BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037H20

Length=742
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009798984.1|  PREDICTED: probable protein S-acyltransferas...    111   8e-27   Nicotiana sylvestris
ref|XP_006347869.1|  PREDICTED: probable protein S-acyltransferas...    111   2e-25   Solanum tuberosum [potatoes]
ref|XP_009610572.1|  PREDICTED: probable protein S-acyltransferas...    110   5e-25   Nicotiana tomentosiformis
ref|XP_004248564.1|  PREDICTED: probable protein S-acyltransferas...    110   6e-25   Solanum lycopersicum
ref|XP_006364242.1|  PREDICTED: probable protein S-acyltransferas...    110   7e-25   Solanum tuberosum [potatoes]
ref|XP_010325709.1|  PREDICTED: probable protein S-acyltransferas...    110   9e-25   Solanum lycopersicum
ref|XP_009791941.1|  PREDICTED: probable protein S-acyltransferas...    109   1e-24   Nicotiana sylvestris
gb|EYU31985.1|  hypothetical protein MIMGU_mgv1a010704mg                109   2e-24   Erythranthe guttata [common monkey flower]
emb|CDO97688.1|  unnamed protein product                                108   3e-24   Coffea canephora [robusta coffee]
ref|XP_009616135.1|  PREDICTED: probable protein S-acyltransferas...    108   3e-24   Nicotiana tomentosiformis
ref|XP_011090630.1|  PREDICTED: probable protein S-acyltransferas...    106   2e-23   Sesamum indicum [beniseed]
ref|XP_008438165.1|  PREDICTED: probable protein S-acyltransferas...    106   2e-23   Cucumis melo [Oriental melon]
ref|XP_002511714.1|  zinc finger protein, putative                      106   2e-23   Ricinus communis
ref|XP_004133913.1|  PREDICTED: probable S-acyltransferase At3g60...    106   2e-23   Cucumis sativus [cucumbers]
ref|XP_008393352.1|  PREDICTED: probable protein S-acyltransferas...    106   3e-23   
gb|KJB09889.1|  hypothetical protein B456_001G174100                    105   3e-23   Gossypium raimondii
gb|KHG00286.1|  hypothetical protein F383_19583                         105   3e-23   Gossypium arboreum [tree cotton]
gb|KJB09890.1|  hypothetical protein B456_001G174100                    105   3e-23   Gossypium raimondii
ref|XP_010692246.1|  PREDICTED: probable protein S-acyltransferas...    105   3e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007218730.1|  hypothetical protein PRUPE_ppa009076mg             105   3e-23   Prunus persica
ref|XP_006445267.1|  hypothetical protein CICLE_v10021302mg             105   4e-23   Citrus clementina [clementine]
emb|CDX71777.1|  BnaC08g30970D                                          105   4e-23   
emb|CDY52347.1|  BnaA09g38960D                                          105   4e-23   Brassica napus [oilseed rape]
ref|XP_009116762.1|  PREDICTED: probable protein S-acyltransferas...    105   5e-23   Brassica rapa
ref|XP_010098912.1|  putative S-acyltransferase                         105   5e-23   Morus notabilis
gb|ACU19432.1|  unknown                                                 105   5e-23   Glycine max [soybeans]
ref|XP_006587892.1|  PREDICTED: probable protein S-acyltransferas...    105   6e-23   Glycine max [soybeans]
gb|KDP28757.1|  hypothetical protein JCGZ_14528                         105   6e-23   Jatropha curcas
ref|XP_010255627.1|  PREDICTED: probable protein S-acyltransferas...    104   8e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010918308.1|  PREDICTED: probable protein S-acyltransferas...    104   8e-23   Elaeis guineensis
ref|XP_011469138.1|  PREDICTED: probable protein S-acyltransferas...    104   8e-23   Fragaria vesca subsp. vesca
ref|XP_009338113.1|  PREDICTED: probable protein S-acyltransferas...    104   9e-23   Pyrus x bretschneideri [bai li]
ref|XP_010056317.1|  PREDICTED: probable protein S-acyltransferas...    104   1e-22   Eucalyptus grandis [rose gum]
ref|XP_011034295.1|  PREDICTED: probable protein S-acyltransferas...    104   1e-22   Populus euphratica
ref|XP_007052066.1|  DHHC-type zinc finger family protein isoform 1     104   1e-22   
gb|AES87286.2|  DHHC-type zinc finger protein                           103   1e-22   Medicago truncatula
ref|XP_003605089.1|  Palmitoyltransferase pfa3                          103   1e-22   
gb|ABK24332.1|  unknown                                                 103   1e-22   Picea sitchensis
gb|EMS35725.1|  hypothetical protein TRIUR3_29953                     98.6    1e-22   Triticum urartu
ref|XP_010276626.1|  PREDICTED: probable protein S-acyltransferas...    103   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_003579517.1|  PREDICTED: probable protein S-acyltransferas...    103   1e-22   Brachypodium distachyon [annual false brome]
gb|KHN40573.1|  Putative S-acyltransferase                              104   2e-22   Glycine soja [wild soybean]
emb|CBI38870.3|  unnamed protein product                                103   2e-22   Vitis vinifera
ref|XP_002279896.1|  PREDICTED: probable protein S-acyltransferas...    103   2e-22   Vitis vinifera
ref|XP_011017489.1|  PREDICTED: probable protein S-acyltransferas...    103   2e-22   Populus euphratica
gb|AFW57919.1|  palmitoyltransferase ZDHHC20, mRNA                      102   2e-22   
ref|XP_003552340.1|  PREDICTED: probable protein S-acyltransferas...    103   3e-22   Glycine max [soybeans]
