDWSPA  +SAIVTTAW 
Sbjct  469  SILAATSP-DSNSSAGGFDILAGTSMAAPVISGVVALLKAMHPDWSPAAFRSAIVTTAWR  527

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGG++NP +A  PGL+YDM   DY+  LC+ GY+ 
Sbjct  528  TD-PFGEQIFAEGSS-RKVADPFDYGGGLVNPEKAADPGLIYDMGPKDYIIYLCSAGYND  585

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + GQ T C +   S+LDVN PS+TIP+LK  + LTRTVTNVGP NS YKV+VEPP
Sbjct  586  SSISQLVGQVTVCSNPKPSVLDVNLPSLTIPNLKEEVNLTRTVTNVGPVNSVYKVVVEPP  645

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISV  43
             G+ VVV P  L F+   K +SF V +ST H  NTGFYFGSLIW D VHNV IP+ +
Sbjct  646  LGVQVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGFYFGSLIWRDSVHNVTIPVHI  702


 Score =   232 bits (592),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/239 (51%), Positives = 160/239 (67%), Gaps = 17/239 (7%)
 Frame = -2

Query  750   NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             +ILAA  P +       +  +SGTSMATP ++G++ALLK+ HPDWSPA  +SAIVTTAW 
Sbjct  1194  SILAATSP-NATFNAGGFVMLSGTSMATPAISGVLALLKSLHPDWSPAAFRSAIVTTAWR  1252

Query  570   TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             TD   GE +  EG +  K+AD FDYGGG++NP +A +PGL+YDM   DY+  LC++    
Sbjct  1253  TD-PFGEQLPAEGSS-RKVADPFDYGGGLVNPEKAAEPGLIYDMGPKDYILYLCSV----  1306

Query  390   KAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
                           +  S+LD+N PSITIP+LK  + LTRTVTNVGP +S YKV+VEPP 
Sbjct  1307  ----------VCTDQKPSVLDMNLPSITIPNLKDEVILTRTVTNVGPVHSVYKVVVEPPL  1356

Query  210   GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ VVV P  L F+   K +SF V +ST H  NTG+YFGSLIW+D V  V IP+SV+T+
Sbjct  1357  GVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTGYYFGSLIWSDSVRKVTIPVSVRTQ  1415



>ref|XP_010478713.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=645

 Score =   254 bits (649),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 170/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       ++  SGTSM+TP VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  400  NILAATSPND-TFYDRGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWR  458

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A KPGLVYDM   DYV  LC++GY+ 
Sbjct  459  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTD  516

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVG   S YK ++E P
Sbjct  517  SSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGTVGSVYKAVIEAP  576

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V PSTL F+   +K+SF V + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  577  MGVNVTVTPSTLVFNAKTRKLSFKVRVLTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQ  636



>ref|NP_567633.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AAO00797.1| subtilisin proteinase - like [Arabidopsis thaliana]
 gb|AEE84485.1| Subtilase family protein [Arabidopsis thaliana]
Length=766

 Score =   256 bits (655),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 174/240 (73%), Gaps = 5/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P +P  + + +  +SGTSM+TP V+GI+ALLK+ HP WSPA ++SA+VTTAW 
Sbjct  526  SILAAISPLNPEEQ-NGFGLLSGTSMSTPVVSGIIALLKSLHPKWSPAAVRSALVTTAWR  584

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+  +C+ GY+ 
Sbjct  585  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIVDYIKYMCSAGYND  642

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T+C     S+LD+N PSITIP+L++ +TLTRTVTNVGP  S Y+ ++E P
Sbjct  643  SSISRVLGKKTNCPIPKPSMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYRAVIESP  702

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL F    K++ +F+V   T H  NTG++FGSL W+DGVH+V IP+SVKT
Sbjct  703  LGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNTGYFFGSLTWSDGVHDVIIPVSVKT  762



>ref|XP_006391365.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
 gb|ESQ28651.1| hypothetical protein EUTSA_v10018142mg [Eutrema salsugineum]
Length=791

 Score =   256 bits (655),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 170/240 (71%), Gaps = 10/240 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            ILAA +PS PA     Y F+SGTSMATP V+GIVAL++  HPDWSPA I+SA+VTTA+ +
Sbjct  554  ILAA-VPS-PA----GYEFMSGTSMATPVVSGIVALVRKKHPDWSPAAIRSALVTTAFQS  607

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D  SGEPI  EG    KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY  +
Sbjct  608  D-PSGEPIAAEGSP-RKLADPFDYGGGLVNPGKVADPGLVYDMGYNEYVHYLCSAGYDDR  665

Query  387  AISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            +IS + G+  +C     S+LDVN PSITIP L   IT+TRTVTNVGP  S YK ++EPP+
Sbjct  666  SISKLLGKNYTCPSPTPSMLDVNLPSITIPYLSEEITITRTVTNVGPVGSVYKALIEPPQ  725

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVKTK  34
            GI V V P TL F  N KKI+F V +ST H  NT + FGSL W D G HNVRIP+SV+T+
Sbjct  726  GINVQVTPETLEFGSNAKKITFKVKVSTTHRTNTDYLFGSLTWTDNGAHNVRIPLSVRTR  785



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score =   256 bits (654),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 131/240 (55%), Positives = 173/240 (72%), Gaps = 5/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP    + +   SGTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTTAW 
Sbjct  532  SILAAVSPLDPDA-FNGFGLYSGTSMSTPVVSGIIALLKSLHPNWSPAAMRSALVTTAWR  590

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF +G    KLAD FDYGGG++NP++A +PGLVYDM   DY+N +C+ GY  
Sbjct  591  TS-PSGEPIFAQGSN-KKLADPFDYGGGLVNPDKAAQPGLVYDMGIKDYINYMCSAGYID  648

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     SILD+N PSITIP+L++ +TLTRTVTNVGP  S YK ++E P
Sbjct  649  SSISRVLGKKTKCTIPKPSILDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIESP  708

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL F+   K++ +F+V   T H  N+G++FGSL W DGVH+V IP+SVKT
Sbjct  709  LGITLTVNPTTLVFNSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVIIPVSVKT  768



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 170/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       ++  SGTSM+TP VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  526  NILAATSPND-TFYDRGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWR  584

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A KPGLVYDM   DYV  LC++GYS 
Sbjct  585  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAAKPGLVYDMGVKDYVLYLCSVGYSD  642

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVG   S YK ++E P
Sbjct  643  SSITRLVSKKTVCGNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGTVGSVYKAVIEAP  702

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V PSTL F+   +K+SF + + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  703  MGVNVTVTPSTLVFNAKTRKLSFKIRVLTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQ  762



>ref|XP_010499844.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010499845.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=771

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 170/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       ++  SGTSM+TP VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  526  NILAATSPND-TFYDRGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWR  584

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A KPGLVYDM   DYV  LC++GY+ 
Sbjct  585  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTD  642

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVGP  S YK ++E P
Sbjct  643  SSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGPVGSVYKAVIEAP  702

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V PS L F+   +K+SF V + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  703  MGVNVNVTPSALVFNAKTRKLSFKVRVVTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQ  762



>ref|XP_010455451.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=1533

 Score =   261 bits (667),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 162/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  690   ISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLA  511
             +SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KLA
Sbjct  1307  LSGTSMAAPVISGVVALLKARHRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKLA  1364

Query  510   DAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSI  334
             D FDYGGG++NP +A KPGLVYD+   DYV+ +C++GY+  +IS + G+ T C     S+
Sbjct  1365  DPFDYGGGLVNPEKAAKPGLVYDLGLEDYVHYMCSVGYNESSISQLVGKGTVCSIPKPSV  1424

Query  333   LDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKK  154
             LD N PSITIP+LK  +TLTRT+TNVGP NS YKVMVEPP GI V V P TL F+   K+
Sbjct  1425  LDFNLPSITIPNLKDVVTLTRTLTNVGPLNSIYKVMVEPPLGIQVTVSPETLVFNSTTKR  1484

Query  153   ISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              SF V +ST H  NTG+YFGSL W+D  HNV IP+SV+T+
Sbjct  1485  ASFKVRVSTTHKINTGYYFGSLTWSDSEHNVTIPLSVRTQ  1524


 Score =   243 bits (620),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 149/209 (71%), Gaps = 3/209 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            +N +SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    
Sbjct  549  FNMMSGTSMAAPAISGVVALLKALHRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-R  606

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKG  343
            KLAD FDYGGG++NP +A KPGLVYD+   DYV  +C+ GY+  +IS + G+ T C +  
Sbjct  607  KLADPFDYGGGLVNPEKAAKPGLVYDLGLEDYVLYMCSAGYNESSISQLVGKGTVCSNPK  666

Query  342  FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD N PSITIP+LK  +TLTRT+TNVGP  S Y+V VEPP G  V V P TL F   
Sbjct  667  PSILDFNLPSITIPNLKDEVTLTRTLTNVGPLKSVYRVKVEPPLGFQVTVTPKTLVFKAK  726

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWND  76
             K++SF V IST H  NTG+YFGSL W+D
Sbjct  727  TKRVSFKVRISTTHKINTGYYFGSLTWSD  755



>ref|XP_009105192.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 160/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSMATP V GIVALLK   PDWSPA I+SA+VTTA+ TD  SGEPI  EG    
Sbjct  532  YEFMSGTSMATPVVTGIVALLKQKRPDWSPAAIRSALVTTAFQTD-PSGEPIAAEGSP-R  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            K+AD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY   +IS + G+  +C    
Sbjct  590  KIADPFDYGGGLVNPGKVADPGLVYDMGHDEYVHYLCSAGYEDISISKLLGKVYTCPSPT  649

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LDVN PSITIP L + IT+TRTVTNVGP  S YK ++EPP GI + V P TL F PN
Sbjct  650  PSMLDVNLPSITIPYLSQEITITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPN  709

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVKTK  34
             KKI+F V +ST H  NT ++FGSL W D G HNVRIP+SV+T+
Sbjct  710  TKKITFTVKVSTTHRVNTDYHFGSLTWTDNGAHNVRIPLSVRTR  753



>ref|XP_010104913.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC02149.1| Subtilisin-like protease [Morus notabilis]
Length=803

 Score =   256 bits (653),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 142/241 (59%), Positives = 170/241 (71%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P D     + Y   SGTSMATPH++GIVALLKA HP WSPA IKSAI+TTA T
Sbjct  557  NILAAASPLDEFAD-NGYVMHSGTSMATPHISGIVALLKALHPTWSPAAIKSAIITTART  615

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
                SG  IF+EG    KLAD FD+GGGI+NPN A  PGLVYDM T+DY + LCAM Y++
Sbjct  616  A-APSGLTIFSEGSP-QKLADPFDFGGGIVNPNAAADPGLVYDMGTSDYAHYLCAMHYNN  673

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKR-PITLTRTVTNVGPENSTYKVMVEP  217
             AIS + G  T C  +  S+LDVN PSITIP ++  PI +TRTVTNVG  NS Y+  +EP
Sbjct  674  SAISHLIGNLTKCPLQKPSVLDVNLPSITIPSIRTTPIVVTRTVTNVGSPNSIYEATIEP  733

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            P G++V VKP  L F+  ++KISF VTIST H  NT + FGSL W D VH VRIP+SV+T
Sbjct  734  PSGVLVSVKPEFLVFNSTIEKISFQVTISTTHQMNTDYLFGSLTWTDKVHIVRIPLSVRT  793

Query  36   K  34
            +
Sbjct  794  E  794



>ref|NP_001078370.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82897.1| subtilisin-like protease [Arabidopsis thaliana]
Length=722

 Score =   254 bits (649),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 160/221 (72%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+ ALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  495  MLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIVTTAWKTD-PFGEQIFAEGSP-PKL  552

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP ++  PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S
Sbjct  553  ADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPS  612

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   K
Sbjct  613  VLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTK  672

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+ F V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  673  KVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQ  713



>emb|CDY07491.1| BnaA07g25700D [Brassica napus]
Length=759

 Score =   255 bits (651),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 132/224 (59%), Positives = 160/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSMATP V GIVALLK   PDWSPA I+SA+VTTA+ TD  SGEPI  EG    
Sbjct  532  YEFMSGTSMATPVVTGIVALLKQKRPDWSPAAIRSALVTTAFQTD-PSGEPIAAEGSP-R  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            K+AD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY   +IS + G+  +C    
Sbjct  590  KIADPFDYGGGLVNPGKVADPGLVYDMGHDEYVHYLCSAGYEDISISKLLGKVYTCPSPT  649

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LDVN PSITIP L + IT+TRTVTNVGP  S YK ++EPP GI + V P TL F PN
Sbjct  650  PSMLDVNLPSITIPYLSQEITITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPN  709

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVKTK  34
             KKI+F V +ST H  NT ++FGSL W D G HNVRIP+SV+T+
Sbjct  710  TKKITFTVKVSTTHRVNTDYHFGSLTWTDNGAHNVRIPLSVRTR  753



>gb|AAD03431.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 45.8, E=1.1e-11, n=2) [Arabidopsis thaliana]
Length=751

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 160/221 (72%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+ ALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  524  MLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIVTTAWKTD-PFGEQIFAEGSP-PKL  581

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP ++  PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S
Sbjct  582  ADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPS  641

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   K
Sbjct  642  VLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTK  701

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+ F V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  702  KVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQ  742



>ref|XP_010445228.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=875

 Score =   256 bits (655),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 130/241 (54%), Positives = 171/241 (71%), Gaps = 5/241 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP    + +   SGTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTTAW 
Sbjct  633  SILAALSPLDPDAH-NGFGLDSGTSMSTPVVSGIIALLKSLHPNWSPAAMRSALVTTAWR  691

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   +GEPIF EG    KLAD FDYGGG++NP +A  PGLVYDM   DY++ +C+ GY+ 
Sbjct  692  TS-PTGEPIFAEGSN-KKLADPFDYGGGLVNPEKAANPGLVYDMGIKDYISYMCSAGYND  749

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS +  + T C     SI D+N PSITIP+L++ +TLTRTVTNVGP  S YK ++E P
Sbjct  750  SSISRVLSKKTKCQIPEPSIFDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIESP  809

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             G+ + VKP+TL F+    ++ +F+V   T H  NTG++FGSL W DGVHNV IP+SVKT
Sbjct  810  LGVTLTVKPTTLVFNSAANRVLTFSVKAKTSHKVNTGYFFGSLTWTDGVHNVTIPVSVKT  869

Query  36   K  34
            K
Sbjct  870  K  870



>dbj|BAE98849.1| subtilisin-like protease -like protein [Arabidopsis thaliana]
Length=722

 Score =   254 bits (649),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 160/221 (72%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+ ALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  495  MLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIVTTAWKTD-PFGEQIFAEGSP-PKL  552

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP ++  PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S
Sbjct  553  ADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPS  612

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   K
Sbjct  613  VLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTK  672

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+ F V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  673  KVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQ  713



>ref|XP_010528996.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=756

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 165/240 (69%), Gaps = 7/240 (3%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA     P      Y F SGTSMATP VAGIVALLK  HP WSPA IKSA++TTAW 
Sbjct  517  NILAAI----PGPGAGAYEFYSGTSMATPAVAGIVALLKMKHPHWSPAAIKSALITTAWR  572

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPI +E  +  K+AD FDYGGG++NP  A  PGLVYD+   DY + LCA G+  
Sbjct  573  TD-PSGEPIISE-TSPRKMADPFDYGGGLVNPEGASDPGLVYDLGLHDYAHYLCAEGFDD  630

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I  +  +  +C +   S+LDVN PSITIP L   +T+TRTVTNVGP +S Y+ +VE P
Sbjct  631  MSIRRLLRKHKACPNPRPSMLDVNMPSITIPYLNEDVTITRTVTNVGPVDSVYRAVVEAP  690

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI +VVKP TL F+   KK+S+ V++ST H  NTG+ FGSL W DG HNV IP+SV+TK
Sbjct  691  LGIKLVVKPETLVFNSQTKKVSYTVSVSTSHKVNTGYLFGSLTWTDGTHNVAIPVSVRTK  750



>ref|XP_010478712.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=771

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 170/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       ++  SGTSM+TP VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  526  NILAATSPND-TFYDRGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWR  584

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A KPGLVYDM   DYV  LC++GY+ 
Sbjct  585  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAAKPGLVYDMGVNDYVLYLCSVGYTD  642

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVG   S YK ++E P
Sbjct  643  SSITRLVRKKTVCGNPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGTVGSVYKAVIEAP  702

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V PSTL F+   +K+SF V + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  703  MGVNVTVTPSTLVFNAKTRKLSFKVRVLTNHRVNTGYYFGSLTWTDSVHNVVIPLSVRTQ  762



>ref|XP_010554964.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=762

 Score =   254 bits (650),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 168/240 (70%), Gaps = 7/240 (3%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA   S+P     T++ ++GTSM+TP V+GIVALLK  HPDWSPA I+SA+VTTAW 
Sbjct  523  NILAASTGSNP----RTFDLMTGTSMSTPAVSGIVALLKVKHPDWSPAAIRSALVTTAWR  578

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE I  EG +  K A  FD+GGGI+NP RA  PGLVYDM   DYV+ LC+ GY  
Sbjct  579  TD-PFGETIMTEGAS-PKPAGPFDFGGGIMNPERAAYPGLVYDMGYEDYVHYLCSAGYDD  636

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
            KAIS + G+  +C +   S+LDVN PSIT+PDL+  + +TRTVTNVGP +S YK ++E P
Sbjct  637  KAISGLLGKAHTCPNPKPSMLDVNLPSITVPDLREDVVITRTVTNVGPADSVYKAVIESP  696

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + V P +L F+   KK++F V +S+ H  NT FYFGSL W DG  NV IP+SV+TK
Sbjct  697  SGINLEVNPQSLVFNSATKKVTFKVKVSSTHKVNTEFYFGSLTWTDGTTNVTIPLSVRTK  756



>ref|XP_002874634.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50893.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=781

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/219 (58%), Positives = 162/219 (74%), Gaps = 3/219 (1%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KLAD
Sbjct  556  SGTSMAAPVISGVVALLKAMHRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKLAD  613

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFSIL  331
             FDYGGG++NP +A KPGLVYD+   DY   +C++GY+  +IS + G+ T C +   S+L
Sbjct  614  PFDYGGGLVNPEKAAKPGLVYDLGLEDYALYMCSVGYNETSISQLVGKGTVCSNPKPSVL  673

Query  330  DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
            D N PSITIP+LK  +TLT+T+TNVGP  S YKV++EPP G++V V P TL F+   K++
Sbjct  674  DFNLPSITIPNLKEEVTLTKTLTNVGPVESVYKVVIEPPLGVVVTVTPETLVFNSTTKRV  733

Query  150  SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            SF V +ST H  NTG++FGSL W+D +HNV IP+SV+T+
Sbjct  734  SFKVRVSTKHKINTGYFFGSLTWSDSLHNVTIPLSVRTQ  772



>ref|NP_567362.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AAM91616.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE82896.1| subtilisin-like protease [Arabidopsis thaliana]
Length=778

 Score =   255 bits (651),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 160/221 (72%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+ ALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  551  MLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIVTTAWKTD-PFGEQIFAEGSP-PKL  608

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP ++  PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S
Sbjct  609  ADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPS  668

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   K
Sbjct  669  VLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTK  728

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+ F V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  729  KVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQ  769



>emb|CAB40021.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
 emb|CAB78178.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=803

 Score =   255 bits (652),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 160/221 (72%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+ ALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  576  MLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIVTTAWKTD-PFGEQIFAEGSP-PKL  633

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP ++  PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S
Sbjct  634  ADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPS  693

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   K
Sbjct  694  VLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTK  753

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+ F V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  754  KVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQ  794



>ref|NP_001190697.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82898.1| subtilisin-like protease [Arabidopsis thaliana]
Length=794

 Score =   255 bits (651),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 161/221 (73%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+ ALLKA H DWSPA I+SAIVTTAW TD   GE IF EG +  KL
Sbjct  567  MLSGTSMAAPAISGVAALLKALHRDWSPAAIRSAIVTTAWKTD-PFGEQIFAEG-SPPKL  624

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP ++  PGLVYDM   DYV  +C++GY+  +IS + G+TT C +   S
Sbjct  625  ADPFDYGGGLVNPEKSANPGLVYDMGLEDYVLYMCSVGYNETSISQLIGKTTVCSNPKPS  684

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +T+TRTVTNVGP NS Y+V VEPP G  V V P TL F+   K
Sbjct  685  VLDFNLPSITIPNLKDEVTITRTVTNVGPLNSVYRVTVEPPLGFQVTVTPETLVFNSTTK  744