ref|XP_004975099.1|  PREDICTED: probable S-acyltransferase At3g60...    103   3e-22   Setaria italica
ref|XP_006602748.1|  PREDICTED: probable protein S-acyltransferas...    103   3e-22   Glycine max [soybeans]
ref|XP_009398464.1|  PREDICTED: probable protein S-acyltransferas...    102   4e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010910428.1|  PREDICTED: probable protein S-acyltransferas...  99.0    5e-22   
gb|KFK35280.1|  hypothetical protein AALP_AA5G264300                    102   5e-22   Arabis alpina [alpine rockcress]
ref|XP_008232660.1|  PREDICTED: probable protein S-acyltransferas...    104   5e-22   Prunus mume [ume]
ref|XP_006402542.1|  hypothetical protein EUTSA_v10006120mg             102   5e-22   Eutrema salsugineum [saltwater cress]
ref|XP_009389071.1|  PREDICTED: probable protein S-acyltransferas...    102   6e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002446206.1|  hypothetical protein SORBIDRAFT_06g004040          102   6e-22   Sorghum bicolor [broomcorn]
gb|KHN29455.1|  Putative S-acyltransferase                              102   6e-22   Glycine soja [wild soybean]
ref|NP_001148846.1|  palmitoyltransferase ZDHHC20                       102   6e-22   Zea mays [maize]
ref|XP_010413515.1|  PREDICTED: probable protein S-acyltransferas...  99.0    7e-22   Camelina sativa [gold-of-pleasure]
gb|KJB49336.1|  hypothetical protein B456_008G114100                    101   7e-22   Gossypium raimondii
ref|XP_003517050.1|  PREDICTED: probable protein S-acyltransferas...    102   7e-22   Glycine max [soybeans]
ref|XP_007134881.1|  hypothetical protein PHAVU_010G083900g             102   7e-22   Phaseolus vulgaris [French bean]
gb|AHA84213.1|  palmitoyltransferase                                    102   8e-22   Phaseolus vulgaris [French bean]
ref|XP_003521795.1|  PREDICTED: probable protein S-acyltransferas...    101   8e-22   Glycine max [soybeans]
gb|KJB41110.1|  hypothetical protein B456_007G090900                    101   8e-22   Gossypium raimondii
gb|KHG30156.1|  hypothetical protein F383_14468                         101   9e-22   Gossypium arboreum [tree cotton]
gb|KJB49335.1|  hypothetical protein B456_008G114100                    101   1e-21   Gossypium raimondii
emb|CDX71345.1|  BnaC07g06240D                                          101   1e-21   
emb|CDX89079.1|  BnaA04g01070D                                          101   1e-21   
ref|XP_010524364.1|  PREDICTED: probable protein S-acyltransferas...    100   2e-21   Tarenaya hassleriana [spider flower]
ref|XP_008343300.1|  PREDICTED: probable protein S-acyltransferas...    100   2e-21   Malus domestica [apple tree]
ref|XP_008798535.1|  PREDICTED: probable protein S-acyltransferas...    100   2e-21   Phoenix dactylifera
emb|CDY51805.1|  BnaC04g53110D                                          100   3e-21   Brassica napus [oilseed rape]
ref|XP_009143135.1|  PREDICTED: probable protein S-acyltransferas...    100   3e-21   
emb|CDX74736.1|  BnaA05g04820D                                          100   3e-21   
ref|XP_006291552.1|  hypothetical protein CARUB_v10017708mg             100   3e-21   Capsella rubella
ref|XP_006652138.1|  PREDICTED: probable protein S-acyltransferas...    100   3e-21   Oryza brachyantha
ref|XP_009143136.1|  PREDICTED: probable protein S-acyltransferas...    100   3e-21   Brassica rapa
gb|EMT07089.1|  Putative S-acyltransferase                              100   3e-21   
ref|XP_008776787.1|  PREDICTED: probable protein S-acyltransferas...    100   3e-21   Phoenix dactylifera
ref|XP_002882009.1|  hypothetical protein ARALYDRAFT_903981             100   3e-21   Arabidopsis lyrata subsp. lyrata
dbj|BAJ93966.1|  predicted protein                                      100   3e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004492612.1|  PREDICTED: probable S-acyltransferase At3g60...    100   4e-21   Cicer arietinum [garbanzo]
ref|XP_006851861.1|  hypothetical protein AMTR_s00041p00097340        99.4    6e-21   
ref|NP_191639.2|  DHHC-type zinc finger family protein                99.0    8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001051618.1|  Os03g0804300                                     99.0    8e-21   
emb|CAB82684.1|  putative protein                                     98.6    8e-21   Arabidopsis thaliana [mouse-ear cress]
gb|EEC76365.1|  hypothetical protein OsI_13959                        99.0    9e-21   Oryza sativa Indica Group [Indian rice]
ref|XP_010469144.1|  PREDICTED: probable protein S-acyltransferas...  99.0    9e-21   Camelina sativa [gold-of-pleasure]
ref|XP_006397719.1|  hypothetical protein EUTSA_v10001560mg           99.0    9e-21   Eutrema salsugineum [saltwater cress]
ref|XP_010413516.1|  PREDICTED: probable protein S-acyltransferas...  98.6    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010910146.1|  PREDICTED: probable protein S-acyltransferas...  98.6    1e-20   Elaeis guineensis
ref|XP_002302535.2|  zinc finger family protein                       98.6    1e-20   
gb|KHG01247.1|  hypothetical protein F383_23406                       97.4    1e-20   Gossypium arboreum [tree cotton]
ref|XP_002878349.1|  zinc finger family protein                       98.2    1e-20   Arabidopsis lyrata subsp. lyrata