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+ F V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  745  KVYFKVKVSTTHKTNTGYYFGSLTWSDSLHNVTIPLSVRTQ  785



>ref|XP_006413751.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
 gb|ESQ55204.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
Length=766

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 137/245 (56%), Positives = 170/245 (69%), Gaps = 11/245 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYN---FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTT  580
            NILAA  P    + +  YN     +GTSM+TP V+GIVALLK+ HP WSPA I+SA+VTT
Sbjct  524  NILAALSP----LHLGAYNGFGLETGTSMSTPVVSGIVALLKSLHPHWSPAAIRSALVTT  579

Query  579  AWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG  400
            AW T   SGEPIF EG    KLAD FDYGGG++NP +A KPGLVYDM    Y++ +C+ G
Sbjct  580  AWRTS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIEGYISYMCSAG  637

Query  399  YSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMV  223
            Y+  +IS + G+ T C     SILD+N PSITIP+L+  +TLTRTVTNVGP  S YK +V
Sbjct  638  YNDSSISRVLGKKTICPTPEPSILDINLPSITIPNLEEEVTLTRTVTNVGPIKSVYKAVV  697

Query  222  EPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPIS  46
            E P GI + V P+TL FS   K++ +F V     H  NTG++FGSL W DGVHNV IP+S
Sbjct  698  ESPLGINLTVSPTTLVFSSATKRVLTFTVKAKRSHKVNTGYFFGSLTWTDGVHNVTIPVS  757

Query  45   VKTKY  31
            VKTK+
Sbjct  758  VKTKF  762



>emb|CDX98690.1| BnaA03g44750D [Brassica napus]
Length=696

 Score =   253 bits (645),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 166/240 (69%), Gaps = 15/240 (6%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP      +   SGTSM+TP V+GI+ALLK+ HPDWSPA  +SA+VTTAW 
Sbjct  466  SILAALSPFDPNGH-DGFGLASGTSMSTPVVSGIIALLKSLHPDWSPAAFRSALVTTAWR  524

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP RA  PGLVYDM   DY+N +C+ GY+ 
Sbjct  525  T-SPSGEPIFAEGSN-KKLADPFDYGGGLVNPQRAAHPGLVYDMGIEDYINYMCSKGYND  582

Query  390  KAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
             +IS             SILD+N PSITIP++++ +TLTR+VTNVGP  S YK ++E P 
Sbjct  583  SSISRP-----------SILDMNLPSITIPNIEKEVTLTRSVTNVGPIKSVYKAVIESPL  631

Query  210  GIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            GI + V P+TL FS   KK+ SF V   T H  NTG++FGSL W DGVH+V+IP+SV+T+
Sbjct  632  GITLTVHPTTLVFSSEDKKVLSFTVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQTR  691



>ref|XP_009344068.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Pyrus x 
bretschneideri]
Length=758

 Score =   254 bits (648),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 138/239 (58%), Positives = 168/239 (70%), Gaps = 4/239 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAAY P    V    Y   SGTS++TPHV+GIVALLK  HP WSPA I+SA+VTTA  
Sbjct  515  NILAAYSPLRSYVD-GGYAVKSGTSLSTPHVSGIVALLKVMHPSWSPAAIRSALVTTASR  573

Query  570  TDRS-SGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS  394
               S S  PIF EG    KLA+ FDYGGGI+NPN+A  PGLVYDM   DY+N LCA+GY+
Sbjct  574  NGPSCSILPIFAEGSP-RKLANPFDYGGGIVNPNKAAYPGLVYDMGREDYINFLCAVGYN  632

Query  393  SKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            + A+S I GQ T+C     S+LDVN PSITIP+L+  I LTR+VTNVGP +S YKV ++P
Sbjct  633  TSALSQIVGQVTACSSTKPSVLDVNLPSITIPNLRDNINLTRSVTNVGPVDSVYKVDIDP  692

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G+ V V+P TL F+ +VK I+F V +ST H  NTG+YFGSL W DG H V   +SV+
Sbjct  693  PLGVNVAVRPDTLVFNSSVKTITFTVAVSTTHHVNTGYYFGSLTWTDGKHVVTSAVSVR  751



>ref|NP_193895.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84484.1| Subtilase family protein [Arabidopsis thaliana]
Length=733

 Score =   253 bits (645),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 169/240 (70%), Gaps = 5/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P DP    + +   SGTSM+TP V+GI+ LLK+ HP WSPA ++SA+VTTAW 
Sbjct  493  SILAAVSPLDPGA-FNGFKLHSGTSMSTPVVSGIIVLLKSLHPKWSPAAMRSALVTTAWR  551

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF +G    KLAD FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+ 
Sbjct  552  TS-PSGEPIFAQGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIKDYINYMCSAGYND  609

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     S+LD+N PSITIP+L++ +TLTRTVTNVGP  S Y+ ++E P
Sbjct  610  SSISRVLGKKTKCPIPKPSMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYRAVIESP  669

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+ L F    K++ +F+V   T H  N+G++FGSL W DGVH+V IP+SVKT
Sbjct  670  LGITLTVNPTILVFKSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVTIPVSVKT  729



>emb|CDX98693.1| BnaA03g44780D [Brassica napus]
Length=765

 Score =   253 bits (646),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 132/242 (55%), Positives = 169/242 (70%), Gaps = 6/242 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA    +P      +  +SGTSM+TP V+GI+ALLK+ HP WSPA  +SA+VTTAW 
Sbjct  522  SILAALSRRNPQAH-DGFGLLSGTSMSTPVVSGIIALLKSLHPTWSPAAFRSALVTTAWR  580

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP RA  PGLVYDM   DY++ +C+ GY  
Sbjct  581  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPQRASNPGLVYDMGIQDYIDYMCSAGYKD  638

Query  390  KAIS-IIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
             +IS II  +T  C     S+LD+N PSITIP+L++ +TLTRTVTNVGP  S YK ++E 
Sbjct  639  SSISRIIRKKTNKCPTPKPSVLDMNLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIES  698

Query  216  PKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P GI + V P+TL FS   K++ +F V   T H  NTG++FGSL W DGVH+V+IP+SV+
Sbjct  699  PLGITLTVTPNTLVFSSAAKRVLTFKVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPVSVQ  758

Query  39   TK  34
            TK
Sbjct  759  TK  760



>ref|XP_002874635.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50894.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   253 bits (647),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 159/221 (72%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  547  MLSGTSMAAPAISGVVALLKALHRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-PKL  604

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A  PGLVYD+   DY+  LC++GY+  +IS + G+ T C +   S
Sbjct  605  ADPFDYGGGLVNPEKAANPGLVYDLGLEDYILYLCSVGYNETSISQLVGKRTVCSNPKPS  664

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            ILD N PSITIP+LK  +TLTRT+TNVG   S YKV VEPP G  V V P TL F+   K
Sbjct  665  ILDFNLPSITIPNLKDEVTLTRTLTNVGLLKSVYKVAVEPPLGFKVTVTPETLVFNTRTK  724

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            ++SF V +ST H  NTGFYFGSL W+D +HNV IP+SV+T+
Sbjct  725  RVSFKVKVSTKHKINTGFYFGSLTWSDSMHNVTIPLSVRTQ  765



>emb|CDX94044.1| BnaC07g36780D [Brassica napus]
Length=727

 Score =   252 bits (643),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 172/245 (70%), Gaps = 12/245 (5%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D +     +   +GTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTTAW 
Sbjct  484  SILAALSPFD-SREHDGFGLDTGTSMSTPVVSGIIALLKSPHPNWSPAAVRSALVTTAWR  542

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T   SGEPIF EG    KLAD FDYGGG++NP RA KPGLVYDM   DY+N +C+ GY+ 
Sbjct  543  TS-PSGEPIFAEGSN-KKLADPFDYGGGLVNPQRASKPGLVYDMGIQDYINYMCSAGYND  600

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS   G  T C +   SILD+N PSITIP++++ +TLTRTVTNVGP  S YK ++E P
Sbjct  601  SSIS---GIITKCPNPKPSILDMNLPSITIPNIEKEVTLTRTVTNVGPIKSVYKAVIESP  657

Query  213  KGIIVVVKPSTLNFSPNVKKI-----SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPI  49
             GI + V P+TL FS   K++     +F V   T H  NTG++FGSL W DGVH+V+IP+
Sbjct  658  LGITLTVTPNTLVFSSAAKRVLTFKPTFKVKAKTSHKVNTGYFFGSLTWTDGVHDVKIPV  717

Query  48   SVKTK  34
            SV+TK
Sbjct  718  SVQTK  722



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score =   252 bits (644),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 128/242 (53%), Positives = 172/242 (71%), Gaps = 13/242 (5%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P +P  + + +  +SGTSM+TP V+GI+ALLK+ HP+WSPA ++SA+VTT   
Sbjct  526  SILAAISPLNPEQQ-NGFGLLSGTSMSTPVVSGIIALLKSLHPNWSPAAMRSALVTT---  581

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
                  EPIF EG    KLAD FDYGGG++NP +A KPGLVYDM   DY+N +C+ GY+ 
Sbjct  582  ------EPIFAEGSN-KKLADPFDYGGGLVNPEKAAKPGLVYDMGIDDYINYMCSAGYND  634

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     S+LD+N PSITIP+L++ +TLTRTVTNVGP  S YK ++EPP
Sbjct  635  SSISRVLGKKTKCPIPEPSMLDINLPSITIPNLEKEVTLTRTVTNVGPIKSVYKAVIEPP  694

Query  213  KGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
             GI + V P+TL F    K++ +F+V   T H  N+G++FGSL W DGVH+V IP+SVKT
Sbjct  695  LGITLTVNPTTLVFKSAAKRVLTFSVKAKTSHKVNSGYFFGSLTWTDGVHDVIIPVSVKT  754

Query  36   KY  31
            +Y
Sbjct  755  RY  756



>ref|NP_174573.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AAF31279.1|AC006424_8 Fourth of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
 gb|AEE31545.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=734

 Score =   251 bits (641),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 168/240 (70%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       +   SGTSM+ P VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  489  NILAATSPND-TFYDKGFAMKSGTSMSAPVVAGIVALLKSVHPHWSPAAIRSAIVTTAWR  547

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A  PGLVYDM   DY+  LC++GY+ 
Sbjct  548  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAANPGLVYDMGVKDYILYLCSVGYTD  605

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVGP  S YK ++E P
Sbjct  606  SSITGLVSKKTVCANPKPSVLDLNLPSITIPNLAKEVTITRTVTNVGPVGSVYKPVIEAP  665

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V PSTL F+   +K+SF V + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  666  MGVNVTVTPSTLVFNAYTRKLSFKVRVLTNHIVNTGYYFGSLTWTDSVHNVVIPVSVRTQ  725



>ref|XP_009132975.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 169/242 (70%), Gaps = 10/242 (4%)
 Frame = -2

Query  753  TNILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAW  574
            + ILAA +PS+       Y F+SGTSMATP V+GIVALL+   PDWSPA I+SA+VTTA 
Sbjct  520  SGILAA-VPSEEG-----YAFMSGTSMATPVVSGIVALLRQKRPDWSPAAIRSALVTTAL  573

Query  573  TTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS  394
             TD   GEPI  EG    KLA+ FD+GGG++NP +   PGLVYDM + +YV+ LC+ GY 
Sbjct  574  QTD-PFGEPISAEGSP-RKLANPFDFGGGLVNPGKVADPGLVYDMGSDEYVHYLCSAGYE  631

Query  393  SKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            +K+IS + G+  +C     S+LDVN PSITIP L   I LTRTVTNVGP  S YK ++EP
Sbjct  632  NKSISRLLGRIYTCPSPTPSMLDVNVPSITIPYLNEEIILTRTVTNVGPVGSVYKAVIEP  691

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVK  40
            P GI + V P TL F PN KKI+F V +ST H +NT + FGSL W D G HNVRIP+SV+
Sbjct  692  PLGIKLQVSPKTLEFGPNTKKITFTVKVSTTHRWNTDYLFGSLTWTDNGAHNVRIPLSVR  751

Query  39   TK  34
            T+
Sbjct  752  TR  753



>ref|XP_010437025.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=778

 Score =   251 bits (642),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 158/221 (71%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F+SGTSMATP ++G+VALLKA H DWSPA I+SAIVTTAW TD   GE I  EG    KL
Sbjct  551  FLSGTSMATPTISGVVALLKALHHDWSPAAIRSAIVTTAWRTD-PLGEQITAEGSP-RKL  608

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFS  337
             D FDYGGG++NP +A KPGLVYD+   DYV  +C++GY+  +IS + G+ T C     S
Sbjct  609  TDPFDYGGGLVNPEKATKPGLVYDLGLEDYVLYMCSVGYNETSISQLVGKGTVCSIPKPS  668

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TLT+T TNVGP  S Y V VEPP GI V V P TL F+   K
Sbjct  669  VLDFNLPSITIPNLKDEVTLTKTFTNVGPLESVYNVTVEPPLGIQVTVTPETLVFNSTTK  728

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            + SF V +ST H  NTG+YFGSL W+D +HNV IP+SV+T+
Sbjct  729  RASFKVRVSTTHKINTGYYFGSLTWSDSLHNVTIPLSVRTQ  769



>emb|CDX84657.1| BnaA03g15730D [Brassica napus]
Length=759

 Score =   251 bits (641),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 136/242 (56%), Positives = 168/242 (69%), Gaps = 10/242 (4%)
 Frame = -2

Query  753  TNILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAW  574
            + ILAA +PS+       Y F+SGTSMATP V+GIVALL+   PDWSPA I+SA+VTTA 
Sbjct  520  SGILAA-VPSEEG-----YAFMSGTSMATPVVSGIVALLRQKRPDWSPAAIRSALVTTAL  573

Query  573  TTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS  394
             TD   GEPI  EG    KLA  FD+GGG++NP +   PGLVYDM + +YV+ LC+ GY 
Sbjct  574  QTD-PFGEPISAEGSP-RKLASPFDFGGGLVNPGKVADPGLVYDMGSDEYVHYLCSAGYE  631

Query  393  SKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            +K+IS + G+  +C     S+LDVN PSITIP L   I LTRTVTNVGP  S YK ++EP
Sbjct  632  NKSISRLLGRIYTCPSPTPSMLDVNVPSITIPYLNEEIILTRTVTNVGPVGSVYKAVIEP  691

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVK  40
            P GI + V P TL F PN KKI+F V +ST H +NT + FGSL W D G HNVRIP+SV+
Sbjct  692  PLGIKLQVSPETLKFGPNTKKITFTVKVSTTHRWNTDYLFGSLTWTDNGAHNVRIPLSVR  751

Query  39   TK  34
            T+
Sbjct  752  TR  753



>ref|NP_564412.1| Subtilase 3.5 [Arabidopsis thaliana]
 sp|Q9MAP7.1|SBT35_ARATH RecName: Full=Subtilisin-like protease SBT3.5; AltName: Full=Subtilase 
subfamily 3 member 5; Short=AtSBT3.5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31278.1|AC006424_7 First of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAL67022.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAP04132.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE31542.1| Subtilase 3.5 [Arabidopsis thaliana]
Length=774

 Score =   251 bits (641),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 139/240 (58%), Positives = 171/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D    +  ++ ++GTSMA P VAG+VALLKA HP+WSPA  +SAIVTTAW 
Sbjct  529  SILAATSP-DSNSSVGGFDILAGTSMAAPVVAGVVALLKALHPNWSPAAFRSAIVTTAWR  587

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGGI+NP +A  PGL+YDM   DY+  LC+ GY+ 
Sbjct  588  TD-PFGEQIFAEGSS-RKVADPFDYGGGIVNPEKAADPGLIYDMGPRDYILYLCSAGYND  645

Query  390  KAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ + G  T C     S+LDVN PSITIPDLK  +TLTRTVTNVG  +S YKV+VEPP
Sbjct  646  SSITQLVGNVTVCSTPKTSVLDVNLPSITIPDLKDEVTLTRTVTNVGTVDSVYKVVVEPP  705

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI VVV P TL F+   K +SF V +ST H  NTGFYFG+LIW D +HNV IP+SV+T+
Sbjct  706  LGIQVVVAPETLVFNSKTKNVSFTVRVSTTHKINTGFYFGNLIWTDSMHNVTIPVSVRTQ  765



>ref|XP_010474133.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=754

 Score =   251 bits (640),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y  +SG+SMATP V+GIV LL+  HP WSPA I+SA+VTTAW TD  SGE IF+EG T  
Sbjct  528  YTILSGSSMATPIVSGIVGLLRQIHPGWSPAAIRSALVTTAWRTD-PSGEQIFSEGST-R  585

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYGGG+INP +   PGL+YDM   DYV+ LC+  Y   +IS + G+   C    
Sbjct  586  KLADPFDYGGGLINPEKVANPGLIYDMGINDYVHYLCSAEYDDGSISKLLGKPIKCPYPL  645

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD N PSI IP L R +TLTRTVTNVGP +S YK +VE P GI + V P TL F+ N
Sbjct  646  PSMLDFNMPSIIIPSLTREVTLTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASN  705

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            + K +FNV + T H  N+ +YFGSL W DGVHNV IPI+V+TK
Sbjct  706  ITKGTFNVRVKTSHRVNSDYYFGSLCWTDGVHNVTIPIAVRTK  748



>gb|KFK41045.1| hypothetical protein AALP_AA2G078300 [Arabis alpina]
Length=757

 Score =   251 bits (640),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 130/226 (58%), Positives = 160/226 (71%), Gaps = 4/226 (2%)
 Frame = -2

Query  705  STYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGET  526
            S Y F+SGTSMATP V+GIVALL+  HPDWSPA I+SA+VTTA  TD  SGEPI  EG  
Sbjct  528  SRYEFMSGTSMATPVVSGIVALLRQKHPDWSPAAIRSALVTTASQTD-PSGEPIAAEGSP  586

Query  525  ISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK  346
              KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY  ++ISI+  +  +C  
Sbjct  587  -RKLADPFDYGGGLVNPGKVADPGLVYDMGYDEYVHYLCSAGYDDRSISILLSKPYTCPS  645

Query  345  GF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFS  169
               S+LDVN PSITIP L + IT+TRTVTNVGP  S YK ++EPP GI + V P TL F 
Sbjct  646  PTPSMLDVNLPSITIPYLSQEITITRTVTNVGPVGSIYKAVIEPPLGINLQVSPETLEFG  705

Query  168  PNVKKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVKTK  34
             N  KI+F V +ST H  NT ++FGSL W D G H+VRIP S++T+
Sbjct  706  SNTNKITFMVKVSTTHRVNTDYHFGSLTWTDNGAHDVRIPFSIRTR  751



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score =   250 bits (638),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 165/239 (69%), Gaps = 15/239 (6%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D       ++ ++GTSMA P ++G+VALLKA HPDWSPA IKSAIVTTAW 
Sbjct  520  SILAATSP-DSNSSAGGFDILAGTSMAAPVISGVVALLKAMHPDWSPAAIKSAIVTTAWR  578

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGG++NP +A  PGL+YDM   DY+  LC+     
Sbjct  579  TD-PFGEQIFAEGSS-RKVADPFDYGGGLVNPEKAADPGLIYDMGPKDYILYLCS-----  631

Query  390  KAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
             A+++ +    S      +LDVN PS+TIP+LK  + LTRTVTNVGP NS YKV+VEPP 
Sbjct  632  -AVTVCSNPKPS------VLDVNLPSLTIPNLKEEVNLTRTVTNVGPVNSVYKVVVEPPL  684

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ VVV P  L F+   K +SF V +ST H  NTGFYFGSLIW D VHNV IP+SV+T+
Sbjct  685  GVRVVVTPKKLVFNSKTKSLSFMVRVSTIHKINTGFYFGSLIWRDSVHNVTIPVSVRTQ  743



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score =   250 bits (639),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 130/240 (54%), Positives = 169/240 (70%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P +       +  +SGTSMATP ++G+VALLK+ HPDWSPA  +SAIVTTAW 
Sbjct  527  SILAATSP-NATFNAGGFVMLSGTSMATPAISGVVALLKSLHPDWSPAAFRSAIVTTAWR  585

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE +  EG +  K+AD FDYGGG++NP +A +PGL+YDM   DY+  LC++GY+ 
Sbjct  586  TD-PFGEQLPAEGSS-RKVADPFDYGGGLVNPEKAAEPGLIYDMGPKDYILYLCSVGYND  643

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C     S+LD+N PSITIP+LK  + LTRTVTNVGP +S YKV VEPP
Sbjct  644  SSISQLVGKGTVCTDPKPSVLDMNLPSITIPNLKDEVILTRTVTNVGPVHSVYKVGVEPP  703

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ VVV P  L F+   K +SF V +ST H  NTG+YFGSL+W+D V  V IP+SV+T+
Sbjct  704  LGVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTGYYFGSLVWSDSVRKVTIPVSVRTQ  763



>ref|XP_010511550.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=676

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 165/227 (73%), Gaps = 5/227 (2%)
 Frame = -2

Query  705  STYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGET  526
            S Y F+SGTSMATP VAGIVALLK  HPDWSPA I+SA+VTTA  TD  SGEPI  EG  
Sbjct  446  SGYEFLSGTSMATPIVAGIVALLKQNHPDWSPAAIRSALVTTARQTD-PSGEPISAEGSP  504

Query  525  ISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK  346
              KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C  
Sbjct  505  -RKLADPFDYGGGLVNPMKVADPGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPF  563

Query  345  GF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFS  169
             F S+LDVN PSITIP L + IT+TRTVTNVGP  S YK +++ P+GI + V P TL FS
Sbjct  564  PFPSMLDVNLPSITIPYLSKEITITRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFS  623

Query  168  PN-VKKISFNVTISTCHGFNTGFYFGSLIW-NDGVHNVRIPISVKTK  34
             N   +I+F V +ST H  NT ++FGSL W ++G HNVRIP+SV+T+
Sbjct  624  SNTTNRITFTVKVSTTHKANTDYHFGSLTWIDNGGHNVRIPLSVRTR  670



>ref|XP_006397047.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
 gb|ESQ38500.1| hypothetical protein EUTSA_v10028468mg [Eutrema salsugineum]
Length=723

 Score =   249 bits (636),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/230 (56%), Positives = 161/230 (70%), Gaps = 8/230 (3%)
 Frame = -2

Query  705  STYN-----FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIF  541
            ST+N      +SGTSMA P ++G+VA LKA H +WSPA I+SAIVTTAW TD   GE IF
Sbjct  487  STFNDRGFIMLSGTSMAAPVISGVVAFLKARHRNWSPAAIRSAIVTTAWRTD-PFGEKIF  545

Query  540  NEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQT  361
             EG    KLAD FDYGGG++NP +A KPGLVYD+   DY+  +C++GY+  AIS +A + 
Sbjct  546  AEGSP-RKLADPFDYGGGLVNPEKAAKPGLVYDLGLEDYILYMCSVGYNESAISQLASKK  604

Query  360  TSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPS  184
            T C     S+LD N PSITIP+LK   TLTR +TNVGP +S YKV VE P G+ V V P 
Sbjct  605  TLCSNPRPSVLDFNLPSITIPNLKDEATLTRILTNVGPLDSVYKVAVEAPLGVQVTVTPE  664

Query  183  TLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             L F+   K++SF V +ST H  NTG+YFGSL W+D VHNV IP+SV+T+
Sbjct  665  KLVFNSTTKRVSFKVKVSTTHKINTGYYFGSLTWSDSVHNVTIPLSVRTQ  714



>emb|CDY25259.1| BnaA02g21970D [Brassica napus]
Length=742

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/240 (56%), Positives = 169/240 (70%), Gaps = 15/240 (6%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA   +D +  ++ ++  SGTSMATP V+GIV LLK+ HP WSP+ IKSAIVTTAW 
Sbjct  508  NILAATSLND-SFSVNGFSMKSGTSMATPVVSGIVVLLKSLHPHWSPSAIKSAIVTTAWK  566

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG++NP RA KPGLVYDM+T DYV  LCA  Y  
Sbjct  567  TD-PSGEPIFADGSS-RKLADPFDYGGGLVNPERAAKPGLVYDMATHDYVLYLCAADY--  622

Query  390  KAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
                     TT C      +LD+N PSITIP+L+  +TLTRTVTNVGP NS YKV++ PP
Sbjct  623  ---------TTVCPTPKPWVLDLNLPSITIPNLRDEVTLTRTVTNVGPLNSVYKVVINPP  673

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P+T  F+    K+SF V ++T H  NTG++FGSL W+D +HNV IP+SV+T+
Sbjct  674  TGVNVGVTPTTFVFNSTATKLSFTVRVTTTHRVNTGYFFGSLTWSDNMHNVAIPLSVRTQ  733



>ref|XP_006301525.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
 gb|EOA34423.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
Length=757

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 128/224 (57%), Positives = 160/224 (71%), Gaps = 4/224 (2%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSMA P ++GIVALL+   PDWSPA I+SA+VTTA  TD  SGEPI  EG    
Sbjct  530  YEFMSGTSMAAPIISGIVALLRQKRPDWSPAAIRSALVTTALQTD-PSGEPIAAEGSP-R  587

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY   +IS + G+  +C    
Sbjct  588  KLADPFDYGGGLVNPGKVADPGLVYDMGHNEYVHYLCSAGYDDISISKLLGKNNTCPSPM  647

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LDVN PSITIP L + IT+TRTVTNVGP  S YK M++ P+GI + V P TL+FS N
Sbjct  648  PSMLDVNLPSITIPYLSQEITITRTVTNVGPAGSVYKAMIQAPQGINLQVSPETLDFSSN  707

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIW-NDGVHNVRIPISVKTK  34
              KI+F V +ST H  NT ++FGSL W ++G HNVRIPISV+T+
Sbjct  708  TNKITFTVKVSTTHRSNTDYHFGSLTWIDNGGHNVRIPISVRTR  751



>gb|ADQ37388.1| unknown [Capsella rubella]
Length=700

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   SGTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAWTTD  SGEPIF EGE   
Sbjct  476  YTLGSGTSYATPAVAGLVVLLKALHPDWSPAALKSAIMTTAWTTD-PSGEPIFAEGEP-R  533

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI+ + G+ T C    
Sbjct  534  KLADPFDYGAGLVNIERAKDPGLVYDMNVDDYIDFFCASGYNETAITTLVGKPTKCSSPL  593

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITI DL+  +T+TRTVTNVGP NS YK +VEPP+G+ +VV+P TL F  N
Sbjct  594  PSILDLNYPAITITDLEEEVTVTRTVTNVGPVNSVYKAVVEPPQGVKIVVEPETLVFCSN  653

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FGS  W DG  NV IP+SV+T+
Sbjct  654  TKKLGFKVRVSSSHKSNTGFIFGSFTWTDGSRNVTIPLSVRTR  696



>ref|XP_006286454.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19352.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=754

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 133/240 (55%), Positives = 167/240 (70%), Gaps = 9/240 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA    +  V      F SGTSMATP V+G+V LLK+ +P WSPA I+SAIVTTAW 
Sbjct  514  NILAADKDKEGVV------FKSGTSMATPVVSGVVVLLKSLYPQWSPAAIRSAIVTTAWK  567

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLC-AMGYS  394
            TD   GEPIF EG    KLAD FDYGGG++NP +A  PGLVYDM+  DYV+ LC A  ++
Sbjct  568  TD-PFGEPIFAEGSN-RKLADPFDYGGGLVNPEKAVSPGLVYDMTINDYVSYLCSAYNFN  625

Query  393  SKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              +IS +   T   +   S+LD+N PSITIPDL+  +TLTRTVTNVG  NS YKVM++ P
Sbjct  626  DVSISQVGNITACPNPKQSLLDLNLPSITIPDLRDEVTLTRTVTNVGSVNSIYKVMIDAP  685

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ ++V P+TL F+   +K+SF V + T H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  686  IGVNMIVTPATLEFNSMTRKVSFKVRVLTTHKVNTGYYFGSLTWTDNVHNVVIPVSVRTQ  745



>ref|XP_006304869.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
 gb|EOA37767.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
Length=759

 Score =   249 bits (636),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 161/221 (73%), Gaps = 5/221 (2%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMATP VAG+VALL+A HPDWSPA +KSA+VTTA  TD   GEPIF+EG T  KLAD
Sbjct  534  SGTSMATPVVAGLVALLRAVHPDWSPAALKSALVTTASQTD-PYGEPIFSEGLT-RKLAD  591

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTT--SCHKGF-S  337
             FD+GGG++NPN+A  PGLVYD    DY   LCA  Y    I+ I+   T   C     S
Sbjct  592  PFDFGGGLVNPNKAADPGLVYDAGAEDYRLFLCASNYDEVHITRISRINTLYRCPSPRPS  651

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIP LK  +TLTRTVTNVGP +S YK++VEPP GI + V P+TL F+ NVK
Sbjct  652  MLDLNLPSITIPFLKEDVTLTRTVTNVGPVDSVYKLVVEPPLGIKISVTPNTLLFNSNVK  711

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+SF VT+ST H  N+ +YFGSL W DG HNV IP+SV+T+
Sbjct  712  KLSFKVTVSTTHKANSIYYFGSLTWTDGSHNVTIPLSVRTQ  752



>gb|AID21678.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 168/239 (70%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL A     P      Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW T
Sbjct  517  ILGATAEDSPG-SFGGYFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKT  575

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D  SGEPIF EGE   KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  
Sbjct  576  D-PSGEPIFAEGEP-RKLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDT  633

Query  387  AISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            AI++I G+ T C     SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ MVEPP+
Sbjct  634  AITLITGKPTKCSSPLPSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAMVEPPQ  693

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ +VV+P TL F  N KK+ F V +S+ H  NTGF FGS  W DG  NV IP+SV+T+
Sbjct  694  GVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTIPLSVRTR  752



>ref|XP_010463200.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 164/222 (74%), Gaps = 7/222 (3%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMATP VAG+VALL+A HPDWSPA +KSA+VTTA  TD   GEPIF+EG T  KLAD
Sbjct  522  SGTSMATPVVAGLVALLRAVHPDWSPAALKSALVTTASKTDLY-GEPIFSEGLT-RKLAD  579

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK----GF  340
             FD+GGG+++PN+A  PGLVYD    DY   LCA  Y    I+ I+ +T + ++      
Sbjct  580  PFDFGGGLVSPNKAADPGLVYDAGAEDYRLFLCASNYDEMHITKIS-RTNTLYRCPSPRP  638

Query  339  SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNV  160
            S+LD+N PSITIP LK  +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NV
Sbjct  639  SMLDLNLPSITIPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNV  698

Query  159  KKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            KK+SF VT+ST H  N+ +YFGSL W DG HNV IP+SV+T+
Sbjct  699  KKLSFKVTVSTTHKSNSIYYFGSLTWTDGSHNVTIPLSVRTQ  740



>gb|AID21628.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   249 bits (635),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 136/239 (57%), Positives = 168/239 (70%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL A     P      Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW T
Sbjct  517  ILGATAEDSPG-SFGGYFLGTGTSYATPIVAGLVVLLKALHPDWSPAALKSAIMTTAWKT  575

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D  SGEPIF EGE   KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  
Sbjct  576  D-PSGEPIFAEGEP-RKLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDT  633

Query  387  AISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            AI++I G+ T C     SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ MVEPP+
Sbjct  634  AITLITGKPTKCSSPLLSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAMVEPPQ  693

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ +VV+P TL F  N KK+ F V +S+ H  NTGF FGS  W DG  NV IP+SV+T+
Sbjct  694  GVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTIPLSVRTR  752



>ref|XP_010511549.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   248 bits (634),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 165/227 (73%), Gaps = 5/227 (2%)
 Frame = -2

Query  705  STYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGET  526
            S Y F+SGTSMATP VAGIVALLK  HPDWSPA I+SA+VTTA  TD  SGEPI  EG  
Sbjct  530  SGYEFLSGTSMATPIVAGIVALLKQNHPDWSPAAIRSALVTTARQTD-PSGEPISAEGSP  588

Query  525  ISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK  346
              KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C  
Sbjct  589  -RKLADPFDYGGGLVNPMKVADPGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPF  647

Query  345  GF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFS  169
             F S+LDVN PSITIP L + IT+TRTVTNVGP  S YK +++ P+GI + V P TL FS
Sbjct  648  PFPSMLDVNLPSITIPYLSKEITITRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFS  707

Query  168  PN-VKKISFNVTISTCHGFNTGFYFGSLIW-NDGVHNVRIPISVKTK  34
             N   +I+F V +ST H  NT ++FGSL W ++G HNVRIP+SV+T+
Sbjct  708  SNTTNRITFTVKVSTTHKANTDYHFGSLTWIDNGGHNVRIPLSVRTR  754



>ref|XP_002891020.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67279.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   248 bits (634),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 174/240 (73%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +IL+A  P D    +  ++ +SGTSMA P VAG+VALLKA HP+WSPA  +SAIVTTAW 
Sbjct  529  SILSATSP-DSNSSVGGFDILSGTSMAAPVVAGVVALLKALHPNWSPAAFRSAIVTTAWR  587

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGG++N  +A +PGL+YDM T DY+  LC+ GY+ 
Sbjct  588  TD-PFGEQIFAEGSS-RKVADPFDYGGGVVNAEKAAEPGLIYDMGTQDYILYLCSAGYND  645

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ + G  T C +   S+LDVN PSITIP+LK  +TLTRTVTNVGP +S YKV+++PP
Sbjct  646  SSITQLVGNVTVCSNPKPSVLDVNLPSITIPNLKDEVTLTRTVTNVGPVDSVYKVVLDPP  705

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI VVV P TL F+   K +SF V +ST H  NTGFYFG+LIW D +HNV IP+SV+T+
Sbjct  706  LGIRVVVTPETLVFNSKTKSVSFTVGVSTTHKINTGFYFGNLIWTDSMHNVTIPVSVRTQ  765



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score =   248 bits (634),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 128/220 (58%), Positives = 159/220 (72%), Gaps = 11/220 (5%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA HPDWSPA I+SAIVTTAW TD   GE I  EG +  KL
Sbjct  558  MLSGTSMAAPVISGVVALLKALHPDWSPAAIRSAIVTTAWRTD-PFGEQIDAEGSS-RKL  615

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFSI  334
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C         S++  +TT  +   S+
Sbjct  616  ADPFDYGGGLVNPEKAVKPGLVYDLDLEDYVLYMC---------SLVGERTTCSNPRPSV  666

Query  333  LDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKK  154
            LD+N PSITIPDLK  +TLTRTVTNVGP +S YKV VEPP G+ V V P+ L F+   KK
Sbjct  667  LDLNLPSITIPDLKEEVTLTRTVTNVGPPSSVYKVKVEPPLGVQVTVMPNKLVFNSKTKK  726

Query  153  ISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            +S++V +ST H  NTGFYFGSL W+D VH+V IP+SV+T+
Sbjct  727  LSYHVRVSTRHKINTGFYFGSLTWSDSVHDVIIPLSVRTQ  766



>ref|XP_010419003.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=719

 Score =   248 bits (632),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 155/223 (70%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y  +SG+SMATP V+GIV LL+  HP WSPA I+SA+VTTAW TD  SGE IF+EG T  
Sbjct  493  YTLMSGSSMATPVVSGIVGLLRQIHPGWSPAAIRSALVTTAWRTD-PSGEQIFSEGST-R  550

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYGGG+INP +   PGL+YDM   DYV+ LC+  Y   +IS + G+   C    
Sbjct  551  KLADPFDYGGGLINPEKVANPGLIYDMGINDYVHYLCSAEYDDGSISKLVGKPIKCPSPL  610

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             ++LD N PSI IP L R +TLTRTVTNVGP +S YK +VE P GI + V P TL F+ N
Sbjct  611  PTMLDFNMPSIIIPSLTREVTLTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASN  670

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            + K +FNV + T H  N+ +YF SL W DGVHNV IPI+V+TK
Sbjct  671  ITKGTFNVRVKTSHRVNSDYYFCSLCWTDGVHNVTIPIAVRTK  713



>gb|ADQ37345.1| unknown [Arabidopsis lyrata]
Length=696

 Score =   247 bits (630),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  472  YFLGTGTSYATPIVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  529

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI++I G+ T C    
Sbjct  530  KLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPL  589

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  590  PSVLDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSN  649

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FGS  W DG  NV IP+SV+T+
Sbjct  650  TKKLEFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTIPLSVRTR  692



>ref|XP_010480961.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   248 bits (632),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 164/222 (74%), Gaps = 7/222 (3%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMATP VAG+VALL+A HPDWSPA +KSA+VTTA  TD   GEPIF+EG T  KLAD
Sbjct  522  SGTSMATPVVAGLVALLRAVHPDWSPAALKSALVTTASKTD-PYGEPIFSEGLT-RKLAD  579

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK----GF  340
             FD+GGG+++PN+A  PGLV+D    DY   LCA  Y    I+ I+ +T + ++      
Sbjct  580  PFDFGGGLVSPNKAADPGLVFDAGAEDYRLFLCASNYDEMHITKIS-RTNTLYRCPSPRP  638

Query  339  SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNV  160
            S+LD+N PSITIP LK  +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NV
Sbjct  639  SMLDLNLPSITIPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNV  698

Query  159  KKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            KKISF VT+ST H  N+ +YFGSL W DG HNV IP+SV+T+
Sbjct  699  KKISFKVTVSTTHKSNSIYYFGSLTWTDGSHNVTIPLSVRTQ  740



>ref|XP_006283179.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
 gb|EOA16077.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
Length=760

 Score =   248 bits (632),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 133/223 (60%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   SGTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAWTTD  SGEPIF EGE   
Sbjct  536  YTLGSGTSYATPAVAGLVVLLKALHPDWSPAALKSAIMTTAWTTD-PSGEPIFAEGEP-R  593

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI+ + G+ T C    
Sbjct  594  KLADPFDYGAGLVNIERAKDPGLVYDMNVDDYIDFFCASGYNETAITTLVGKPTKCSSPL  653

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITI DL+  +T+TRTVTNVGP NS YK +VEPP+G+ +VV+P TL F  N
Sbjct  654  PSILDLNYPAITITDLEEEVTVTRTVTNVGPVNSVYKAVVEPPQGVKIVVEPETLVFCSN  713

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FGS  W DG  NV IP+SV+T+
Sbjct  714  TKKLGFKVRVSSSHKSNTGFIFGSFTWTDGSRNVTIPLSVRTR  756



>emb|CAB87667.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=755

 Score =   247 bits (631),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 163/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSM+TP VAG+VALL+A HPDWSPA +KSA++TTA TTD   GEPIF+EG T  KLAD
Sbjct  530  SGTSMSTPVVAGLVALLRAVHPDWSPAALKSALITTASTTD-PYGEPIFSEGMT-RKLAD  587

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTT--SC-HKGFS  337
             FD+GGG++NPN+A  PGLVYD+S  DY   LCA  Y  K I+ I+   T   C     S
Sbjct  588  PFDFGGGLVNPNKAADPGLVYDISAEDYRLFLCASHYDEKQITKISKTHTPYRCPSPKPS  647

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIP LK  +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NVK
Sbjct  648  MLDLNLPSITIPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVK  707

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             +S+ VT+ST H  N+ +YFGSL W DG H V IP+SV+T+
Sbjct  708  ILSYKVTVSTTHKSNSIYYFGSLTWTDGSHKVTIPLSVRTQ  748



>gb|ABV21208.1| At4g21326 [Arabidopsis thaliana]
Length=694

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  470  YFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  527

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  +I+II G+ T C    
Sbjct  528  KLADPFDYGAGLVNAERAKDPGLVYDMNIDDYIHYFCATGYNDTSITIITGKPTKCSSPL  587

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  588  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVEIVVEPETLVFCSN  647

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NT F+FGS  W DG  NV IP+SV+T+
Sbjct  648  TKKLGFKVRVSSSHKSNTDFFFGSFTWTDGTRNVTIPLSVRTR  690



>ref|NP_568255.1| Subtilase family protein [Arabidopsis thaliana]
 gb|ABE66153.1| subtilase family protein [Arabidopsis thaliana]
 gb|AED91742.1| Subtilase family protein [Arabidopsis thaliana]
Length=762

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 163/221 (74%), Gaps = 5/221 (2%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSM+TP VAG+VALL+A HPDWSPA +KSA++TTA TTD   GEPIF+EG T  KLAD
Sbjct  537  SGTSMSTPVVAGLVALLRAVHPDWSPAALKSALITTASTTD-PYGEPIFSEGMT-RKLAD  594

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTT--SC-HKGFS  337
             FD+GGG++NPN+A  PGLVYD+S  DY   LCA  Y  K I+ I+   T   C     S
Sbjct  595  PFDFGGGLVNPNKAADPGLVYDISAEDYRLFLCASHYDEKQITKISKTHTPYRCPSPKPS  654

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIP LK  +TLTRTVTNVGP +S YK++VEPP G+ + V P+TL F+ NVK
Sbjct  655  MLDLNLPSITIPFLKEDVTLTRTVTNVGPVDSVYKLIVEPPLGVKISVTPNTLLFNSNVK  714