gb|KJB37584.1|  hypothetical protein B456_006G211800                  97.8    2e-20   Gossypium raimondii
ref|XP_010508175.1|  PREDICTED: probable protein S-acyltransferas...  97.8    2e-20   
ref|XP_009399491.1|  PREDICTED: probable protein S-acyltransferas...  97.8    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010506482.1|  PREDICTED: probable protein S-acyltransferas...  97.4    3e-20   Camelina sativa [gold-of-pleasure]
gb|KFK37316.1|  hypothetical protein AALP_AA4G241200                  97.1    4e-20   Arabis alpina [alpine rockcress]
gb|KHG16541.1|  hypothetical protein F383_02611                       96.7    4e-20   Gossypium arboreum [tree cotton]
gb|EPS68199.1|  hypothetical protein M569_06570                       96.7    5e-20   Genlisea aurea
ref|XP_009138811.1|  PREDICTED: probable protein S-acyltransferas...  96.7    5e-20   Brassica rapa
ref|XP_010544651.1|  PREDICTED: probable protein S-acyltransferas...  96.7    6e-20   Tarenaya hassleriana [spider flower]
ref|XP_002535239.1|  zinc finger protein, putative                    95.9    7e-20   
ref|XP_010518152.1|  PREDICTED: probable protein S-acyltransferas...  95.9    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010647607.1|  PREDICTED: probable protein S-acyltransferas...  92.4    1e-19   
ref|XP_010108133.1|  putative S-acyltransferase                       95.5    1e-19   Morus notabilis
gb|KJB37583.1|  hypothetical protein B456_006G211800                  97.1    2e-19   Gossypium raimondii
gb|KCW78273.1|  hypothetical protein EUGRSUZ_D02456                   93.6    3e-19   Eucalyptus grandis [rose gum]
ref|XP_010053896.1|  PREDICTED: probable protein S-acyltransferas...  93.6    5e-19   Eucalyptus grandis [rose gum]
ref|XP_007209402.1|  hypothetical protein PRUPE_ppa009226mg           93.6    6e-19   Prunus persica
ref|XP_008238650.1|  PREDICTED: probable protein S-acyltransferas...  93.2    8e-19   Prunus mume [ume]
ref|XP_011033891.1|  PREDICTED: probable protein S-acyltransferas...  93.2    9e-19   Populus euphratica
ref|XP_004952412.1|  PREDICTED: probable S-acyltransferase At3g60...  92.8    1e-18   Setaria italica
ref|XP_008345376.1|  PREDICTED: probable protein S-acyltransferas...  92.8    1e-18   
ref|NP_001169109.1|  palmitoyltransferase ZDHHC20                     92.8    1e-18   Zea mays [maize]
ref|XP_009362134.1|  PREDICTED: probable protein S-acyltransferas...  92.8    1e-18   Pyrus x bretschneideri [bai li]
ref|XP_007039984.1|  DHHC-type zinc finger family protein             92.4    1e-18   
ref|XP_002994078.1|  hypothetical protein SELMODRAFT_449300           92.4    1e-18   Selaginella moellendorffii
ref|XP_002989117.1|  hypothetical protein SELMODRAFT_184354           92.0    2e-18   
ref|XP_010662159.1|  PREDICTED: probable protein S-acyltransferas...  92.0    2e-18   Vitis vinifera
ref|XP_008437153.1|  PREDICTED: probable protein S-acyltransferas...  92.0    2e-18   Cucumis melo [Oriental melon]
gb|KDP42560.1|  hypothetical protein JCGZ_24334                       91.7    3e-18   Jatropha curcas
ref|XP_002304438.2|  hypothetical protein POPTR_0003s11520g           91.3    3e-18   Populus trichocarpa [western balsam poplar]
ref|XP_011463771.1|  PREDICTED: probable protein S-acyltransferas...  91.3    4e-18   Fragaria vesca subsp. vesca
ref|XP_004147573.1|  PREDICTED: probable S-acyltransferase At3g60...  90.9    5e-18   Cucumis sativus [cucumbers]
gb|KGN50197.1|  hypothetical protein Csa_5G158530                     90.5    6e-18   Cucumis sativus [cucumbers]
ref|XP_006368710.1|  hypothetical protein POPTR_0001s08000g           90.5    7e-18   
ref|XP_011029093.1|  PREDICTED: probable protein S-acyltransferas...  86.7    1e-16   Populus euphratica
ref|XP_011029092.1|  PREDICTED: probable protein S-acyltransferas...  86.7    1e-16   Populus euphratica
ref|XP_001781101.1|  predicted protein                                86.3    2e-16   
emb|CDP08627.1|  unnamed protein product                              81.3    3e-16   Coffea canephora [robusta coffee]
gb|ADE76560.1|  unknown                                               85.1    4e-16   Picea sitchensis
ref|XP_010540019.1|  PREDICTED: probable protein S-acyltransferas...  84.7    7e-16   Tarenaya hassleriana [spider flower]
ref|XP_004515766.1|  PREDICTED: probable S-acyltransferase At3g60...  82.8    3e-15   Cicer arietinum [garbanzo]
ref|XP_010100672.1|  putative S-acyltransferase                       80.9    8e-15   
ref|XP_011039088.1|  PREDICTED: probable protein S-acyltransferas...  80.9    1e-14   Populus euphratica
ref|XP_011039097.1|  PREDICTED: probable protein S-acyltransferas...  80.5    1e-14   Populus euphratica
ref|XP_002320223.1|  hypothetical protein POPTR_0014s09980g           80.5    2e-14   
ref|XP_006491350.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  79.3    4e-14   
ref|XP_006444756.1|  hypothetical protein CICLE_v10021463mg           79.0    4e-14   
ref|XP_006444753.1|  hypothetical protein CICLE_v10021463mg           79.0    4e-14   
gb|KDO86582.1|  hypothetical protein CISIN_1g021385mg                 79.3    4e-14   Citrus sinensis [apfelsine]