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             +S+ VT+ST H  N+ +YFGSL W DG H V IP+SV+T+
Sbjct  715  ILSYKVTVSTTHKSNSIYYFGSLTWTDGSHKVTIPLSVRTQ  755



>ref|NP_567625.4| subtilase 3.12 [Arabidopsis thaliana]
 gb|AEE84441.1| subtilase 3.12 [Arabidopsis thaliana]
Length=754

 Score =   247 bits (630),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  530  YFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  587

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  +I+II G+ T C    
Sbjct  588  KLADPFDYGAGLVNAERAKDPGLVYDMNIDDYIHYFCATGYNDTSITIITGKPTKCSSPL  647

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  648  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVEIVVEPETLVFCSN  707

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF+FGS  W DG  NV IP+SV+ +
Sbjct  708  TKKLGFKVRVSSSHKSNTGFFFGSFTWTDGTRNVTIPLSVRIR  750



>ref|XP_002871506.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47765.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=762

 Score =   246 bits (629),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/221 (59%), Positives = 160/221 (72%), Gaps = 5/221 (2%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            SGTSMATP VAG+VALL+A HPDWSPA +KSA++TTA TTD   GEPIF+EG T  KLAD
Sbjct  537  SGTSMATPVVAGLVALLRAVHPDWSPAALKSALITTASTTD-PYGEPIFSEGMT-RKLAD  594

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTT--SCHKGF-S  337
             FD+GGG++NPN+A  PGLVYD+   DY   LCA  Y  + I+ I+   T   C     S
Sbjct  595  PFDFGGGLVNPNKAADPGLVYDIGAEDYRLFLCASDYDERQITKISKTNTPYRCPSPRPS  654

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD+N PSITIP LK  +TLTRTVTNVGP +S YK++V PP G+ + V P TL F+ NVK
Sbjct  655  MLDLNLPSITIPFLKEDVTLTRTVTNVGPVDSVYKLVVRPPLGVKISVTPKTLLFNSNVK  714

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+SF V +ST H  N+ +YFGSL W DG H V IP+SV+T+
Sbjct  715  KLSFKVIVSTTHKSNSIYYFGSLTWTDGSHKVTIPLSVRTQ  755



>gb|ADQ37356.1| unknown [Arabidopsis lyrata]
Length=696

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  472  YFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  529

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI++I G+ T C    
Sbjct  530  KLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPL  589

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  590  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLMFCSN  649

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FG   W DG  NV IP+SV+T+
Sbjct  650  TKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTR  692



>gb|AID21685.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 168/239 (70%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL A     P      Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW T
Sbjct  517  ILGATAEDSPG-SFGGYFLGTGTSYATPIVAGLVVLLKALHPDWSPAALKSAIMTTAWKT  575

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D  SGEPIF EGE   KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  
Sbjct  576  D-PSGEPIFAEGEP-RKLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDT  633

Query  387  AISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            AI++I G+ T C     S+LD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+
Sbjct  634  AITLITGKPTKCSSPLPSVLDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPQ  693

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ +VV+P TL F  N KK+ F V +S+ H  NTGF FGS  W DG  NV IP+SV+T+
Sbjct  694  GVKIVVEPETLIFCSNTKKLGFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTIPLSVRTR  752



>emb|CDX86874.1| BnaA09g22640D [Brassica napus]
Length=747

 Score =   246 bits (627),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/221 (58%), Positives = 154/221 (70%), Gaps = 13/221 (6%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD  SGE IF EG    KL
Sbjct  530  MLSGTSMAAPAISGVVALLKATHRDWSPAAIRSAIVTTAWRTD-PSGERIFAEGSP-RKL  587

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-S  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C +           G+ T C     S
Sbjct  588  ADPFDYGGGLVNPEKAAKPGLVYDLGIEDYVLYMCTL----------VGKGTVCSNPIPS  637

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TLTRT+TNVGP +S YKV VEPP G+ V V P TL F+   K
Sbjct  638  VLDFNLPSITIPNLKEEVTLTRTLTNVGPVDSVYKVAVEPPLGVQVTVTPETLVFNSTNK  697

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+SF V +ST H  NTG+YFGSL W+D VHN  IP+SV+T+
Sbjct  698  KVSFKVRVSTTHKTNTGYYFGSLTWSDYVHNATIPLSVRTQ  738



>gb|KFK31853.1| hypothetical protein AALP_AA6G166900 [Arabis alpina]
Length=787

 Score =   246 bits (628),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 158/221 (71%), Gaps = 3/221 (1%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLK+ + DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  560  MLSGTSMAAPVISGVVALLKSLNRDWSPAAIRSAIVTTAWRTD-PFGEQIFAEGSP-RKL  617

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKGFS  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C+  Y+  +IS + G+ T C +   S
Sbjct  618  ADPFDYGGGLVNPEKAAKPGLVYDLGLEDYVLYMCSAAYNESSISQLVGKGTVCSNPKPS  677

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TLTRT+TNVGP +S YK  VE   G+ V V P TL F+   K
Sbjct  678  VLDFNLPSITIPNLKEDVTLTRTLTNVGPLDSVYKASVELLSGVQVTVTPETLVFNSTTK  737

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+SF V +ST H  NTG+YFGSL W+D VHNV IP+SV+T+
Sbjct  738  KVSFKVKVSTTHKINTGYYFGSLTWSDSVHNVTIPLSVRTQ  778



>gb|AID21653.1| At4g21326p-like protein [Arabidopsis lyrata]
Length=756

 Score =   245 bits (625),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 134/239 (56%), Positives = 167/239 (70%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL A     P      Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW T
Sbjct  517  ILGATAEDSPG-SFGGYFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKT  575

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D  SGEPIF EGE   KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  
Sbjct  576  D-PSGEPIFAEGEP-RKLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDT  633

Query  387  AISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            AI++I G+ T C     SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+
Sbjct  634  AITLITGKPTKCSSPLPSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPR  693

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ +VV+P TL F  N KK+ F V +S+ H  NTGF FG   W DG  NV IP+SV+T+
Sbjct  694  GVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTR  752



>ref|XP_010538683.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=696

 Score =   244 bits (622),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 135/243 (56%), Positives = 177/243 (73%), Gaps = 7/243 (3%)
 Frame = -2

Query  753  TNILAAYIPSDPAVRIST-YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTA  577
            + IL A I S+P  R  T  +  +GTS + P VAGIVALLK+ HPDWSPA +KSA++TTA
Sbjct  454  SQILVASIMSNP--RFDTGISLNTGTSYSAPAVAGIVALLKSLHPDWSPAALKSAVITTA  511

Query  576  WTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGY  397
            W TD   G+PIF+EG +  KLAD FDYGGG+INP +AR PGLVYDM   DY++  CA  Y
Sbjct  512  WKTD-PYGQPIFSEGSS-QKLADPFDYGGGLINPEKARDPGLVYDMGIEDYIHYFCARSY  569

Query  396  SSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDL-KRPITLTRTVTNVGPENSTYKVMV  223
            +  AIS + G++ +C     SILDVN PSITIPDL +  +T+TRTVTNVGP +S Y+ +V
Sbjct  570  NDSAISKLVGKSVTCPSPRPSILDVNVPSITIPDLDEEAVTVTRTVTNVGPVDSVYRAVV  629

Query  222  EPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISV  43
            EPP GI ++VKP  L F+ + KK +F++++ST H  NTGF+FGSL+W DG  NV +P+SV
Sbjct  630  EPPLGINILVKPEALAFNSDTKKQTFSMSVSTSHKTNTGFFFGSLVWTDGTRNVSVPLSV  689

Query  42   KTK  34
            +T+
Sbjct  690  RTQ  692



>gb|AJP61136.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   244 bits (624),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  532  YFLGTGTSYATPIVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI++I G+ T C    
Sbjct  590  KLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTRCSSPL  649

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  650  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSN  709

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FG   W DG  NV IP+SV+T+
Sbjct  710  TKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTR  752



>emb|CDX99526.1| BnaC09g24660D [Brassica napus]
Length=753

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 127/221 (57%), Positives = 154/221 (70%), Gaps = 13/221 (6%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
             +SGTSMA P ++G+VALLKA H DWSPA I+SAIVTTAW TD  SGE IF EG    KL
Sbjct  536  MLSGTSMAAPAISGVVALLKATHRDWSPAAIRSAIVTTAWRTD-PSGERIFAEGSP-RKL  593

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-S  337
            AD FDYGGG++NP +A KPGLVYD+   DYV  +C +           G+ T C     S
Sbjct  594  ADPFDYGGGLVNPEKAAKPGLVYDLGLEDYVLYMCTL----------VGKGTICSNPIPS  643

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSIT+P+LK  +TLTRT+TNVGP +S YKV VEPP G+ V V P TL F+   K
Sbjct  644  VLDFNLPSITVPNLKEEVTLTRTLTNVGPVDSVYKVAVEPPFGVQVTVTPETLVFNSTNK  703

Query  156  KISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            K+SF V +S  H  NTG+YFGSL W+D VHNV IP+SV+T+
Sbjct  704  KVSFQVRVSATHKTNTGYYFGSLTWSDYVHNVTIPLSVRTQ  744



>gb|AID21581.1| AT4G21326p [Arabidopsis halleri]
 gb|AID21618.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   244 bits (624),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  532  YFLGTGTSYATPIVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI++I G+ T C    
Sbjct  590  KLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTRCSSPL  649

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  650  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVNIVVEPETLVFCSN  709

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FG   W DG  NV IP+SV+T+
Sbjct  710  TKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTR  752



>emb|CDX91186.1| BnaC02g04110D [Brassica napus]
Length=760

 Score =   244 bits (623),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 167/223 (75%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y  +SGTSMA P VAG+VALLKA HPDWSPA++KSAI+TTA +TD   GEPI++EG +  
Sbjct  533  YTAMSGTSMAAPAVAGVVALLKAVHPDWSPAMLKSAIITTASSTD-PYGEPIYSEGLS-R  590

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FD+GGG++NP++A  PGLVYD    DY+  LCA  Y  K+I+ I+ QT  C    
Sbjct  591  KLADPFDFGGGLVNPDKAANPGLVYDADVQDYIRFLCASSYDEKSITKISKQTVKCPSPR  650

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD+N PSITIP LK  +TLTRTVTNVGP NS YK++V+PP G+ + V P TL F+  
Sbjct  651  PSMLDLNLPSITIPFLKEDVTLTRTVTNVGPVNSVYKLIVQPPMGVKISVTPQTLVFNSG  710

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            VKK+S+ VT+ST H  N+ ++FGSL W DG+HNV IP+S++T+
Sbjct  711  VKKLSYQVTVSTTHKANSIYFFGSLTWTDGIHNVVIPLSIRTQ  753



>ref|XP_006391366.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
 gb|ESQ28652.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
Length=729

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 152/223 (68%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y  +SGTSMATP V+GIV LL+   P+WSPA I+SA+VTTAW TD   GEP+F+EG T  
Sbjct  503  YKLMSGTSMATPVVSGIVGLLRQIRPNWSPAAIRSALVTTAWRTD-PFGEPLFSEGST-R  560

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKG  343
            KLAD FDYGGG+INP +   PGLVYDM   DYV+ LC+  Y    IS + G+   C    
Sbjct  561  KLADPFDYGGGLINPEKVTDPGLVYDMGFDDYVHYLCSAEYGDSEISKLIGKDYKCPWPK  620

Query  342  FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+L+ N PSITIP L   +T+ RTVTNVGP  S YK MVE P GI + V P TL F  N
Sbjct  621  PSMLNFNLPSITIPSLTGEVTVARTVTNVGPPGSVYKAMVENPFGIELEVNPKTLEFGSN  680

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              KI+++V + T H  N+ FYFGSL W DGVHNV IP+SV+TK
Sbjct  681  TTKITYSVRVRTNHKVNSDFYFGSLCWTDGVHNVTIPVSVRTK  723



>gb|AID21603.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   244 bits (622),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  532  YFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  +I+I+ G+ T C    
Sbjct  590  KLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTSITILTGKPTKCSSPL  649

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  650  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSN  709

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FG   W DG  NV IP+SV+T+
Sbjct  710  TKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTR  752



>gb|KFK31852.1| hypothetical protein AALP_AA6G166800 [Arabis alpina]
Length=1462

 Score =   248 bits (634),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 138/240 (58%), Positives = 178/240 (74%), Gaps = 4/240 (2%)
 Frame = -2

Query  750   NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             NILAA  P+  +  +  +  +SGTSMATP V+GIV LLK+ HP WSP+ IKSAIVTTAW 
Sbjct  1217  NILAAMSPNS-SFNVGGFAMMSGTSMATPIVSGIVVLLKSLHPHWSPSAIKSAIVTTAWK  1275

Query  570   TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             TD  SGEPIF +G +  KLAD FDYGGG++NP +A KPGLVYDM+T DY+  LC+  YS 
Sbjct  1276  TD-PSGEPIFADGSS-RKLADPFDYGGGLVNPEKAAKPGLVYDMATHDYIMYLCSADYSD  1333

Query  390   KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              +IS + G+TT C +   S+LD+N PSITIP+LK  +T+TRTVTNVGP +S Y V+++PP
Sbjct  1334  ISISRVLGKTTVCPNPKPSVLDLNLPSITIPNLKDEVTVTRTVTNVGPLDSIYNVVIDPP  1393

Query  213   KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              GI V V P+TL F+   +K+SF V +ST H  NTG+YFGSL W D +H+V IP+SV+T+
Sbjct  1394  TGINVTVTPTTLVFNSTTRKLSFTVRVSTTHKVNTGYYFGSLSWTDNLHDVAIPVSVRTQ  1453


 Score =   211 bits (537),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 135/188 (72%), Gaps = 3/188 (2%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F+SGTSMATP ++G+VALLK+ H DWSPA I+SAIVTTAW TD   GE IF EG    KL
Sbjct  552  FLSGTSMATPTISGVVALLKSLHRDWSPAAIRSAIVTTAWRTD-PFGELIFAEGSP-RKL  609

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-S  337
            AD FDYGGG++NP +A K GLVYD+   DYV  +C+ GY+  +IS + G+ T C     S
Sbjct  610  ADPFDYGGGLVNPEKAAKAGLVYDLGLEDYVLYMCSAGYNDSSISQLVGKGTVCSNPRPS  669

Query  336  ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVK  157
            +LD N PSITIP+LK  +TLTRT+TNVGP +S YKV VEPP G+ V V P TL F+   K
Sbjct  670  VLDFNLPSITIPNLKEEVTLTRTLTNVGPLDSVYKVAVEPPLGVQVTVTPKTLVFNSRTK  729

Query  156  KISFNVTI  133
            ++SF V +
Sbjct  730  RVSFKVYV  737



>gb|ADQ37368.1| unknown [Arabidopsis lyrata]
Length=696

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 162/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  472  YFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  529

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI++I G+ T C    
Sbjct  530  KLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPL  589

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P  L F  N
Sbjct  590  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPEILMFCSN  649

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FGS  W DG  NV I +SV+T+
Sbjct  650  TKKLEFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTISLSVRTR  692



>ref|XP_010470496.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=676

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 164/227 (72%), Gaps = 5/227 (2%)
 Frame = -2

Query  705  STYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGET  526
            S Y F+SGTSMATP VAGIVAL+K  HPDWSPA I+SA+VTTA  TD  SGEPI  EG  
Sbjct  446  SGYEFLSGTSMATPIVAGIVALVKQNHPDWSPAAIRSALVTTALQTD-PSGEPISAEGSP  504

Query  525  ISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-H  349
              KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C  
Sbjct  505  -RKLADPFDYGGGVVNPVKVADPGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPS  563

Query  348  KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFS  169
               S+LDVN PSITIP L + IT+TRTVTNVGP  S YK +++ P+GI + V P TL FS
Sbjct  564  PSPSMLDVNLPSITIPYLSKEITVTRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFS  623

Query  168  PN-VKKISFNVTISTCHGFNTGFYFGSLIW-NDGVHNVRIPISVKTK  34
             N   K++F V +ST H  NT ++FGSL W ++G H+VRIP+SV+T+
Sbjct  624  SNTTNKLTFTVKVSTAHRANTDYHFGSLSWIDNGGHSVRIPLSVRTR  670



>emb|CCI61494.1| unnamed protein product [Arabidopsis halleri]
 gb|AJP61099.1| At4g21326p-like protein [Arabidopsis halleri]
 gb|AJP61132.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 133/239 (56%), Positives = 167/239 (70%), Gaps = 4/239 (2%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            IL A     P      Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW T
Sbjct  517  ILGATAEDSPG-SFGGYFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKT  575

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSK  388
            D  SGEPIF EGE   KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  
Sbjct  576  D-PSGEPIFAEGEP-RKLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDT  633

Query  387  AISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
            +I+I+ G+ T C     SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+
Sbjct  634  SITILTGKPTKCSSPLPSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPR  693

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ +VV+P TL F  N KK+ F V +S+ H  NTGF FG   W DG  NV IP+SV+T+
Sbjct  694  GVKIVVEPETLVFCSNTKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTR  752



>gb|AJP61119.1| At4g21326p-like protein [Arabidopsis halleri]
Length=756

 Score =   243 bits (621),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/223 (58%), Positives = 163/223 (73%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y   +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   
Sbjct  532  YFLGTGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-R  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  +I+I+ G+ T C    
Sbjct  590  KLADPFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTSITILTGKPTKCSSPL  649

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             SILD+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N
Sbjct  650  PSILDLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSN  709

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             KK+ F V +S+ H  NTGF FG   W DG  NV IP+SV+T+
Sbjct  710  TKKLEFKVRVSSSHKSNTGFIFGIFTWTDGTRNVTIPLSVRTR  752



>ref|XP_010470495.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   243 bits (620),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 129/227 (57%), Positives = 164/227 (72%), Gaps = 5/227 (2%)
 Frame = -2

Query  705  STYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGET  526
            S Y F+SGTSMATP VAGIVAL+K  HPDWSPA I+SA+VTTA  TD  SGEPI  EG  
Sbjct  530  SGYEFLSGTSMATPIVAGIVALVKQNHPDWSPAAIRSALVTTALQTD-PSGEPISAEGSP  588

Query  525  ISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-H  349
              KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY++ +IS + G+  +C  
Sbjct  589  -RKLADPFDYGGGVVNPVKVADPGLVYDMGENEYVHYLCSAGYNNTSISKLLGKIYTCPS  647

Query  348  KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFS  169
               S+LDVN PSITIP L + IT+TRTVTNVGP  S YK +++ P+GI + V P TL FS
Sbjct  648  PSPSMLDVNLPSITIPYLSKEITVTRTVTNVGPVGSVYKAVIQQPQGINLQVSPETLEFS  707

Query  168  PN-VKKISFNVTISTCHGFNTGFYFGSLIW-NDGVHNVRIPISVKTK  34
             N   K++F V +ST H  NT ++FGSL W ++G H+VRIP+SV+T+
Sbjct  708  SNTTNKLTFTVKVSTAHRANTDYHFGSLSWIDNGGHSVRIPLSVRTR  754



>ref|XP_010538146.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=821

 Score =   243 bits (620),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 162/220 (74%), Gaps = 3/220 (1%)
 Frame = -2

Query  690  ISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLA  511
             SGTSMATP VAGIVALLK +HPDWSPA I+SAIVTTA  TD   GEPIF +G + ++LA
Sbjct  599  FSGTSMATPVVAGIVALLKVSHPDWSPAAIRSAIVTTAKKTD-PYGEPIFADGSS-TELA  656

Query  510  DAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SI  334
            D FDYGGG++NP +A +PGLVYDM   DY   LC  GYS  ++S I G+   C     SI
Sbjct  657  DPFDYGGGLVNPEKAVEPGLVYDMGIDDYAQYLCYAGYSDSSLSAIVGKDAKCPSPLPSI  716

Query  333  LDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKK  154
            LD+N PSITIPDL+  +T+TRTVTNVGP +S YK +++ P GI V V+P  L F+ N KK
Sbjct  717  LDLNLPSITIPDLREDVTVTRTVTNVGPVDSVYKPLIDAPFGINVEVRPEALAFNLNTKK  776

Query  153  ISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            + F+V +ST H  NTGFYFGSL W DG+HNV IP+SV+T+
Sbjct  777  LGFSVKVSTTHKANTGFYFGSLTWTDGIHNVTIPLSVRTQ  816



>emb|CDY61569.1| BnaCnng38020D [Brassica napus]
Length=1177

 Score =   245 bits (625),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 134/243 (55%), Positives = 167/243 (69%), Gaps = 10/243 (4%)
 Frame = -2

Query  753   TNILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAW  574
             + ILAA +PS+       Y F+SGTSMATP V+GIVALL+   PDWSPA I+SA+VTTA 
Sbjct  938   SGILAA-VPSEEG-----YAFMSGTSMATPVVSGIVALLRQKRPDWSPAAIRSALVTTAL  991

Query  573   TTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS  394
              TD   GEPI  EG    KLA  FD+GGG++NP +   PGLVYDM   +YV+ LC+ GY 
Sbjct  992   QTD-PFGEPISAEGSP-RKLASPFDFGGGLVNPGKVADPGLVYDMGYDEYVHYLCSAGYE  1049

Query  393   SKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
             +K+IS + G+  +C     S+LDVN PSITIP L   I +TRTVTNVGP  S YK ++E 
Sbjct  1050  NKSISKLLGKIYTCPSPTPSMLDVNVPSITIPYLNEEIIITRTVTNVGPVGSVYKAVIEA  1109

Query  216   PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVK  40
             P GI + V P TL F PN KKI+F V +ST H +NT + FGSL W D G HNVRIP+SV+
Sbjct  1110  PLGIKLQVGPETLEFGPNTKKITFTVKVSTTHRWNTDYNFGSLTWTDNGAHNVRIPLSVR  1169

Query  39    TKY  31
             T++
Sbjct  1170  TRF  1172



>emb|CDY65868.1| BnaAnng21170D, partial [Brassica napus]
Length=672

 Score =   240 bits (612),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 164/223 (74%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y  +SGTSMA P VAG+VALLKA HPDWSPA++KSAI+TTA +TD   GEPI++EG +  
Sbjct  445  YTAMSGTSMAAPAVAGVVALLKAVHPDWSPAMLKSAIITTASSTD-PYGEPIYSEGLS-R  502

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FD+GGG++NP +A  PGLVYD    DY+  LCA  Y   +I+ I+ QT  C    
Sbjct  503  KLADPFDFGGGLVNPEKAANPGLVYDADVQDYIRFLCASSYDEMSITKISKQTVKCPSPR  562

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD+N PSITIP LK  +TLTRTVTNVGP NS YK++V+PP G+ + V P TL F+  
Sbjct  563  PSMLDLNLPSITIPFLKEDVTLTRTVTNVGPVNSVYKLIVQPPMGVKISVTPQTLVFNSG  622

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            VKK+S+ VT+ST H  N+ ++FGSL W DG HNV IP+S++T+
Sbjct  623  VKKLSYQVTVSTTHKANSIYFFGSLTWTDGTHNVVIPLSIRTQ  665



>ref|XP_002869894.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46153.1| hypothetical protein ARALYDRAFT_329472 [Arabidopsis lyrata subsp. 
lyrata]
Length=1745

 Score =   247 bits (630),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 163/219 (74%), Gaps = 3/219 (1%)
 Frame = -2

Query  687   SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
             +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   KLAD
Sbjct  1525  TGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-RKLAD  1582

Query  507   AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SIL  331
              FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  AI++I G+ T C     S+L
Sbjct  1583  PFDYGAGLVNAERAKDPGLVYDMNLDDYIHYFCATGYNDTAITLITGKPTKCSSPLPSVL  1642

Query  330   DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
             D+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+
Sbjct  1643  DLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVKIVVEPETLVFCSNTKKL  1702

Query  150   SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              F V +S+ H  NTGF FGS  W DG  NV IP+SV+T+
Sbjct  1703  EFKVRVSSSHKSNTGFIFGSFTWTDGTRNVTIPLSVRTR  1741


 Score =   173 bits (439),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 138/208 (66%), Gaps = 8/208 (4%)
 Frame = -2

Query  747   ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
             +L   IP+D      TY   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  844   LLTPRIPTDEDTSEFTY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  900

Query  567   DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
             D   GE +  +G    K+ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  901   D-PYGERLTVDGGNY-KVADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  958

Query  390   KAISIIAGQTTS-CHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
             K +S + G  TS C    S ILD+N PSITIPDLKR +T+TRTVTNVGP  S YK ++E 
Sbjct  959   KKVSALTGNITSKCPSSCSSILDLNVPSITIPDLKRDVTVTRTVTNVGPVKSVYKPVIET  1018

Query  216   PKGIIVVVKPSTLNFSPNVKKISFNVTI  133
             P G  VVV P  L F+    K++F + I
Sbjct  1019  PLGFKVVVSPKKLKFNKRRNKVAFKIYI  1046



>emb|CAA20197.1| putative protein [Arabidopsis thaliana]
 emb|CAB79131.1| putative protein [Arabidopsis thaliana]
Length=1736

 Score =   246 bits (629),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 163/219 (74%), Gaps = 3/219 (1%)
 Frame = -2

Query  687   SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
             +GTS ATP VAG+V LLKA HPDWSPA +KSAI+TTAW TD  SGEPIF EGE   KLAD
Sbjct  1516  TGTSYATPVVAGLVVLLKALHPDWSPAALKSAIMTTAWKTD-PSGEPIFAEGEP-RKLAD  1573

Query  507   AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SIL  331
              FDYG G++N  RA+ PGLVYDM+  DY++  CA GY+  +I+II G+ T C     SIL
Sbjct  1574  PFDYGAGLVNAERAKDPGLVYDMNIDDYIHYFCATGYNDTSITIITGKPTKCSSPLPSIL  1633

Query  330   DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
             D+N+P+ITIPDL+  +T+TRTVTNVGP +S Y+ +VEPP+G+ +VV+P TL F  N KK+
Sbjct  1634  DLNYPAITIPDLEEEVTVTRTVTNVGPVDSVYRAVVEPPRGVEIVVEPETLVFCSNTKKL  1693

Query  150   SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              F V +S+ H  NTGF+FGS  W DG  NV IP+SV+ +
Sbjct  1694  GFKVRVSSSHKSNTGFFFGSFTWTDGTRNVTIPLSVRIR  1732


 Score =   179 bits (455),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 134/208 (64%), Gaps = 8/208 (4%)
 Frame = -2

Query  747   ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
             +L   IP+D   R   Y   SGTSMATP +AGIVALLK +HP+WSPAVIKSA+VTTA  T
Sbjct  847   LLTPRIPTDEDTREFVY---SGTSMATPVIAGIVALLKISHPNWSPAVIKSALVTTAMKT  903

Query  567   DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
             D   GE +  +G    K+ADAFDYGGG++N  +A  PGLVYDM   DY + LC+   Y+ 
Sbjct  904   D-PYGERLTVDGGNY-KVADAFDYGGGLVNLEKATDPGLVYDMDINDYTHYLCSQTLYTD  961

Query  390   KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
             K +S + G   + C     SILD+N PSITIPDLK  + +TRTVTNVG   S YK ++E 
Sbjct  962   KKVSALTGNVNNKCPSSSSSILDLNVPSITIPDLKGTVNVTRTVTNVGRVKSVYKPVIEA  1021

Query  216   PKGIIVVVKPSTLNFSPNVKKISFNVTI  133
             P G  VVV P  L F+    K++F + +
Sbjct  1022  PFGFNVVVSPKKLKFNKTRNKLAFTIYV  1049



>ref|XP_006399712.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
 gb|ESQ41165.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
Length=752

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 122/219 (56%), Positives = 159/219 (73%), Gaps = 3/219 (1%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
            +GTSMATP VAG+VALLKA HPDWSPA I+SA++TTA TTD   GEPIF +G +  + A+
Sbjct  529  TGTSMATPAVAGVVALLKAVHPDWSPAAIRSALITTASTTD-PYGEPIFADGLS-QRQAN  586

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SIL  331
             FDYGGG+++PN+A  PGLVYD    DY   LCA  Y+   I+ ++  T  C     S+ 
Sbjct  587  PFDYGGGLVSPNKAADPGLVYDADAEDYRRFLCASDYNEGIIAKLSQTTYKCPTTKPSVF  646

Query  330  DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
            ++N PSITIP LK  +TLTRTVTNVGP +S YK++VEPP GI + V P+TL F+ +VKK+
Sbjct  647  ELNLPSITIPFLKEDVTLTRTVTNVGPVDSLYKLVVEPPLGIKISVTPNTLQFNSSVKKL  706

Query  150  SFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            S+ VT+ST H  N+ +YFG L W DG HNV IP+S++T+
Sbjct  707  SYKVTVSTTHKANSIYYFGRLTWTDGSHNVTIPLSIRTE  745



>ref|XP_009125836.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score =   240 bits (612),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 165/223 (74%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y  +SGTSMA P VAG+VALLKA HPDWSPA++KSAI+TTA +TD   GEPI++EG +  
Sbjct  533  YTAMSGTSMAAPAVAGVVALLKAVHPDWSPAMLKSAIITTASSTD-PYGEPIYSEGLS-R  590

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FD+GGG++NP +A  PGLVYD    DY+  LCA  Y   +I+ I+ QT  C    
Sbjct  591  KLADPFDFGGGLVNPEKAANPGLVYDADVQDYIRFLCASSYDEMSITKISKQTVKCPSPR  650

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD+N PSITIP LK  +TLTRTVTNVGP +S YK++V+PP G+ + V P TL F+  
Sbjct  651  PSMLDLNLPSITIPFLKEDVTLTRTVTNVGPVDSVYKLIVQPPMGVKISVTPQTLVFNSG  710

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            VKK+S+ VT+ST H  N+ ++FGSL W DG+HNV IP+S++T+
Sbjct  711  VKKLSYQVTVSTTHKANSIYFFGSLTWTDGIHNVVIPLSIRTQ  753



>ref|XP_003537841.1| PREDICTED: cucumisin-like [Glycine max]
Length=782

 Score =   240 bits (612),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 165/252 (65%), Gaps = 16/252 (6%)
 Frame = -2

Query  750  NILAAYIPSDPAVRIS-------------TYNFISGTSMATPHVAGIVALLKAAHPDWSP  610
            NILAA+ P+  A  +S              +N  SGTSMA PH+ GIVAL+K  HP WSP
Sbjct  524  NILAAWSPASSARLVSDAENEDETELHPLNFNIESGTSMACPHITGIVALIKTIHPTWSP  583

Query  609  AVIKSAIVTTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTT  430
            A IKSA+VTTA +      E I+ EG    K AD FDYGGG ++PN+   PGLVYDM  +
Sbjct  584  AAIKSALVTTA-SLKNEYKEYIWAEGAP-HKQADPFDYGGGHVDPNKVTDPGLVYDMKNS  641

Query  429  DYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVG  253
            DY+  LC+MGY++ AISI+ G  T CHK    +L++N PSITIP+LK+P+T++RTVTNVG
Sbjct  642  DYIRFLCSMGYNNTAISILTGFPTKCHKSHKFLLNMNLPSITIPELKQPLTVSRTVTNVG  701

Query  252  PENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDG  73
            P  S Y   V  P GI V+V+PSTL FS   KK+ F VT S+     + F FG L+W DG
Sbjct  702  PVKSNYTARVVAPIGISVIVEPSTLAFSSKRKKMKFKVTFSSKLRVQSRFSFGYLLWEDG  761

Query  72   VHNVRIPISVKT  37
            +H VRIP++V++
Sbjct  762  LHEVRIPLAVRS  773



>gb|KHN39834.1| Cucumisin, partial [Glycine soja]
Length=753

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 128/252 (51%), Positives = 165/252 (65%), Gaps = 16/252 (6%)
 Frame = -2

Query  750  NILAAYIPSDPAVRIS-------------TYNFISGTSMATPHVAGIVALLKAAHPDWSP  610
            NILAA+ P+  A  +S              +N  SGTSMA PH+ GIVAL+K  HP WSP
Sbjct  495  NILAAWSPASSARLVSDAENEDETELHPLNFNIESGTSMACPHITGIVALIKTIHPTWSP  554

Query  609  AVIKSAIVTTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTT  430
            A IKSA+VTTA +      E I+ EG    K AD FDYGGG ++PN+   PGLVYDM  +
Sbjct  555  AAIKSALVTTA-SLKNEYKEYIWAEGAP-HKQADPFDYGGGHVDPNKVTDPGLVYDMKNS  612

Query  429  DYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVG  253
            DY+  LC+MGY++ AISI+ G  T CHK    +L++N PSITIP+LK+P+T++RTVTNVG
Sbjct  613  DYIRFLCSMGYNNTAISILTGFPTKCHKSHKFLLNMNLPSITIPELKQPLTVSRTVTNVG  672

Query  252  PENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDG  73
            P  S Y   V  P GI V+V+PSTL FS   KK+ F VT S+     + F FG L+W DG
Sbjct  673  PVKSNYTARVVAPIGISVIVEPSTLAFSSKRKKMKFKVTFSSKLRVQSRFSFGYLLWEDG  732

Query  72   VHNVRIPISVKT  37
            +H VRIP++V++
Sbjct  733  LHEVRIPLAVRS  744



>ref|XP_010436935.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   239 bits (611),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 132/240 (55%), Positives = 172/240 (72%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P + ++    +  +SGTSM+TP V+G+V LLK+ HPDWSPA IKSAIVTTAW 
Sbjct  516  NILAAISP-NSSINDGGFAMMSGTSMSTPVVSGVVVLLKSLHPDWSPAAIKSAIVTTAWK  574

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G +  KLAD FDYGGG+INP +A  PGL+YDM+T DY+  LC+  Y+ 
Sbjct  575  TD-PSGEPIFADGSS-RKLADPFDYGGGLINPEKAVNPGLIYDMTTDDYILYLCSAEYND  632

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS + G+ T C +   S+LD+N PSITIP+L+  +T  RTVTNVGP  S YKV+++PP
Sbjct  633  ISISRVLGKATVCPNPKPSVLDLNLPSITIPNLREEVTFKRTVTNVGPLKSVYKVVIDPP  692

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P+ L F     K+SF V +ST H  NTG+YFGSL W + +HNV IP+SV+T+
Sbjct  693  TGVTVTVTPTELLFDSTNTKLSFTVRVSTTHKVNTGYYFGSLTWTNDLHNVVIPVSVRTQ  752



>ref|XP_002888489.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64748.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=760

 Score =   239 bits (611),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 164/242 (68%), Gaps = 10/242 (4%)
 Frame = -2

Query  753  TNILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAW  574
            + ILAA +PS      + Y  +SGTSMA P V+GIV+LL+   PDWSPA I+SA+VTTA 
Sbjct  521  SGILAA-VPSR-----AGYELMSGTSMAAPVVSGIVSLLRQKRPDWSPAAIRSALVTTAL  574

Query  573  TTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS  394
             TD  SGEPI  EG    KLAD+FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY 
Sbjct  575  QTD-PSGEPIAAEGSP-RKLADSFDYGGGLVNPGKVADPGLVYDMGHDEYVHYLCSAGYD  632

Query  393  SKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            + +IS + G+  +C     S+LDVN PSITIP L   IT+TRTVTNVGP  S YK +++ 
Sbjct  633  NTSISKLLGKIYTCPSPIPSMLDVNLPSITIPYLSEEITITRTVTNVGPVGSVYKAVIQA  692

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGV-HNVRIPISVK  40
            P+GI + V P TL F  N  KI+F V +ST H  NT + FGSL W D   HNVRIP+SV+
Sbjct  693  PQGINLQVSPETLEFGSNTNKITFTVKVSTTHRANTDYLFGSLTWTDNEGHNVRIPLSVR  752

Query  39   TK  34
            T+
Sbjct  753  TR  754



>ref|NP_564868.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAC43166.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64891.1| At1g66210 [Arabidopsis thaliana]
 gb|AEE34477.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=759

 Score =   239 bits (609),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 157/224 (70%), Gaps = 4/224 (2%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y+F+SGTSM+TP V+GIVALL+   PDWSPA I+SA+VTTA  TD  SGEPI  EG +  
Sbjct  532  YDFMSGTSMSTPVVSGIVALLRKKRPDWSPAAIRSALVTTALQTD-PSGEPIAAEG-SPR  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY + +IS + G+  +C    
Sbjct  590  KLADPFDYGGGLVNPVKVADPGLVYDMGHDEYVHYLCSAGYDNTSISKLLGEIYTCPTPI  649

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LDVN PSITIP L   IT+TRTVTNVGP  S YK +++ P+GI + V P TL F  N
Sbjct  650  PSMLDVNMPSITIPYLSEEITITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSN  709

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGV-HNVRIPISVKTK  34
              K +F V +ST H  NT + FGSL W D   HNVRIP+SV+T+
Sbjct  710  TNKTTFTVKVSTTHRANTDYLFGSLTWADNEGHNVRIPLSVRTR  753



>gb|AAG51763.1|AC066691_3 hypothetical protein; 8963-6048 [Arabidopsis thaliana]
Length=758

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 156/224 (70%), Gaps = 4/224 (2%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y+F+SGTSM+TP V+GIVALL+   PDWSPA I+SA+VTTA  TD  SGEPI  EG    
Sbjct  531  YDFMSGTSMSTPVVSGIVALLRKKRPDWSPAAIRSALVTTALQTD-PSGEPIAAEGSP-R  588

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYGGG++NP +   PGLVYDM   +YV+ LC+ GY + +IS + G+  +C    
Sbjct  589  KLADPFDYGGGLVNPVKVADPGLVYDMGHDEYVHYLCSAGYDNTSISKLLGEIYTCPTPI  648

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LDVN PSITIP L   IT+TRTVTNVGP  S YK +++ P+GI + V P TL F  N
Sbjct  649  PSMLDVNMPSITIPYLSEEITITRTVTNVGPVGSVYKAVIQAPQGINLQVSPETLEFGSN  708

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGV-HNVRIPISVKTK  34
              K +F V +ST H  NT + FGSL W D   HNVRIP+SV+T+
Sbjct  709  TNKTTFTVKVSTTHRANTDYLFGSLTWADNEGHNVRIPLSVRTR  752



>ref|XP_006415135.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
 gb|ESQ33488.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
Length=776

 Score =   239 bits (609),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 136/240 (57%), Positives = 170/240 (71%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+D       ++  SGTSM+TP VAGIVALLK+ HP WSPA I+SAIVTTAW 
Sbjct  531  NILAATSPND-TFNDRGFSMKSGTSMSTPVVAGIVALLKSLHPHWSPAAIRSAIVTTAWR  589

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD  SGEPIF +G    KLAD FDYGGG++N  +A KPGLVYDM   DYV  LC++GY+ 
Sbjct  590  TD-PSGEPIFADGSN-RKLADPFDYGGGVVNSEKAAKPGLVYDMGVKDYVLYLCSVGYTD  647

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +IS +  + T C +   S+LD+N PSITIP+L + +T+TRTVTNVGP  S YK ++E P
Sbjct  648  SSISRLVRKKTVCANPKPSVLDLNLPSITIPNLGKEVTVTRTVTNVGPVGSVYKAVIEAP  707

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             G+ V V P TL F+   KK+SF V + T H  NTG+YFGSL W D +HNV IP+SV+T+
Sbjct  708  MGVNVTVTPRTLVFNAKTKKLSFKVRVLTNHRVNTGYYFGSLTWTDSLHNVVIPLSVRTQ  767



>ref|XP_006286458.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
 gb|EOA19356.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
Length=759

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 131/222 (59%), Positives = 162/222 (73%), Gaps = 4/222 (2%)
 Frame = -2

Query  693  FISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKL  514
            F SGTSMATP V  +V LLK+ +P WSP+ IKSAIVTTAW TD  SGEPIF EG +  KL
Sbjct  531  FKSGTSMATPVVTAVVVLLKSLYPHWSPSAIKSAIVTTAWKTD-PSGEPIFAEGSS-RKL  588

Query  513  ADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLC-AMGYSSKAISIIAGQTTSC-HKGF  340
            AD FDYGGG+INP +A +PGLVYDM+  DY++ LC A  ++  +IS + G   +C +   
Sbjct  589  ADPFDYGGGLINPEKAARPGLVYDMTIDDYISYLCSAYNFNDGSISQVLGNKKTCPNPKQ  648

Query  339  SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNV  160
            S+LD+N PSITIPDLK  +TLTRTVTNVGP NS YKVM++ P G+ + V P+TL F+   
Sbjct  649  SVLDLNLPSITIPDLKDEVTLTRTVTNVGPFNSIYKVMIDAPLGVNMTVTPNTLEFNAMT  708

Query  159  KKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             K+SF V  ST H  NTG+YFGSL W D VHNV IP+SV+T+
Sbjct  709  TKVSFKVRFSTTHKVNTGYYFGSLTWTDNVHNVVIPVSVRTQ  750