ref|XP_004506505.1|  PREDICTED: probable S-acyltransferase At3g60...  79.3    5e-14   Cicer arietinum [garbanzo]
gb|KJB09590.1|  hypothetical protein B456_001G151300                  78.2    7e-14   Gossypium raimondii
ref|XP_006440414.1|  hypothetical protein CICLE_v10021242mg           77.8    8e-14   
ref|XP_002263621.1|  PREDICTED: probable protein S-acyltransferas...  78.2    1e-13   Vitis vinifera
gb|KJB09587.1|  hypothetical protein B456_001G151300                  77.8    1e-13   Gossypium raimondii
ref|XP_006477282.1|  PREDICTED: probable protein S-acyltransferas...  77.8    2e-13   Citrus sinensis [apfelsine]
gb|KDO63753.1|  hypothetical protein CISIN_1g021223mg                 77.8    2e-13   Citrus sinensis [apfelsine]
ref|XP_006440415.1|  hypothetical protein CICLE_v10021242mg           77.8    2e-13   Citrus clementina [clementine]
ref|XP_009804295.1|  PREDICTED: probable protein S-acyltransferas...  75.5    2e-13   Nicotiana sylvestris
gb|AFK47432.1|  unknown                                               73.2    2e-13   Medicago truncatula
ref|XP_007051453.1|  DHHC-type zinc finger family protein             77.0    2e-13   
ref|XP_006830293.1|  hypothetical protein AMTR_s00121p00069490        77.4    4e-13   
ref|XP_003626591.1|  Palmitoyltransferase PFA4                        76.6    5e-13   Medicago truncatula
ref|XP_010054971.1|  PREDICTED: probable protein S-acyltransferas...  76.3    5e-13   Eucalyptus grandis [rose gum]
ref|XP_004240115.1|  PREDICTED: probable protein S-acyltransferas...  76.3    6e-13   Solanum lycopersicum
ref|XP_008355759.1|  PREDICTED: probable protein S-acyltransferas...  73.9    7e-13   
gb|KHG08036.1|  hypothetical protein F383_35334                       75.9    7e-13   Gossypium arboreum [tree cotton]
gb|KFK28858.1|  hypothetical protein AALP_AA7G057700                  75.9    7e-13   Arabis alpina [alpine rockcress]
ref|XP_004494854.1|  PREDICTED: probable S-acyltransferase At4g00...  76.6    7e-13   
emb|CDX98764.1|  BnaA03g45490D                                        75.9    8e-13   
emb|CDX94118.1|  BnaC07g37520D                                        75.5    9e-13   
ref|XP_010919145.1|  PREDICTED: probable protein S-acyltransferas...  75.5    1e-12   
ref|XP_008437841.1|  PREDICTED: probable protein S-acyltransferas...  75.5    1e-12   Cucumis melo [Oriental melon]
gb|KJB25655.1|  hypothetical protein B456_004G202600                  74.3    1e-12   Gossypium raimondii
ref|XP_009136121.1|  PREDICTED: probable protein S-acyltransferas...  71.2    1e-12   Brassica rapa
ref|XP_010448848.1|  PREDICTED: probable protein S-acyltransferas...  75.1    1e-12   Camelina sativa [gold-of-pleasure]
gb|KFK30666.1|  hypothetical protein AALP_AA6G012100                  74.7    1e-12   Arabis alpina [alpine rockcress]
emb|CDY41296.1|  BnaA01g12430D                                        72.0    2e-12   Brassica napus [oilseed rape]
gb|KDP28430.1|  hypothetical protein JCGZ_14201                       74.7    2e-12   Jatropha curcas
ref|XP_010433998.1|  PREDICTED: probable protein S-acyltransferas...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010439292.1|  PREDICTED: probable protein S-acyltransferas...  74.3    2e-12   Camelina sativa [gold-of-pleasure]
ref|XP_006360644.1|  PREDICTED: probable protein S-acyltransferas...  74.3    2e-12   Solanum tuberosum [potatoes]
gb|KJB25653.1|  hypothetical protein B456_004G202600                  73.9    3e-12   Gossypium raimondii
emb|CDX91862.1|  BnaC03g31640D                                        73.9    3e-12   
ref|XP_004167123.1|  PREDICTED: probable S-acyltransferase At4g00...  74.3    3e-12   
emb|CDX74374.1|  BnaA03g26730D                                        73.9    3e-12   
gb|KJB25654.1|  hypothetical protein B456_004G202600                  73.9    3e-12   Gossypium raimondii
ref|XP_004133790.1|  PREDICTED: probable S-acyltransferase At4g00...  73.9    3e-12   Cucumis sativus [cucumbers]
ref|XP_009137276.1|  PREDICTED: probable protein S-acyltransferas...  73.6    5e-12   Brassica rapa
ref|XP_009607103.1|  PREDICTED: probable protein S-acyltransferas...  73.2    5e-12   
ref|XP_009366621.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  73.6    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_008779828.1|  PREDICTED: probable protein S-acyltransferas...  73.6    5e-12   Phoenix dactylifera
ref|XP_009134494.1|  PREDICTED: probable protein S-acyltransferas...  73.2    6e-12   Brassica rapa
ref|XP_004306624.1|  PREDICTED: probable protein S-acyltransferas...  73.6    6e-12   Fragaria vesca subsp. vesca
emb|CDY07150.1|  BnaCnng01650D                                        73.2    6e-12   
ref|XP_002462839.1|  hypothetical protein SORBIDRAFT_02g032840        73.2    6e-12   Sorghum bicolor [broomcorn]
dbj|BAJ34112.1|  unnamed protein product                              73.2    6e-12   Eutrema halophilum
ref|XP_010267431.1|  PREDICTED: probable protein S-acyltransferas...  72.8    8e-12   
ref|XP_010267425.1|  PREDICTED: probable protein S-acyltransferas...  72.8    9e-12   Nelumbo nucifera [Indian lotus]
gb|AAM65313.1|  unknown                                               72.8    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567668.1|  DHHC-type zinc finger family protein                72.8    9e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008779824.1|  PREDICTED: probable protein S-acyltransferas...  73.2    1e-11   Phoenix dactylifera
ref|XP_008233069.1|  PREDICTED: probable protein S-acyltransferas...  72.8    1e-11   Prunus mume [ume]
ref|NP_001154264.1|  DHHC-type zinc finger family protein             72.8    1e-11   
ref|XP_006288366.1|  hypothetical protein CARUB_v10001614mg           72.0    1e-11   Capsella rubella
ref|XP_010422733.1|  PREDICTED: probable protein S-acyltransferas...  72.0    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010456165.1|  PREDICTED: probable protein S-acyltransferas...  72.0    1e-11   
ref|XP_006283414.1|  hypothetical protein CARUB_v10004463mg           73.6    1e-11   
ref|XP_010428132.1|  PREDICTED: probable protein S-acyltransferas...  72.0    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_009111388.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...  72.0    2e-11   Brassica rapa
emb|CDY51717.1|  BnaA09g52040D                                        72.0    2e-11   Brassica napus [oilseed rape]
ref|XP_002872926.1|  zinc ion binding protein                         71.6    2e-11   Arabidopsis lyrata subsp. lyrata
ref|XP_010238650.1|  PREDICTED: probable protein S-acyltransferas...  71.6    3e-11   
ref|XP_009136109.1|  PREDICTED: probable protein S-acyltransferas...  71.6    3e-11   Brassica rapa
ref|XP_003560239.2|  PREDICTED: probable protein S-acyltransferas...  71.6    3e-11   Brachypodium distachyon [annual false brome]
ref|XP_009401747.1|  PREDICTED: probable protein S-acyltransferas...  71.2    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006396329.1|  hypothetical protein EUTSA_v10028856mg           70.9    4e-11   Eutrema salsugineum [saltwater cress]
ref|XP_006413626.1|  hypothetical protein EUTSA_v10024722mg           72.4    4e-11   
ref|XP_004957652.1|  PREDICTED: probable S-acyltransferase At4g00...  70.9    5e-11   Setaria italica
ref|XP_010556619.1|  PREDICTED: probable protein S-acyltransferas...  70.5    5e-11   Tarenaya hassleriana [spider flower]
ref|XP_008376192.1|  PREDICTED: probable protein S-acyltransferas...  70.9    5e-11   Malus domestica [apple tree]
ref|NP_001190801.1|  sterol 4-alpha methyl oxidase 1-3                72.0    5e-11   
tpg|DAA40774.1|  TPA: hypothetical protein ZEAMMB73_782285            69.7    6e-11   
ref|NP_567193.2|  putative S-acyltransferase                          70.1    7e-11   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003521821.1|  PREDICTED: probable protein S-acyltransferas...  70.1    1e-10   Glycine max [soybeans]
gb|ACF85839.1|  unknown                                               69.7    1e-10   Zea mays [maize]
emb|CAA16560.1|  predicted protein                                    71.2    1e-10   Arabidopsis thaliana [mouse-ear cress]
gb|EMT22691.1|  hypothetical protein F775_15921                       67.4    1e-10   
ref|XP_002867753.1|  hypothetical protein ARALYDRAFT_329352           70.9    1e-10   
ref|XP_006657678.1|  PREDICTED: probable protein S-acyltransferas...  68.2    2e-10   Oryza brachyantha
ref|XP_007147347.1|  hypothetical protein PHAVU_006G116400g           68.9    2e-10   Phaseolus vulgaris [French bean]
dbj|BAK01014.1|  predicted protein                                    69.3    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006602749.1|  PREDICTED: probable protein S-acyltransferas...  68.2    3e-10   Glycine max [soybeans]
gb|KJB41112.1|  hypothetical protein B456_007G090900                  67.0    8e-10   Gossypium raimondii
ref|XP_009136132.1|  PREDICTED: probable protein S-acyltransferas...  67.0    1e-09   Brassica rapa
gb|EEE67131.1|  hypothetical protein OsJ_24176                        66.2    2e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81995.1|  hypothetical protein OsI_25930                        66.2    2e-09   Oryza sativa Indica Group [Indian rice]
gb|KJB49337.1|  hypothetical protein B456_008G114100                  65.5    3e-09   Gossypium raimondii
gb|EMS59025.1|  hypothetical protein TRIUR3_20383                     63.9    6e-09   Triticum urartu
ref|XP_010691320.1|  PREDICTED: probable protein S-acyltransferas...  64.7    8e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011082343.1|  PREDICTED: probable protein S-acyltransferas...  63.5    2e-08   
ref|XP_011082342.1|  PREDICTED: probable protein S-acyltransferas...  63.5    2e-08   Sesamum indicum [beniseed]
ref|XP_006598426.1|  PREDICTED: uncharacterized protein LOC100817234  63.2    4e-08   
ref|XP_006657677.1|  PREDICTED: probable protein S-acyltransferas...  58.9    4e-07   Oryza brachyantha
gb|EYU32291.1|  hypothetical protein MIMGU_mgv1a010611mg              59.3    6e-07   Erythranthe guttata [common monkey flower]
ref|XP_011469137.1|  PREDICTED: probable protein S-acyltransferas...  56.6    5e-06   Fragaria vesca subsp. vesca
emb|CDX82967.1|  BnaC01g14170D                                        55.5    2e-05   
emb|CBI22146.3|  unnamed protein product                              53.5    7e-05   Vitis vinifera
ref|XP_007052067.1|  DHHC-type zinc finger family protein isoform 2   52.8    1e-04   