>emb|CAB36808.1| subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB81271.1| subtilisin-like protease [Arabidopsis thaliana]
Length=769

 Score =   238 bits (607),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 128/264 (48%), Positives = 169/264 (64%), Gaps = 29/264 (11%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTT---  580
            +ILAA  P DP    + +   SGTSM+TP V+GI+ LLK+ HP WSPA ++SA+VTT   
Sbjct  505  SILAAVSPLDPGA-FNGFKLHSGTSMSTPVVSGIIVLLKSLHPKWSPAAMRSALVTTGSC  563

Query  579  ---------------------AWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRAR  463
                                 AW T   SGEPIF +G    KLAD FDYGGG++NP +A 
Sbjct  564  FFLFFFFINKPSRTNRSVSFVAWRTS-PSGEPIFAQGSN-KKLADPFDYGGGLVNPEKAA  621

Query  462  KPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRP  286
            KPGLVYDM   DY+N +C+ GY+  +IS + G+ T C     S+LD+N PSITIP+L++ 
Sbjct  622  KPGLVYDMGIKDYINYMCSAGYNDSSISRVLGKKTKCPIPKPSMLDINLPSITIPNLEKE  681

Query  285  ITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI-SFNVTISTCHGFNT  109
            +TLTRTVTNVGP  S Y+ ++E P GI + V P+ L F    K++ +F+V   T H  N+
Sbjct  682  VTLTRTVTNVGPIKSVYRAVIESPLGITLTVNPTILVFKSAAKRVLTFSVKAKTSHKVNS  741

Query  108  GFYFGSLIWNDGVHNVRIPISVKT  37
            G++FGSL W DGVH+V IP+SVKT
Sbjct  742  GYFFGSLTWTDGVHDVTIPVSVKT  765



>gb|AID21654.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   238 bits (607),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 133/243 (55%), Positives = 166/243 (68%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP+D      TY   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  561  LLTPRIPTDEDTSEFTY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  617

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  618  D-PYGERLTVDGGNY-KEADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  675

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  676  KKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  735

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIST-CHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +ST  H  NT FYFGSL W+DG+HNV IPIS++
Sbjct  736  PLGFKVVVSPKKLKFNKRRNKVAFKVRVSTGSHRVNTAFYFGSLTWSDGLHNVTIPISLR  795

Query  39   TKY  31
            T++
Sbjct  796  TRF  798



>ref|XP_007039330.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23831.1| Subtilase family protein, putative [Theobroma cacao]
Length=1029

 Score =   239 bits (609),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 152/211 (72%), Gaps = 4/211 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA I     +R   Y   SGTSMATPHV+GIVALLKA HPDWSPA IKSA+VTTAWT
Sbjct  530  NILAA-ISQLNQLRDDGYAIRSGTSMATPHVSGIVALLKAIHPDWSPAAIKSALVTTAWT  588

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             D +SG P+F EG    KLA+ FD+GGGI+NPN A  PGLVYDM T+DY+  LCAMGY+ 
Sbjct  589  KD-ASGLPLFAEGSP-QKLANPFDFGGGIVNPNGAADPGLVYDMGTSDYIQYLCAMGYND  646

Query  390  KAISIIAGQTTSCH-KGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + GQ+T C  K  SILDVN PSITI  L+   TLTRTVTNVG   S Y+ ++EPP
Sbjct  647  SAISRLTGQSTVCPIKKPSILDVNVPSITISSLRNSATLTRTVTNVGAPISVYRAVIEPP  706

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCH  121
             GI V V+P+ L F+   KKISF+VT+S  H
Sbjct  707  TGITVTVRPNVLVFNSTTKKISFSVTVSAAH  737



>ref|XP_006829610.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
 gb|ERM97026.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
Length=732

 Score =   236 bits (601),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 162/238 (68%), Gaps = 5/238 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA +PS P      + F+SGTSMA PHVAGIVALL + HPDWSPA IKSA+VTTA T
Sbjct  488  NILAA-VPS-PDSTSDKFMFMSGTSMACPHVAGIVALLMSIHPDWSPAAIKSALVTTAST  545

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             D++  EP+  EG    K+AD FDYGGG +NPN+A  PGL+YDM  +DY+   CAMGY++
Sbjct  546  MDKNE-EPMLAEGYP-RKVADPFDYGGGHVNPNQAADPGLIYDMDISDYILFFCAMGYNN  603

Query  390  KAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS++  +T SC K   SI ++N PSI IP+LK  +T+ R VTNVG  +S YK MVE P
Sbjct  604  SAISLVTSKTISCPKDPPSIPNMNLPSIVIPELKTSVTIARKVTNVGKVHSVYKAMVESP  663

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
             G+ VVV+P  L F+     + F VT +  H     + FGSLIW+DG H VR PI+V+
Sbjct  664  TGVKVVVEPKVLYFNEATIVLPFKVTFTVVHQMQGDYTFGSLIWSDGEHFVRSPIAVR  721



>ref|XP_002887016.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63275.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=753

 Score =   236 bits (602),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/223 (57%), Positives = 160/223 (72%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSMATP V+GIV LL+   PDWSPA I+SA+VTTAW TD  SGEPIF+EG T  
Sbjct  527  YKFMSGTSMATPVVSGIVGLLRQTRPDWSPAAIRSALVTTAWKTD-PSGEPIFSEGST-R  584

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSC-HKG  343
            KLAD FDYGGG+INP +   PGL+YDM   DY++ LC+  Y + +IS + G+T  C +  
Sbjct  585  KLADPFDYGGGLINPEKVTDPGLIYDMGIDDYLHYLCSAEYDNASISKLLGKTYKCTYPK  644

Query  342  FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD N PSITIP L   +T+TRTVTNVGP +S Y+ ++E P GI + V P TL F  N
Sbjct  645  PSMLDFNLPSITIPSLTGEVTVTRTVTNVGPASSVYRPVIESPFGIELDVNPKTLVFGSN  704

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            + KI+F+V + T H  NT +YFGSL W DGVHNV  P+SV+TK
Sbjct  705  ITKITFSVRVKTSHRVNTDYYFGSLCWTDGVHNVSTPVSVRTK  747



>gb|AID21679.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   236 bits (601),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 165/243 (68%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP+D      TY   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  561  LLTPRIPTDKDTSEFTY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  617

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  618  D-PYGERLTVDGGNY-KEADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  675

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  676  KKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  735

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +S   H  NT FYFGSL W+DG+HNV IPIS++
Sbjct  736  PLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVTIPISLR  795

Query  39   TKY  31
            T++
Sbjct  796  TRF  798



>gb|AID21686.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   235 bits (600),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 165/243 (68%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP+D      TY   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  561  LLTPRIPTDKDTSEFTY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  617

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  618  D-PYGERLTVDGGNY-KEADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  675

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  676  KKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  735

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +S   H  NT FYFGSL W+DG+HNV IPIS++
Sbjct  736  PLGFKVVVSPKKLKFNKRRSKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVTIPISLR  795

Query  39   TKY  31
            T++
Sbjct  796  TRF  798



>gb|ACN35690.1| unknown [Zea mays]
Length=279

 Score =   223 bits (568),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 161/242 (67%), Gaps = 6/242 (2%)
 Frame = -2

Query  750  NILAAYIPS---DPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTT  580
            NILAA+ P+     A+    +   SGTSM+ PH++G+VALLK+ HP+WSPA +KSA+VTT
Sbjct  31   NILAAWTPAAAISSAIGSVKFKIDSGTSMSCPHISGVVALLKSMHPNWSPAAVKSALVTT  90

Query  579  AWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG  400
            A   D + G  I +E    ++ A+ FDYGGG ++PN A  PGLVYDM T+DYV  LC+MG
Sbjct  91   ASVHD-TYGFEIVSEAAPYNQ-ANPFDYGGGHVDPNSAAHPGLVYDMGTSDYVRFLCSMG  148

Query  399  YSSKAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMV  223
            Y+  AIS +A Q  +C H   + L++N PSI+IP+L+  +T++RTVTNVG   + Y+  V
Sbjct  149  YNVSAISSLAQQHETCQHTPKTQLNLNLPSISIPELRGRLTVSRTVTNVGSALTKYRARV  208

Query  222  EPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISV  43
            E P G+ V V PS L F+  V+K++F VT          +YFGSL W DGVH VRIP+ V
Sbjct  209  EAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAKLKVQGRYYFGSLTWEDGVHAVRIPLVV  268

Query  42   KT  37
            +T
Sbjct  269  RT  270



>emb|CAN80173.1| hypothetical protein VITISV_018392 [Vitis vinifera]
Length=928

 Score =   236 bits (602),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 119/216 (55%), Positives = 158/216 (73%), Gaps = 3/216 (1%)
 Frame = -2

Query  705  STYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGET  526
            + Y  +SGTSMATPHV+G VALL+A + +WSPA IKSAIVTTAWTTD  SGEP+F EG+ 
Sbjct  545  TKYYLMSGTSMATPHVSGAVALLRALNREWSPAAIKSAIVTTAWTTD-PSGEPVFAEGQP  603

Query  525  ISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHK  346
            + KLAD FD+GGGI+NPN A  PGLVYDM   D +  LCAMGY++ AI+ + G+ TSC  
Sbjct  604  M-KLADPFDFGGGILNPNGAGNPGLVYDMGKDDCILYLCAMGYNNSAIAKVTGRPTSCPC  662

Query  345  GF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFS  169
               SILDVN PSITIP+L+  ++LTR+VTNVG  +S Y  +++PP G+ + ++P  L F+
Sbjct  663  NRPSILDVNLPSITIPNLQYSVSLTRSVTNVGAVDSEYNAVIDPPPGVTIKLEPDRLVFN  722

Query  168  PNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNV  61
              ++ I+F V +S+    +TGF FGSL W+DG H +
Sbjct  723  SKIRTITFRVMVSSARRVSTGFSFGSLAWSDGEHAI  758



>ref|XP_006358675.1| PREDICTED: xylem serine proteinase 1-like [Solanum tuberosum]
Length=1174

 Score =   237 bits (604),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/250 (51%), Positives = 161/250 (64%), Gaps = 16/250 (6%)
 Frame = -2

Query  750   NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
             NILAA  P         +  +SGTSMA PHV+GIVALLK AHPDWSPA IKSA+VTTAW 
Sbjct  927   NILAAVRPQKGD---HGFQLMSGTSMAAPHVSGIVALLKVAHPDWSPAAIKSALVTTAWN  983

Query  570   TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS-  394
              D    E I++EG    K+AD FD+GGGI NPN A  PGLVYDM   DY+N LC++GYS 
Sbjct  984   EDTYKSE-IYSEGAG-DKIADPFDFGGGICNPNGATDPGLVYDMDKNDYLNYLCSLGYSN  1041

Query  393   ---SKAISIIAGQTTSCHKGF-------SILDVNFPSITIPDLKRPITLTRTVTNVGPEN  244
                  A ++ +    S   G        S L++N PSI+IP+LK  +T+ RTVTNVG  N
Sbjct  1042  DKMQNATTLFSKTKNSTSSGIICPNKVPSRLNLNLPSISIPNLKNSVTIKRTVTNVGNVN  1101

Query  243   STYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHN  64
             + YKV+++PP+  +V V P  + F+   KKISF V I++ H   + F FGSL WNDG H 
Sbjct  1102  AIYKVVIKPPRNTVVKVSPHIVKFNSKTKKISFEVKITSTHQRMSKFTFGSLAWNDGKHF  1161

Query  63    VRIPISVKTK  34
             VRIPI+V+ +
Sbjct  1162  VRIPIAVRKQ  1171



>ref|XP_010449088.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=800

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 133/244 (55%), Positives = 165/244 (68%), Gaps = 9/244 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            ++L   IP+D       Y   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  
Sbjct  556  SLLTPRIPTDEDTSEFAY---SGTSMATPVIAGIVALLKTSHPNWSPAAIKSALVTTAIK  612

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YS  394
            TD   GE +  +G    K ADAFDYGGG++NP +A  PGLVYDM   DY++ LC+   Y+
Sbjct  613  TD-PYGERVAVDGGNY-KAADAFDYGGGLVNPEKATDPGLVYDMDINDYIHYLCSQALYT  670

Query  393  SKAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVE  220
             K +S +AG  T  C   G SILDVN PSITIPD+K  IT+TRTVTNVGP +S Y  ++E
Sbjct  671  DKKVSALAGNVTKKCPSSGSSILDVNVPSITIPDVKGEITVTRTVTNVGPVDSVYTPVME  730

Query  219  PPKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISV  43
             P G  V V P  L F+    KI+F V++S   H  NT FYFGSL W+DGVHNV IPIS+
Sbjct  731  APFGFSVKVSPEKLVFNKGSNKIAFKVSVSPGSHRVNTAFYFGSLTWSDGVHNVTIPISL  790

Query  42   KTKY  31
            +T++
Sbjct  791  RTRF  794



>ref|XP_010499843.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Camelina sativa]
Length=1161

 Score =   236 bits (603),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 125/223 (56%), Positives = 154/223 (69%), Gaps = 4/223 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P D    +  ++ ++GTSMA P +AG+VALLKA HP+WSPA  +SAIVTTAW 
Sbjct  530  SILAATSP-DSNSSVGGFDILAGTSMAAPVIAGVVALLKALHPNWSPAAFRSAIVTTAWR  588

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE IF EG +  K+AD FDYGGGI+NP +A  PGL+YDM T DY+  LC+ GY+ 
Sbjct  589  TD-PFGEQIFAEGSS-RKVADPFDYGGGIVNPEKASDPGLIYDMGTQDYILYLCSAGYND  646

Query  390  KAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             AIS + G+ T C     S+LDVN PSITIP+LK  +TLTRTVTNVG  +S YKV+VEPP
Sbjct  647  SAISQLVGKVTVCSNLKPSVLDVNLPSITIPNLKDEVTLTRTVTNVGLADSVYKVVVEPP  706

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLI  85
             GI V V P TL F+     + F V +ST H  NTGF+FG L 
Sbjct  707  LGIRVAVTPETLVFNSKTNSVPFTVRVSTTHKINTGFFFGRLF  749



>emb|CCI61493.1| unnamed protein product [Arabidopsis halleri]
 gb|AJP61102.1| At4g21323p-like protein [Arabidopsis halleri]
 gb|AJP61121.1| At4g21323p-like protein [Arabidopsis halleri]
Length=804

 Score =   234 bits (597),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 131/243 (54%), Positives = 165/243 (68%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP+D       Y   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  561  LLTPRIPTDEDTSEFAY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  617

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K+ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  618  D-PYGERLTVDGGNY-KVADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  675

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  676  KKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  735

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +S   H  NT FYFGSL W+DG+HNV IPIS++
Sbjct  736  PLGFKVVVWPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVTIPISLR  795

Query  39   TKY  31
            T++
Sbjct  796  TRF  798



>emb|CDY49641.1| BnaCnng17930D [Brassica napus]
Length=743

 Score =   233 bits (595),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 127/223 (57%), Positives = 150/223 (67%), Gaps = 18/223 (8%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSMATP V GIVALLK   PDWSPA I+SA+VTTA+ TD  SGEPI  EG    
Sbjct  532  YEFMSGTSMATPVVTGIVALLKQKRPDWSPAAIRSALVTTAFQTD-PSGEPIAAEGSP-R  589

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            K+AD FDYGGG++NP +   PGLVYDM   +YV+ L     S                  
Sbjct  590  KIADPFDYGGGLVNPGKVADPGLVYDMGHDEYVHYLFYTCPSPTP---------------  634

Query  339  SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNV  160
            S+LDVN PSITIP L + IT+TRTVTNVGP  S YK ++EPP GI + V P TL F PN 
Sbjct  635  SMLDVNLPSITIPYLSQEITITRTVTNVGPVGSVYKAVIEPPLGINLQVSPKTLEFGPNT  694

Query  159  KKISFNVTISTCHGFNTGFYFGSLIWND-GVHNVRIPISVKTK  34
            KKI+F V +ST H  NT ++FGSL W D GVHNVRIP+SV+T+
Sbjct  695  KKITFTVKVSTTHRVNTDYHFGSLTWTDNGVHNVRIPLSVRTR  737



>ref|XP_011079238.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Sesamum indicum]
Length=780

 Score =   234 bits (596),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 158/248 (64%), Gaps = 13/248 (5%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P  PA   + + F+SGTSMA PH++GIVALL+A HP WSPA IKSA+VTTAW 
Sbjct  530  SILAAVPPGYPA-NDNGFAFMSGTSMAAPHLSGIVALLRALHPHWSPAAIKSALVTTAWN  588

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGY--  397
             D S   PIF EG   +K+AD FD+GGGI+NPN A  PGLVYDM   DY+N LC+  Y  
Sbjct  589  ED-SHKTPIFAEGSP-AKIADPFDFGGGIVNPNGAAYPGLVYDMDREDYMNYLCSQDYYT  646

Query  396  --------SSKAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENS  241
                     + A +  A Q    ++  SIL++N PSI IP LK  IT+ R VTNVGP NS
Sbjct  647  ADIYNATKETSAYNATAEQLICQNRYLSILNLNLPSIVIPALKTSITVKRRVTNVGPSNS  706

Query  240  TYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNV  61
             Y+  ++ P G  V VKP  L F  N + I F VT++     NTG+ FGSL W DG H+V
Sbjct  707  VYRATIKFPIGTTVSVKPDVLVFDSNTRMIDFEVTVNDEQNMNTGYVFGSLTWTDGKHSV  766

Query  60   RIPISVKT  37
            R PISV+T
Sbjct  767  RSPISVRT  774



>ref|XP_008778788.1| PREDICTED: subtilisin-like protease SBT5.4, partial [Phoenix 
dactylifera]
Length=411

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/242 (50%), Positives = 158/242 (65%), Gaps = 6/242 (2%)
 Frame = -2

Query  750  NILAAYIPSDP-AVRISTYNFI--SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTT  580
            NILA++ P+ P +  +S  NF   SGTSM+ PH++G+ ALLK+ HP+WSPA IKSA++TT
Sbjct  163  NILASWSPASPLSSNLSPLNFKIESGTSMSCPHISGVAALLKSVHPNWSPAAIKSALITT  222

Query  579  AWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG  400
            A   D   G  I  EG    K A+ FDYGGG +NPN+A  PGL+YDM  +DYV  LC+MG
Sbjct  223  ASVNDEY-GLGIVAEGAP-HKQANLFDYGGGHVNPNKAMDPGLIYDMEISDYVRFLCSMG  280

Query  399  YSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMV  223
            Y++  IS +    T CH    S  D+N PSI+IP+LK+ +T +RTVTNVGP  S Y   V
Sbjct  281  YNNSVISSMTQHNTICHNASKSQKDLNLPSISIPELKKTVTASRTVTNVGPVMSAYAAHV  340

Query  222  EPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISV  43
            E P G+ V VKPS L F   +KK+ F VT          + FGSL W+DG+H VRIP++V
Sbjct  341  ETPPGVSVHVKPSILLFDSTIKKLKFQVTFQPRLKLQGRYSFGSLTWDDGIHLVRIPLAV  400

Query  42   KT  37
            +T
Sbjct  401  RT  402



>gb|AID21619.1| At4g21323p-like protein [Arabidopsis halleri]
Length=804

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 130/243 (53%), Positives = 165/243 (68%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP+D       Y   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  561  LLTPRIPTDEDTSEFAY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  617

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K+ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  618  D-PYGERLTVDGGNY-KVADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  675

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  676  KKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  735

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +S   H  NT F+FGSL W+DG+HNV IPIS++
Sbjct  736  PLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFFFGSLTWSDGLHNVTIPISLR  795

Query  39   TKY  31
            T++
Sbjct  796  TRF  798



>gb|AID21582.1| AT4G21323p [Arabidopsis halleri]
Length=804

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 165/243 (68%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP++       Y   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  561  LLTPRIPTEEDTSEFAY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  617

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K+ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  618  D-PYGERLTVDGGNY-KVADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  675

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  676  KKVSALTGNVTSKCPSSGLSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  735

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +S   H  NT F+FGSL W+DG+HNV IPIS++
Sbjct  736  PLGFKVVVSPKKLKFNKKRNKVAFKVRVSPGSHRVNTAFFFGSLTWSDGLHNVTIPISLR  795

Query  39   TKY  31
            T++
Sbjct  796  TRF  798



>gb|AID21627.1| At4g21323p-like protein [Arabidopsis lyrata]
Length=804

 Score =   234 bits (596),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 164/243 (67%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP+D      TY   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  561  LLTPRIPTDKDTSEFTY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  617

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  618  D-PYGERLTVDGGNY-KEADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  675