>ref|XP_009798984.1| PREDICTED: probable protein S-acyltransferase 14, partial [Nicotiana 
sylvestris]
Length=136

 Score =   111 bits (278),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFGMD++YWFIPAYSEEDLR +PALHGLEYP KP +D 
Sbjct  75   AYEKKTSPKWRYDLGRKRNFEQVFGMDKRYWFIPAYSEEDLRRIPALHGLEYPSKPDLDA  134

Query  562  QE  557
            QE
Sbjct  135  QE  136



>ref|XP_006347869.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=309

 Score =   111 bits (278),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG+D+QYWFIP+YSEEDLR +PALHGLEYP KP ++ 
Sbjct  247  AYEKKTTPKWRYDLGRKRNFEQVFGLDKQYWFIPSYSEEDLRRMPALHGLEYPSKPELES  306

Query  562  QEF  554
            QEF
Sbjct  307  QEF  309



>ref|XP_009610572.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=308

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 54/62 (87%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFGMD++YWFIPAYSEEDLR +PALHG EYP KP +D 
Sbjct  247  AYEKKTTPKWRYDLGRKRNFEQVFGMDKRYWFIPAYSEEDLRRIPALHGFEYPSKPDLDA  306

Query  562  QE  557
            QE
Sbjct  307  QE  308



>ref|XP_004248564.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=308

 Score =   110 bits (275),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP +D 
Sbjct  247  AYEKKTSPKWRYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPDLDA  306

Query  562  QE  557
            QE
Sbjct  307  QE  308



>ref|XP_006364242.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=308

 Score =   110 bits (275),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 55/62 (89%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP +D 
Sbjct  247  AYEKKTSPKWRYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPDLDA  306

Query  562  QE  557
            QE
Sbjct  307  QE  308



>ref|XP_010325709.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=309

 Score =   110 bits (274),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG+D+Q+WFIP+YSEEDLR +PALHGLEYP KP ++ 
Sbjct  247  AYEKKTTPKWRYDLGRKRNFEQVFGLDKQHWFIPSYSEEDLRRMPALHGLEYPSKPELES  306

Query  562  QEF  554
            QEF
Sbjct  307  QEF  309



>ref|XP_009791941.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=309

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP ++ 
Sbjct  247  AYEKKTTPKWRYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPELES  306

Query  562  QEF  554
            Q+F
Sbjct  307  QDF  309



>gb|EYU31985.1| hypothetical protein MIMGU_mgv1a010704mg [Erythranthe guttata]
Length=304

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFGMD++YWF+PAYSEEDLR +PAL G EYP KP +D 
Sbjct  242  AYEKKTTPKWRYDLGRKRNFEQVFGMDKKYWFVPAYSEEDLRRMPALQGFEYPSKPDLDS  301

Query  562  QEF  554
            QEF
Sbjct  302  QEF  304



>emb|CDO97688.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG+DR+YWFIP YSEED+R +PAL GLEYP KP  D 
Sbjct  238  AYEKKTTPKWRYDLGRKRNFEQVFGLDRRYWFIPTYSEEDIRRIPALQGLEYPSKPDFDA  297

Query  562  QEF  554
            QEF
Sbjct  298  QEF  300



>ref|XP_009616135.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=309

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG+D++YWFIPAYSEEDLR +PALHGLEYP KP ++ 
Sbjct  247  AYEKKTTPKWRYDLGRKRNFEQVFGLDKRYWFIPAYSEEDLRRIPALHGLEYPSKPELES  306

Query  562  QEF  554
            Q F
Sbjct  307  QVF  309



>ref|XP_011090630.1| PREDICTED: probable protein S-acyltransferase 14 [Sesamum indicum]
Length=302

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/61 (77%), Positives = 53/61 (87%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR+RNFEQVFGMD++YWFIPAYSEEDLR +PAL GLEYP KP +D 
Sbjct  242  AYEKKTTPKWRYDLGRRRNFEQVFGMDKKYWFIPAYSEEDLRRIPALQGLEYPSKPDLDA  301

Query  562  Q  560
            Q
Sbjct  302  Q  302



>ref|XP_008438165.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=307

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFGMD++YW IPAYS+EDLR +PAL GLEYP KP ++ 
Sbjct  245  AYEKKTTPKWRYDLGRKRNFEQVFGMDKRYWLIPAYSDEDLRRMPALQGLEYPSKPELES  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_002511714.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50383.1| zinc finger protein, putative [Ricinus communis]
Length=307

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP +D 
Sbjct  245  AYEKKTTPKWRYDLGRRKNFEQVFGADKRYWFIPAYSEEDLRRMPALQGLEYPSKPELDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_004133913.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 ref|XP_004170066.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 gb|KGN56601.1| hypothetical protein Csa_3G126160 [Cucumis sativus]
Length=307

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFGMD++YW IPAYS+EDLR +PAL GLEYP KP ++ 
Sbjct  245  AYEKKTTPKWRYDLGRKRNFEQVFGMDKRYWLIPAYSDEDLRRMPALQGLEYPSKPELES  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_008393352.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D 
Sbjct  245  AYEKKTSTKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEYPSKPEFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>gb|KJB09889.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
 gb|KJB09892.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=304

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D 
Sbjct  242  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDS  301

Query  562  QEF  554
            QEF
Sbjct  302  QEF  304



>gb|KHG00286.1| hypothetical protein F383_19583 [Gossypium arboreum]
Length=307

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D 
Sbjct  245  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>gb|KJB09890.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=297

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D 
Sbjct  235  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDS  294

Query  562  QEF  554
            QEF
Sbjct  295  QEF  297



>ref|XP_010692246.1| PREDICTED: probable protein S-acyltransferase 14 [Beta vulgaris 
subsp. vulgaris]
Length=307

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLG+K+NF+QVFGMDR+YWFIPAYSEED+R +P L GLEYP KP +D 
Sbjct  245  AYEKKTSPKWRYDLGKKKNFQQVFGMDRRYWFIPAYSEEDIRRMPELQGLEYPSKPDLDA  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_007218730.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
 ref|XP_008232661.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Prunus 
mume]
 gb|EMJ19929.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
Length=307

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFGMD++YWFIPAYSEEDLR +PAL GLEYP +P  + 
Sbjct  245  AYEKKTSPKWRYDLGRKKNFEQVFGMDKRYWFIPAYSEEDLRRIPALQGLEYPSRPEFNS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_006445267.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 ref|XP_006490917.1| PREDICTED: probable protein S-acyltransferase 14-like [Citrus 
sinensis]
 gb|ESR58507.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 gb|KDO85813.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=307

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+ED+R +PAL GLEYP KP  D 
Sbjct  245  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDIRKMPALQGLEYPSKPDFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>emb|CDX71777.1| BnaC08g30970D [Brassica napus]
Length=305

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T +RWRYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P LHGLEYP KP  D 
Sbjct  245  AYEKKTSARWRYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELHGLEYPSKPDFDS  304

Query  562  Q  560
            Q
Sbjct  305  Q  305



>emb|CDY52347.1| BnaA09g38960D [Brassica napus]
Length=305

 Score =   105 bits (262),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T +RWRYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P LHGLEYP KP  D 
Sbjct  245  AYEKKTSARWRYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELHGLEYPSKPDFDS  304

Query  562  Q  560
            Q
Sbjct  305  Q  305



>ref|XP_009116762.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=305

 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T +RWRYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P LHGLEYP KP  D 
Sbjct  245  AYEKKTSARWRYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELHGLEYPSKPDFDS  304

Query  562  Q  560
            Q
Sbjct  305  Q  305



>ref|XP_010098912.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB76214.1| putative S-acyltransferase [Morus notabilis]
Length=308

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLG+K+NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP  D 
Sbjct  246  AYEKKTTPKWRYDLGQKKNFEQVFGADKRYWFIPAYSEEDLRRMPALQGLEYPSKPDFDS  305

Query  562  QEF  554
            QEF
Sbjct  306  QEF  308



>gb|ACU19432.1| unknown [Glycine max]
Length=307

 Score =   105 bits (261),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T S+WRYDLGR++NFEQVFGMD++YWFIPAYSEED+R +P L GLEYP  P  + 
Sbjct  245  AYEKKTTSKWRYDLGRRKNFEQVFGMDKRYWFIPAYSEEDIRRMPVLQGLEYPSTPDFNA  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_006587892.1| PREDICTED: probable protein S-acyltransferase 14-like [Glycine 
max]
Length=307