Query  390  KAISIIAGQTTS-CHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C    S ILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  676  KKVSALTGNVTSKCPSSRSSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  735

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L FS    K++F V +S   H  NT FYFGSL W+DG+HNV IPIS++
Sbjct  736  PLGFKVVVSPKKLKFSKRRSKVAFKVRVSPGSHRVNTAFYFGSLTWSDGLHNVTIPISLR  795

Query  39   TKY  31
            T++
Sbjct  796  TRF  798



>gb|AID21602.1| At4g21323p-like protein [Arabidopsis halleri]
Length=803

 Score =   233 bits (593),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 165/243 (68%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP++       Y   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  560  LLTPRIPTEEDTSEFAY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  616

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D   GE +  +G    K+ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  617  D-PYGERLTVDGGNY-KVADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  674

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVGP  S YK ++E 
Sbjct  675  KKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKRNVTVTRSVTNVGPVKSVYKPVIET  734

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +S   H  NT F+FGSL W+DG+HNV IPIS++
Sbjct  735  PLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVNTAFFFGSLTWSDGLHNVTIPISLR  794

Query  39   TKY  31
            T++
Sbjct  795  TRF  797



>ref|XP_007131764.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
 gb|ESW03758.1| hypothetical protein PHAVU_011G039900g [Phaseolus vulgaris]
Length=746

 Score =   232 bits (591),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 159/249 (64%), Gaps = 13/249 (5%)
 Frame = -2

Query  750  NILAAYIPSDPAVRIS----------TYNFISGTSMATPHVAGIVALLKAAHPDWSPAVI  601
            NILAA+ P+     +S          T+N  SGTSM+ PH++GIVAL+K  HP WSPA I
Sbjct  491  NILAAWSPASSERLVSDAKSEKLQPLTFNIESGTSMSCPHISGIVALIKTVHPTWSPAAI  550

Query  600  KSAIVTTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYV  421
            KSA+VTTA +      E I+ EG    K AD FDYGGG ++PN+   PGLVYDM  +DY+
Sbjct  551  KSALVTTA-SLKNEYHEYIWAEGAP-HKQADPFDYGGGHVDPNKVTDPGLVYDMKNSDYI  608

Query  420  NCLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVGPEN  244
            + LC+M Y+  AIS + G  T CHK    +L++N PSI IP+LK+P+T++RTVTNVGP  
Sbjct  609  HFLCSMDYNDTAISFLTGVPTKCHKSHKYLLNMNLPSIIIPELKQPLTVSRTVTNVGPIK  668

Query  243  STYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHN  64
            S Y   VE P G+ V V P TL FSP  KK+ F VT S+       F FG L W DG H 
Sbjct  669  SVYTARVEAPIGVSVTVVPPTLTFSPKRKKMKFKVTFSSKLRIQGRFSFGYLFWEDGSHE  728

Query  63   VRIPISVKT  37
            VR+P++V++
Sbjct  729  VRMPLAVRS  737



>emb|CDX93810.1| BnaA09g24100D [Brassica napus]
Length=750

 Score =   231 bits (590),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 124/239 (52%), Positives = 160/239 (67%), Gaps = 17/239 (7%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAA  P +       +  +SGTSMATP ++G+VALLK+ HPDWSPA  +SAIVTTAW 
Sbjct  520  SILAATSP-NATFNAGGFVMLSGTSMATPAISGVVALLKSLHPDWSPAAFRSAIVTTAWR  578

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            TD   GE +  EG +  K+AD FDYGGG++NP +A +PGL+YDM   DY+  LC      
Sbjct  579  TD-PFGEQLPAEGSS-RKVADPFDYGGGLVNPEKAAEPGLIYDMGPKDYILYLC------  630

Query  390  KAISIIAGQTTSCHKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPK  211
               S++           S+LD+N PSITIP+LK  + LTRTVTNVGP +S YKV+VEPP 
Sbjct  631  ---SVVCTDPKP-----SVLDMNLPSITIPNLKDEVILTRTVTNVGPVHSVYKVVVEPPL  682

Query  210  GIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            G+ VVV P  L F+   K +SF V +ST H  NTG+YFGSL+W+D V  V IP+SV+T+
Sbjct  683  GVRVVVTPKKLVFNSKTKSVSFTVRVSTTHKINTGYYFGSLVWSDSVRKVTIPVSVRTQ  741



>ref|XP_006829160.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
 gb|ERM96576.1| hypothetical protein AMTR_s00001p00269990 [Amborella trichopoda]
Length=774

 Score =   232 bits (591),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 122/243 (50%), Positives = 163/243 (67%), Gaps = 8/243 (3%)
 Frame = -2

Query  750  NILAAYIPSDPAVRIST-----YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIV  586
            NILAA+ P +P V+  T     YN  SGTSM+ PHV+GIVALL++ HP W+PA IKS++V
Sbjct  524  NILAAWSPYNPPVKTDTQGPLYYNIESGTSMSCPHVSGIVALLRSLHPSWTPAAIKSSLV  583

Query  585  TTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCA  406
            TTA T D   G+ I  EG    K AD FDYGGG I+PN+A  PGL++DM   D++  LC 
Sbjct  584  TTASTRDLY-GQHIIAEGAP-HKQADPFDYGGGHIDPNKAANPGLIFDMGVADHIRFLCF  641

Query  405  MGYSSKAISIIAGQTTSCHKGF-SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKV  229
            MGY++ AIS++A Q T C KG  S+ D+N PS++IP L++ +T++RTVTNVGP  S Y  
Sbjct  642  MGYNNSAISLMARQVTVCPKGSGSMADLNLPSVSIPQLRKSLTISRTVTNVGPVLSVYVA  701

Query  228  MVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPI  49
             V+ P G+ V VKPS L+F+    K+ F VT S        + FGSL+W+DG H V+IP+
Sbjct  702  HVQAPPGVKVAVKPSCLSFNATTNKLKFQVTFSPLLRVQGRYAFGSLMWHDGQHVVKIPL  761

Query  48   SVK  40
             V+
Sbjct  762  VVR  764



>emb|CDY07492.1| BnaA07g25710D [Brassica napus]
Length=757

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSM+TP V+GIV L++   PDWSPA I+SA+VTTAW TD  SGEPIF+EG T  
Sbjct  531  YKFMSGTSMSTPIVSGIVGLIRQTRPDWSPAAIRSALVTTAWRTD-PSGEPIFSEGAT-R  588

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYGGG+INP +   PGLVYDM   DY++ LC+  YS   IS + G+   C    
Sbjct  589  KLADPFDYGGGLINPEKVTDPGLVYDMGLDDYIHYLCSADYSDNEISKLIGKPNQCPSPR  648

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD+N PSITIP L   +T+TRTVTNVGP +S YK ++EPP GI + V P TL F  N
Sbjct  649  PSMLDLNMPSITIPSLTGEVTVTRTVTNVGPADSVYKPVIEPPFGIELEVNPKTLVFGSN  708

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              K +F+V + + H  N  FYFGSL W DG HNV IP+S++TK
Sbjct  709  TTKNTFSVRVRSNHQVNGDFYFGSLCWTDGAHNVTIPVSIRTK  751



>ref|XP_010028643.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=792

 Score =   231 bits (589),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 166/243 (68%), Gaps = 10/243 (4%)
 Frame = -2

Query  750  NILAAYIPS----DPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVT  583
            NILA++ P+    DP +    +N  SGTSMA PH++GIVALLKA HP W+PA+IKS++VT
Sbjct  546  NILASWSPASSELDPPL---NFNIESGTSMACPHISGIVALLKAIHPSWTPAMIKSSLVT  602

Query  582  TAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAM  403
            TA T D+ S + I  EG T  K ADAFDYGGG ++ NRA  PGLVYD   +DYV  LC M
Sbjct  603  TASTKDQYS-QNIVAEGAT-HKQADAFDYGGGHVDANRAADPGLVYDAEISDYVCLLCFM  660

Query  402  GYSSKAISIIAGQTTSCHKGFSIL-DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVM  226
            GY+S AIS + G+ T C +  + L ++N PSI IP+LK+ +T++R VTNVGP NSTY   
Sbjct  661  GYNSSAISTMTGKPTQCKESSNCLVNLNLPSIVIPNLKQQVTVSRIVTNVGPANSTYTAR  720

Query  225  VEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPIS  46
            V+ P G  V VKPS L+F+ ++ K+ F V  ++       + FG+LIW DG+H VRIP+ 
Sbjct  721  VKAPVGTHVRVKPSILSFNSSMGKLKFRVIFNSLLRVQGRYSFGNLIWEDGLHKVRIPLV  780

Query  45   VKT  37
            V+T
Sbjct  781  VQT  783



>ref|XP_009105193.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=757

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 156/223 (70%), Gaps = 3/223 (1%)
 Frame = -2

Query  699  YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETIS  520
            Y F+SGTSM+TP V+GIV L++   PDWSPA I+SA+VTTAW TD  SGEPIF+EG T  
Sbjct  531  YKFMSGTSMSTPIVSGIVGLIRQTRPDWSPAAIRSALVTTAWRTD-PSGEPIFSEGAT-R  588

Query  519  KLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF  340
            KLAD FDYGGG+INP +   PGLVYDM   DY++ LC+  YS   IS + G+   C    
Sbjct  589  KLADPFDYGGGLINPEKVTDPGLVYDMGLDDYIHYLCSADYSDNEISKLIGKPNQCPSPR  648

Query  339  -SILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPN  163
             S+LD+N PSITIP L   +T+TRTVTNVGP +S YK ++EPP GI + V P TL F  N
Sbjct  649  PSMLDLNMPSITIPSLTGEVTVTRTVTNVGPADSVYKPVIEPPFGIELEVNPKTLVFGSN  708

Query  162  VKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
              K +F+V + + H  N  FYFGSL W DG HNV IP+S++TK
Sbjct  709  TTKNTFSVRVRSNHQVNGDFYFGSLCWTDGAHNVTIPVSIRTK  751



>gb|KCW55411.1| hypothetical protein EUGRSUZ_I01318 [Eucalyptus grandis]
Length=769

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 166/243 (68%), Gaps = 10/243 (4%)
 Frame = -2

Query  750  NILAAYIPS----DPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVT  583
            NILA++ P+    DP +    +N  SGTSMA PH++GIVALLKA HP W+PA+IKS++VT
Sbjct  523  NILASWSPASSELDPPL---NFNIESGTSMACPHISGIVALLKAIHPSWTPAMIKSSLVT  579

Query  582  TAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAM  403
            TA T D+ S + I  EG T  K ADAFDYGGG ++ NRA  PGLVYD   +DYV  LC M
Sbjct  580  TASTKDQYS-QNIVAEGAT-HKQADAFDYGGGHVDANRAADPGLVYDAEISDYVCLLCFM  637

Query  402  GYSSKAISIIAGQTTSCHKGFSIL-DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVM  226
            GY+S AIS + G+ T C +  + L ++N PSI IP+LK+ +T++R VTNVGP NSTY   
Sbjct  638  GYNSSAISTMTGKPTQCKESSNCLVNLNLPSIVIPNLKQQVTVSRIVTNVGPANSTYTAR  697

Query  225  VEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPIS  46
            V+ P G  V VKPS L+F+ ++ K+ F V  ++       + FG+LIW DG+H VRIP+ 
Sbjct  698  VKAPVGTHVRVKPSILSFNSSMGKLKFRVIFNSLLRVQGRYSFGNLIWEDGLHKVRIPLV  757

Query  45   VKT  37
            V+T
Sbjct  758  VQT  760



>ref|XP_007039328.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY23829.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=776

 Score =   231 bits (588),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 162/244 (66%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAAYIP     + S Y F+SGTSM+ PHVAGI AL+K+ H +WSPA I+SA+VTTA  
Sbjct  532  DILAAYIPVGKE-KSSGYKFMSGTSMSCPHVAGIAALIKSVHKNWSPAAIRSALVTTASQ  590

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T R+ G  I  EG T  K AD FD GGG++NPN+A  PGL+YD    DYV  LC  GYSS
Sbjct  591  T-RTDGSNIAEEGST-RKAADPFDIGGGLVNPNKAVNPGLIYDAGIEDYVQFLCGTGYSS  648

Query  390  KAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
            KA++ +     +C K   ++L++N PSITIP+LKR +T+TR VTNVGP +S YK +++ P
Sbjct  649  KAVTGLTQTQVNCTKSRLNVLNLNLPSITIPNLKRKVTVTRAVTNVGPVDSVYKAIMQAP  708

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            +GI + V+P  L+F+   + + F VT  +    +  + FGSL W DG H VR PISV+  
Sbjct  709  QGIKLKVEPQILSFNKTTQILPFKVTFFSTRKVSGDYRFGSLSWTDGKHIVRSPISVRAI  768

Query  33   Y*ES  22
              ES
Sbjct  769  LFES  772



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 164/240 (68%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPS-DPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAW  574
            NILA++ P+  P+    T+   SGTSM+ PH++GIVALLKA HP WSPA IKSA+VTTA 
Sbjct  490  NILASWSPARSPSKSPDTFKIESGTSMSCPHISGIVALLKAIHPTWSPAAIKSALVTTAS  549

Query  573  TTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS  394
              D  + + I  EG    K AD FDYGGG ++PN+A  PGL+YD+ ++DY++ LC+MGY+
Sbjct  550  LEDEYA-QSIVAEGAP-HKQADPFDYGGGHVDPNKAISPGLIYDIESSDYIHFLCSMGYN  607

Query  393  SKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            + AIS++AG   +C K    I+++N PSITI +LK+ +T++R VTNVGP NS Y   V+ 
Sbjct  608  NTAISLVAGTKITCQKSTKFIVNLNLPSITIHELKQSMTVSRRVTNVGPVNSVYFARVQA  667

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            P G+ V VKPS L+F+  VKK+ F V   +       F FG+L W DG+H VRIP+ V+T
Sbjct  668  PAGVSVKVKPSVLSFNSTVKKLEFKVIFCSLLRVQGRFTFGNLFWEDGLHVVRIPLVVRT  727



>ref|XP_010056037.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=773

 Score =   230 bits (586),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 128/238 (54%), Positives = 161/238 (68%), Gaps = 4/238 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA +P +P+   + Y  +SGTSM+TPHVAGIVALLKA HPDWSPA  +SA+VTTAW 
Sbjct  528  NILAATLPFNPS-EDNGYTMLSGTSMSTPHVAGIVALLKALHPDWSPAAFRSALVTTAWR  586

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            ++   G PIF  G    KLAD FD GGGI+NPN A +PGL+YD+   DY+  LCAMGY+ 
Sbjct  587  SN-PLGFPIFASGSP-PKLADPFDMGGGIVNPNSAAEPGLIYDVGMPDYILYLCAMGYND  644

Query  390  KAISIIAGQTTSC-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
              IS + G+   C  +  S+ DVN PSITIP L   +T+TRTV N G   S Y  ++EPP
Sbjct  645  TEISHLTGKPAPCPARRPSVSDVNLPSITIPRLTSTVTVTRTVKNTGNPESRYWAVIEPP  704

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
             G  V V+P  L F P  KK +F+VT+      NTG+YFGSL+W DGVH VR P++V+
Sbjct  705  SGTTVTVRPHVLAFDPETKKAAFSVTVCAAVPVNTGYYFGSLVWTDGVHAVRSPLAVR  762



>ref|XP_010513580.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=730

 Score =   229 bits (584),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/215 (55%), Positives = 146/215 (68%), Gaps = 3/215 (1%)
 Frame = -2

Query  675  MATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLADAFDY  496
            +A P V  + A+    +PDWSPA I+SA+VTTAW TD  SGE IF+EG T  KLAD FDY
Sbjct  512  IAAPGVNILSAVTDKYNPDWSPAAIRSALVTTAWRTD-PSGEQIFSEGST-RKLADPFDY  569

Query  495  GGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILDVNF  319
            GGG+INP +   PGL+YDM   DYV+ LC+  Y   AIS + G+   C     S+LD N 
Sbjct  570  GGGLINPEKVANPGLIYDMGINDYVHYLCSAEYDDGAISKLVGKPIKCPSPLPSMLDFNM  629

Query  318  PSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNV  139
            PSI IP L R +TLTRTVTNVGP +S YK +VE P GI + V P TL F+ N+ K +FNV
Sbjct  630  PSIIIPSLTREVTLTRTVTNVGPADSVYKPLVESPLGIELDVNPKTLVFASNITKSTFNV  689

Query  138  TISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             + T H  N+ +YFGSL W DGVHNV IP++V+TK
Sbjct  690  RVKTSHRVNSDYYFGSLCWTDGVHNVTIPVAVRTK  724



>ref|XP_007039327.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY23828.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=869

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 162/244 (66%), Gaps = 4/244 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAAYIP     + S Y F+SGTSM+ PHVAGI AL+K+ H +WSPA I+SA+VTTA  
Sbjct  625  DILAAYIPVGKE-KSSGYKFMSGTSMSCPHVAGIAALIKSVHKNWSPAAIRSALVTTASQ  683

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T R+ G  I  EG T  K AD FD GGG++NPN+A  PGL+YD    DYV  LC  GYSS
Sbjct  684  T-RTDGSNIAEEGST-RKAADPFDIGGGLVNPNKAVNPGLIYDAGIEDYVQFLCGTGYSS  741

Query  390  KAISIIAGQTTSCHKG-FSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
            KA++ +     +C K   ++L++N PSITIP+LKR +T+TR VTNVGP +S YK +++ P
Sbjct  742  KAVTGLTQTQVNCTKSRLNVLNLNLPSITIPNLKRKVTVTRAVTNVGPVDSVYKAIMQAP  801

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
            +GI + V+P  L+F+   + + F VT  +    +  + FGSL W DG H VR PISV+  
Sbjct  802  QGIKLKVEPQILSFNKTTQILPFKVTFFSTRKVSGDYRFGSLSWTDGKHIVRSPISVRAI  861

Query  33   Y*ES  22
              ES
Sbjct  862  LFES  865



>gb|AJP61138.1| At4g21323p-like protein, partial [Arabidopsis halleri]
Length=774

 Score =   229 bits (583),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/243 (52%), Positives = 161/243 (66%), Gaps = 9/243 (4%)
 Frame = -2

Query  747  ILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTT  568
            +L   IP+D       Y   SGTSMATP +AGIVALLK +HP+WSPA IKSA+VTTA  T
Sbjct  531  LLTPRIPTDEDTSEFAY---SGTSMATPVIAGIVALLKISHPNWSPAAIKSALVTTAMKT  587

Query  567  DRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YSS  391
            D        + G    K+ADAFDYGGG++N  +A  PGLVYDM   DY++ LC+   Y+ 
Sbjct  588  DPYDERLTVDGGNY--KVADAFDYGGGLVNLEKATDPGLVYDMDINDYIHYLCSQALYTD  645

Query  390  KAISIIAGQTTS-C-HKGFSILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            K +S + G  TS C   G SILD+N PSITIPDLKR +T+TR+VTNVG   S YK ++E 
Sbjct  646  KKVSALTGNVTSKCPSSGSSILDLNVPSITIPDLKRNVTVTRSVTNVGAVKSVYKPVIET  705

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTIS-TCHGFNTGFYFGSLIWNDGVHNVRIPISVK  40
            P G  VVV P  L F+    K++F V +S   H  N+ F+FGSL W+DG+HNV IPIS++
Sbjct  706  PLGFKVVVSPKKLKFNKRRNKVAFKVRVSPGSHRVNSAFFFGSLTWSDGLHNVTIPISLR  765

Query  39   TKY  31
            T++
Sbjct  766  TRF  768



>emb|CDX94032.1| BnaC07g36660D [Brassica napus]
Length=784

 Score =   228 bits (582),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 166/245 (68%), Gaps = 10/245 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            N+L   IP+D       Y   SGTSMATP +AGIVALLK +HP WSPA IKSAIVTTA +
Sbjct  539  NLLTPRIPTDEDTSEFAY---SGTSMATPVIAGIVALLKISHPTWSPAAIKSAIVTTARS  595

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YS  394
            TD   GEP+  EG T  K+ADAFDYGGG+++  +A  PGLVYDM   DYV+ LC+   Y+
Sbjct  596  TD-PYGEPLTAEG-TTPKIADAFDYGGGLVDMEKATNPGLVYDMDMNDYVHYLCSAALYT  653

Query  393  SKAISIIAGQ-TTSC-HKGFSILDVNFPSITIPDLKRPI-TLTRTVTNVGPENSTYKVMV  223
             K +S + G  TT C     SILD+N PSITIPDLK  +  +TRTVTNVGP +S YK ++
Sbjct  654  DKRVSALTGNVTTKCPSSSSSILDINVPSITIPDLKGNVKVITRTVTNVGPVDSVYKPVI  713

Query  222  EPPKGIIVVVKPSTLNFSPNVKKISFNVTIST-CHGFNTGFYFGSLIWNDGVHNVRIPIS  46
            + P G  V V P  L F+    K +F V++S+  +  NTGF+FGSL W+DG+HNV IP+S
Sbjct  714  KAPLGFDVKVSPEELVFNKGTSKAAFTVSVSSGSYKVNTGFFFGSLTWSDGLHNVTIPVS  773

Query  45   VKTKY  31
            V+T +
Sbjct  774  VRTSF  778



>ref|XP_008236858.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=771

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 120/240 (50%), Positives = 163/240 (68%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPS-DPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAW  574
            NILA++ P+  P+    T+   SGTSM+ PH++GIVALLKA HP WSPA IKSA+VTTA 
Sbjct  525  NILASWSPARSPSKSPDTFKIESGTSMSCPHISGIVALLKAIHPTWSPAAIKSALVTTAS  584

Query  573  TTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYS  394
              D  + + I  EG    K AD FDYGGG ++PN+A  PGL+YD+ ++DY+  LC+MGY+
Sbjct  585  LGDEYA-QSIVAEGAP-HKQADPFDYGGGHVDPNKAISPGLIYDIESSDYIRFLCSMGYN  642

Query  393  SKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEP  217
            + AIS++AG   +C K    I+++N PSITI +LK+ +T++R VTNVGP NS Y   V+ 
Sbjct  643  NTAISLMAGTKITCQKSTKFIVNLNLPSITIHELKQNMTVSRRVTNVGPVNSVYFARVQA  702

Query  216  PKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            P G+ V VKPS L+F+  VKK+ F V   +       F FG+L W DG+H VRIP+ V+T
Sbjct  703  PAGVSVKVKPSVLSFNSTVKKLEFKVIFCSLLRVQGRFSFGNLFWEDGLHVVRIPLVVRT  762



>ref|XP_011038012.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 163/240 (68%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAAY P++     ++Y F+SGTSMA PHV+GIVAL+K+ HP+WSPA I+SA+VTTA  
Sbjct  537  DILAAYTPANKD-HGNSYEFLSGTSMACPHVSGIVALIKSLHPNWSPAAIRSALVTTASQ  595

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T  + G  IF EG T  K AD FD GGG +NP +A  PGLVYD +T +Y+  LC++GYSS
Sbjct  596  TG-TDGMKIFEEGST-RKEADPFDMGGGHVNPEKAAYPGLVYDTTTEEYIQYLCSIGYSS  653

Query  390  KAISIIAGQTTSCHKGFSI-LDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +     +C K  +  L++N PSITIP+LK  +T+TR VTNVG  NS YK +V+ P
Sbjct  654  SSITRLTNTKINCMKNTNTRLNLNLPSITIPNLKTKVTVTRKVTNVGNVNSVYKAIVQAP  713

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + V+P TL+F+   K +SF VT  +       + FGSLIW DG H VR PISV+ K
Sbjct  714  IGISLAVEPQTLSFNRINKILSFRVTFLSSQKVQGEYRFGSLIWTDGEHFVRSPISVRAK  773



>emb|CDX94033.1| BnaC07g36670D [Brassica napus]
Length=799

 Score =   228 bits (581),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/215 (52%), Positives = 150/215 (70%), Gaps = 4/215 (2%)
 Frame = -2

Query  687  SGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLAD  508
             GTS + P VAGIV LLK+ HPDWSPA +KSAI+TTAW TD   G+PI++E     KLAD
Sbjct  519  QGTSFSAPAVAGIVLLLKSLHPDWSPAALKSAIMTTAWKTD-PFGDPIYSE-SMPRKLAD  576

Query  507  AFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGFS-IL  331
             FDYGGG++NP RAR PGLVYD++  DY++  CA GY+  +I+++ G+   C      IL
Sbjct  577  PFDYGGGLVNPQRARDPGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPYIL  636

Query  330  DVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKI  151
            D N+P+ITIP+LK  +T++RTVTNVGP +S Y+ ++EPP+G+ + V+P TL F+ + K +
Sbjct  637  DFNYPAITIPELKDEVTVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNSSSKIL  696

Query  150  SFNVTISTCHGFNTGFY-FGSLIWNDGVHNVRIPI  49
             F V ++T H  N   Y FGS  W DG  NV IP+
Sbjct  697  GFKVRVTTSHKSNMPVYLFGSFTWTDGTRNVTIPL  731



>ref|XP_011012404.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=789

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 123/240 (51%), Positives = 163/240 (68%), Gaps = 4/240 (2%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            +ILAAY P++     ++Y F+SGTSMA PHV+GIVAL+K+ HP+WSPA I+SA+VTTA  
Sbjct  548  DILAAYTPANKD-HGNSYEFLSGTSMACPHVSGIVALIKSLHPNWSPAAIRSALVTTASQ  606

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
            T  + G  IF EG T  K AD FD GGG +NP +A  PGLVYD +T +Y+  LC++GYSS
Sbjct  607  TG-TDGMKIFEEGST-RKEADPFDMGGGHVNPEKAAYPGLVYDTTTEEYIQYLCSIGYSS  664

Query  390  KAISIIAGQTTSCHKGFSI-LDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPP  214
             +I+ +     +C K  +  L++N PSITIP+LK  +T+TR VTNVG  NS YK +V+ P
Sbjct  665  SSITRLTNTKINCMKNTNTRLNLNLPSITIPNLKTKVTVTRKVTNVGNVNSVYKAIVQAP  724

Query  213  KGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKTK  34
             GI + V+P TL+F+   K +SF VT  +       + FGSLIW DG H VR PISV+ K
Sbjct  725  IGISLAVEPQTLSFNRINKILSFRVTFLSSQKVQGEYRFGSLIWTDGEHFVRSPISVRAK  784



>emb|CDY58475.1| BnaA03g58460D [Brassica napus]
Length=782

 Score =   228 bits (580),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 165/245 (67%), Gaps = 10/245 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            N+L   IP+D       Y   SGTSMATP +AGIVALLK +HP WSPA IKSAIVTTA +
Sbjct  537  NLLTPRIPTDEDTSEFAY---SGTSMATPVIAGIVALLKVSHPTWSPAAIKSAIVTTARS  593

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YS  394
            TD   GEP+  EG T  K+ADAFDYGGG+++  +A  PGLVYDM   DYV+ LC+   YS
Sbjct  594  TD-PYGEPLTAEG-TTPKIADAFDYGGGLVDMEKATDPGLVYDMDMNDYVHYLCSAALYS  651

Query  393  SKAISIIAGQ-TTSC-HKGFSILDVNFPSITIPDLKRPI-TLTRTVTNVGPENSTYKVMV  223
             K +S + G  TT C     SILD+N PSITIPDLK  +  +TRTVTNVGP +S YK ++
Sbjct  652  DKRVSALTGNVTTKCPSSSSSILDINVPSITIPDLKGNVKVITRTVTNVGPVDSVYKPVI  711

Query  222  EPPKGIIVVVKPSTLNFSPNVKKISFNVTIST-CHGFNTGFYFGSLIWNDGVHNVRIPIS  46
            + P G  V V P  L F+    K +F V++S+  +  NTGF+FGSL W+DG+HNV IP+S
Sbjct  712  KAPLGFDVKVSPEELVFNKGTSKAAFTVSVSSGSYKANTGFFFGSLTWSDGLHNVTIPVS  771

Query  45   VKTKY  31
            V+  +
Sbjct  772  VRANF  776



>ref|XP_006357625.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=535

 Score =   223 bits (568),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 119/249 (48%), Positives = 160/249 (64%), Gaps = 16/249 (6%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            NILAA  P+      + +  +SGTSMA PH++GI+ L K AHP+WSPA IKSA+VTTAW 
Sbjct  290  NILAAIPPNKGGD--NGFQLMSGTSMAAPHISGIIGLHKVAHPNWSPAAIKSALVTTAWN  347

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSS  391
             D + G  IF+EG    K+AD FD+GGGI NPN A  PGL+YDM   DY+N LC++GYS+
Sbjct  348  ED-TYGSEIFSEGAG-DKIADPFDFGGGICNPNGAMDPGLIYDMDNNDYLNYLCSLGYSN  405

Query  390  KAIS-----IIAGQTTSCHKGF-------SILDVNFPSITIPDLKRPITLTRTVTNVGPE  247
            + +          + ++  +G        S LD+N PSI+I +L+  +T+ RTVTNVG  
Sbjct  406  EKVRNATTYFFDTKNSTTKRGIICPSKVPSRLDLNLPSISISNLENSVTIRRTVTNVGNV  465

Query  246  NSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVH  67
            NS YK++V+PP+   + V P  L F+   KKISF V I + H   + F FGSL W+DG H
Sbjct  466  NSIYKLVVKPPRNSAIKVSPHVLKFNSKTKKISFEVKIISTHQRKSKFNFGSLAWSDGKH  525

Query  66   NVRIPISVK  40
             VRIPI+V+
Sbjct  526  YVRIPIAVR  534



>ref|XP_009137185.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=781

 Score =   227 bits (578),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 131/245 (53%), Positives = 165/245 (67%), Gaps = 10/245 (4%)
 Frame = -2

Query  750  NILAAYIPSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWT  571
            N+L   IP+D       Y   SGTSMATP +AGIVALLK +HP WSPA IKSAIVTTA +
Sbjct  536  NLLTPRIPTDEDTSEFAY---SGTSMATPVIAGIVALLKNSHPTWSPAAIKSAIVTTARS  592

Query  570  TDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMG-YS  394
            TD   GEP+  EG T  K+ADAFDYGGG+++  +A  PGLVYDM   DYV+ LC+   YS
Sbjct  593  TD-PYGEPLTAEG-TTPKIADAFDYGGGLVDMEKATDPGLVYDMDMNDYVHYLCSAALYS  650

Query  393  SKAISIIAGQ-TTSC-HKGFSILDVNFPSITIPDLKRPI-TLTRTVTNVGPENSTYKVMV  223
             K +S + G  TT C     SILD+N PSITIPDLK  +  +TRTVTNVGP +S YK ++
Sbjct  651  DKRVSALTGNVTTKCPSSSSSILDINVPSITIPDLKGNVKVITRTVTNVGPVDSVYKPVI  710

Query  222  EPPKGIIVVVKPSTLNFSPNVKKISFNVTIST-CHGFNTGFYFGSLIWNDGVHNVRIPIS  46
            + P G  V V P  L F+    K +F V++S+  +  NTGF+FGSL W+DG+HNV IP+S
Sbjct  711  KAPLGFDVKVSPEELVFNKGTSKAAFTVSVSSGSYKANTGFFFGSLTWSDGLHNVTIPVS  770

Query  45   VKTKY  31
            V+  +
Sbjct  771  VRANF  775



>ref|XP_010109770.1| hypothetical protein L484_008446 [Morus notabilis]
 gb|EXC24675.1| hypothetical protein L484_008446 [Morus notabilis]
Length=745

 Score =   226 bits (577),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 120/233 (52%), Positives = 152/233 (65%), Gaps = 4/233 (2%)
 Frame = -2

Query  729  PSDPAVRISTYNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGE  550
            PSD       + F SGTSMA PH+ GIVALLK+ HP+WSPA IKSA+VTTA   D   G+
Sbjct  506  PSDNRQLSIQFKFESGTSMACPHITGIVALLKSIHPNWSPAAIKSALVTTASLEDEY-GQ  564

Query  549  PIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIA  370
             I  EG    K  D FDYGGG ++PN+A  PGL+YD+ T+DY+  LC+MGY++ AIS +A
Sbjct  565  SIVAEGAPY-KQGDPFDYGGGHVDPNKAISPGLIYDLGTSDYIRFLCSMGYNNTAISYLA  623

Query  369  GQTTSCHKGFS--ILDVNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVV  196
              +  C    +  +LD+N PSITIP+L R +T+TRTVTNVGP NS Y   VE P G+   
Sbjct  624  NSSIKCSTKSTEFLLDLNLPSITIPELMRSLTVTRTVTNVGPVNSVYIARVEAPAGVTAS  683

Query  195  VKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVRIPISVKT  37
            VKPS L F+  VKK+ F V+          + FG+L W DGVH VRIP+ V+T
Sbjct  684  VKPSVLVFNSTVKKLKFKVSFCARIRTQGRYSFGNLFWGDGVHVVRIPLVVRT  736



>emb|CDY70485.1| BnaA03g58450D, partial [Brassica napus]
Length=734

 Score =   226 bits (576),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 153/219 (70%), Gaps = 4/219 (2%)
 Frame = -2

Query  684  GTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLADA  505
            GTS + P +AGI+ LLK+ HPDWSPA +KSAI+TTAW TD   G PI++E     KLAD 
Sbjct  517  GTSYSAPAIAGILILLKSLHPDWSPAALKSAIMTTAWKTDPYGG-PIYSE-SMPRKLADP  574

Query  504  FDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILD  328
            FDYG G++NP RA  PGLVYD++  DY++  CA GY+  +I+++ G+   C     SILD
Sbjct  575  FDYGAGLVNPQRAGDPGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPSILD  634

Query  327  VNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKIS  148
             N+P+ITIP++K  +T++RTVTNVGP +S Y+ ++EPP+G+ + V+P TL F+ + K + 
Sbjct  635  FNYPAITIPEVKDEVTVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNASTKILG  694

Query  147  FNVTISTCHGFNTGFY-FGSLIWNDGVHNVRIPISVKTK  34
            F V ++T H  N   Y FGS  W DG  NV IP+SV+T+
Sbjct  695  FKVRVTTSHKNNMPVYLFGSFTWTDGTRNVTIPLSVRTR  733



>ref|XP_007042043.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOX97874.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=637

 Score =   224 bits (572),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 125/247 (51%), Positives = 162/247 (66%), Gaps = 12/247 (5%)
 Frame = -2

Query  750  NILAAYIPSD-------PAVRISTYNFI--SGTSMATPHVAGIVALLKAAHPDWSPAVIK  598
            +ILA++ P+        P  + S +NF   SGTSMA PH++GIVALLK  HP WSPA IK
Sbjct  382  DILASWSPASSSKPLDSPQNKASPFNFKLDSGTSMACPHISGIVALLKGIHPTWSPAAIK  441

Query  597  SAIVTTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVN  418
            SA+VTTA  TD   G+    EG    K AD FDYGGG ++PN+A  PGL+YDM  +DYV 
Sbjct  442  SALVTTASVTDEY-GQNTVAEGAP-HKQADPFDYGGGHVDPNKALSPGLIYDMEISDYVC  499

Query  417  CLCAMGYSSKAISIIAGQTTSCHKGFS-ILDVNFPSITIPDLKRPITLTRTVTNVGPENS  241
             L AMGY+S AIS++    T C K    +L++N PSITIP+LK+ +T++RTVTNVGP NS
Sbjct  500  FLYAMGYNSTAISLMTRVRTPCRKSAKFLLNLNLPSITIPELKQRLTVSRTVTNVGPINS  559

Query  240  TYKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNV  61
             Y   V+ P G  V VKPS L+F+   KK+ F VTI +       + FG+L W DG+H V
Sbjct  560  VYFARVQAPAGTHVSVKPSNLSFNSTTKKLKFKVTICSQLKVQGRYSFGNLYWEDGIHVV  619

Query  60   RIPISVK  40
            RIP++V+
Sbjct  620  RIPLTVR  626



>ref|XP_009137186.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=746

 Score =   226 bits (576),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/219 (50%), Positives = 153/219 (70%), Gaps = 4/219 (2%)
 Frame = -2

Query  684  GTSMATPHVAGIVALLKAAHPDWSPAVIKSAIVTTAWTTDRSSGEPIFNEGETISKLADA  505
            GTS + P +AGI+ LLK+ HPDWSPA +KSAI+TTAW TD   G PI++E     KLAD 
Sbjct  529  GTSYSAPAIAGILILLKSLHPDWSPAALKSAIMTTAWKTDPYGG-PIYSE-SMPRKLADP  586

Query  504  FDYGGGIINPNRARKPGLVYDMSTTDYVNCLCAMGYSSKAISIIAGQTTSCHKGF-SILD  328
            FDYG G++NP RA  PGLVYD++  DY++  CA GY+  +I+++ G+   C     SILD
Sbjct  587  FDYGAGLVNPQRAGDPGLVYDLNLDDYIHFFCASGYNDTSIALLTGKDAKCPSPLPSILD  646

Query  327  VNFPSITIPDLKRPITLTRTVTNVGPENSTYKVMVEPPKGIIVVVKPSTLNFSPNVKKIS  148
             N+P+ITIP++K  +T++RTVTNVGP +S Y+ ++EPP+G+ + V+P TL F+ + K + 
Sbjct  647  FNYPAITIPEVKDEVTVSRTVTNVGPVDSVYRAVIEPPRGVKIAVEPETLVFNASTKILG  706

Query  147  FNVTISTCHGFNTGFY-FGSLIWNDGVHNVRIPISVKTK  34
            F V ++T H  N   Y FGS  W DG  NV IP+SV+T+
Sbjct  707  FKVRVTTSHKNNMPVYLFGSFTWTDGTRNVTIPLSVRTR  745



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 161/247 (65%), Gaps = 11/247 (4%)
 Frame = -2

Query  750  NILAAYIPSD---PAVRIST-----YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKS  595
            NILA++ P+    P V         +   SGTSM+ PHV+GIVALLK+ HP+WSPA IKS
Sbjct  524  NILASWSPASSLSPGVHRHKQPSLKFKIESGTSMSCPHVSGIVALLKSMHPNWSPAAIKS  583

Query  594  AIVTTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNC  415
            A+VTTA T D+  G+    EG    K AD FDYGGG ++PN+A  PGL+YDM  TD+V  
Sbjct  584  ALVTTASTKDKY-GQSAVAEGSP-HKQADPFDYGGGHVDPNKAADPGLIYDMGITDHVRF  641

Query  414  LCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPITLTRTVTNVGPENST  238
            LC MGY+  ++S++    T C K   S+ D+N PSI+IP+LK+ + ++RTVTNVGP NS 
Sbjct  642  LCLMGYNDSSVSLMTRHPTVCSKTSKSLADLNLPSISIPELKKSLAVSRTVTNVGPVNSV  701

Query  237  YKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVR  58
            Y V V+ P G+IV V PS L+F+   K++ F VT  +       + FGSL W DG+H VR
Sbjct  702  YSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQLSVQGRYSFGSLSWEDGIHVVR  761

Query  57   IPISVKT  37
            IP+ V+T
Sbjct  762  IPLIVRT  768



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   226 bits (577),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/247 (49%), Positives = 161/247 (65%), Gaps = 11/247 (4%)
 Frame = -2

Query  750  NILAAYIPSD---PAVRIST-----YNFISGTSMATPHVAGIVALLKAAHPDWSPAVIKS  595
            NILA++ P+    P V         +   SGTSM+ PHV+GIVALLK+ HP+WSPA IKS
Sbjct  521  NILASWSPASSLSPGVHRHKQPSLKFKIESGTSMSCPHVSGIVALLKSMHPNWSPAAIKS  580

Query  594  AIVTTAWTTDRSSGEPIFNEGETISKLADAFDYGGGIINPNRARKPGLVYDMSTTDYVNC  415
            A+VTTA T D+  G+    EG    K AD FDYGGG ++PN+A  PGL+YDM  TD+V  
Sbjct  581  ALVTTASTKDKY-GQSAVAEGSP-HKQADPFDYGGGHVDPNKAADPGLIYDMGITDHVRF  638

Query  414  LCAMGYSSKAISIIAGQTTSCHK-GFSILDVNFPSITIPDLKRPITLTRTVTNVGPENST  238
            LC MGY+  ++S++    T C K   S+ D+N PSI+IP+LK+ + ++RTVTNVGP NS 
Sbjct  639  LCLMGYNDSSVSLMTRHPTVCSKTSKSLADLNLPSISIPELKKSLAVSRTVTNVGPVNSV  698

Query  237  YKVMVEPPKGIIVVVKPSTLNFSPNVKKISFNVTISTCHGFNTGFYFGSLIWNDGVHNVR  58
            Y V V+ P G+IV V PS L+F+   K++ F VT  +       + FGSL W DG+H VR
Sbjct  699  YSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQLSVQGRYSFGSLSWEDGIHVVR  758

Query  57   IPISVKT  37
            IP+ V+T
Sbjct  759  IPLIVRT  765



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1401010927050