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T S+WRYDLGR++NFEQVFGMD++YWFIPAYSEED+R +P L GLEYP  P  + 
Sbjct  245  AYEKKTTSKWRYDLGRRKNFEQVFGMDKRYWFIPAYSEEDIRRMPVLQGLEYPSTPDFNA  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>gb|KDP28757.1| hypothetical protein JCGZ_14528 [Jatropha curcas]
Length=307

 Score =   105 bits (261),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFG D++YWF+PAYS+EDLR +PAL GLEYP KP +D 
Sbjct  245  AYEKKTTPKWRYDLGRRKNFEQVFGADKRYWFVPAYSDEDLRRMPALQGLEYPSKPDLDC  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_010255627.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP  P +D 
Sbjct  254  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSEEDLRRMPALQGLEYPSNPVLDA  313

Query  562  QEF  554
            QE+
Sbjct  314  QEY  316



>ref|XP_010918308.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W+YDLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GL+YP KP    
Sbjct  255  AYEKKTTPKWKYDLGRKKNFEQVFGTDKKYWFIPAYSEEDLRKIPALQGLDYPTKPDFSA  314

Query  562  QEF  554
            QEF
Sbjct  315  QEF  317



>ref|XP_011469138.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=307

 Score =   104 bits (260),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D+ YWFIPAYSEEDLR +PAL GLEYP KP  D 
Sbjct  245  AYEKKTTPKWRYDLGRKKNFEQVFGTDKLYWFIPAYSEEDLRRIPALQGLEYPSKPEFDS  304

Query  562  QEF  554
            Q+F
Sbjct  305  QDF  307



>ref|XP_009338113.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=307

 Score =   104 bits (260),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D 
Sbjct  245  AYEKKTSPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEYPSKPEFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_010056317.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
Length=307

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFG D+ YWFIPAYSEED+R +PAL GLEYP +PG D 
Sbjct  245  AYEKKTTPKWRYDLGRRKNFEQVFGTDKLYWFIPAYSEEDIRRMPALQGLEYPSRPGFDS  304

Query  562  QEF  554
            +EF
Sbjct  305  EEF  307



>ref|XP_011034295.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIP YSE+DLR +PAL GLEYP KP  D 
Sbjct  245  AYEKKTTPKWRYDLGRKKNFEQVFGADKRYWFIPTYSEDDLRRMPALQGLEYPSKPDFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_007052066.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOX96223.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
Length=353

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLEYP KP  D 
Sbjct  242  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRMPALQGLEYPSKPDFDS  301

Query  562  QEF  554
            QE+
Sbjct  302  QEY  304



>gb|AES87286.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=299

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFGMD++YWFIPAYSEED+R +PAL GLEYP KP  D 
Sbjct  239  AYEKKTTPKWRYDLGRRKNFEQVFGMDKKYWFIPAYSEEDVRRMPALQGLEYPSKPDFDS  298

Query  562  Q  560
            Q
Sbjct  299  Q  299



>ref|XP_003605089.1| Palmitoyltransferase pfa3 [Medicago truncatula]
Length=292

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFGMD++YWFIPAYSEED+R +PAL GLEYP KP  D 
Sbjct  232  AYEKKTTPKWRYDLGRRKNFEQVFGMDKKYWFIPAYSEEDVRRMPALQGLEYPSKPDFDS  291

Query  562  Q  560
            Q
Sbjct  292  Q  292



>gb|ABK24332.1| unknown [Picea sitchensis]
Length=316

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRKRNFEQVFG  + YW IPAY EEDLR +PALHGLEYP KP +D 
Sbjct  254  AYEKKTTPKWRYDLGRKRNFEQVFGTQKLYWLIPAYFEEDLRRMPALHGLEYPSKPDLDA  313

Query  562  QEF  554
            QEF
Sbjct  314  QEF  316



>gb|EMS35725.1| hypothetical protein TRIUR3_29953 [Triticum urartu]
 gb|EMS55127.1| hypothetical protein TRIUR3_00856 [Triticum urartu]
 gb|EMS65745.1| hypothetical protein TRIUR3_17126 [Triticum urartu]
Length=81

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW YDLGRK+NF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++  +DG
Sbjct  19   AYEKKTSPRWMYDLGRKKNFAQVFGNDKKYWFIPAYSEEDLRRMPALQGLDYPVRTDLDG  78

Query  562  QEF  554
            QE 
Sbjct  79   QEL  81



>ref|XP_010276626.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
 ref|XP_010276634.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYSEED+R +PAL GLEYP  P +D 
Sbjct  254  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSEEDIRRIPALQGLEYPSNPVLDA  313

Query  562  QEF  554
            QE+
Sbjct  314  QEY  316



>ref|XP_003579517.1| PREDICTED: probable protein S-acyltransferase 14 [Brachypodium 
distachyon]
Length=315

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW YDLGRKRNF QVFG D++YWFIPAY+EEDLR +PALHGL+YP++  +DG
Sbjct  253  AYEKKTSPRWMYDLGRKRNFAQVFGNDKKYWFIPAYTEEDLRRMPALHGLDYPVRADLDG  312

Query  562  QEF  554
            QE 
Sbjct  313  QEL  315



>gb|KHN40573.1| Putative S-acyltransferase [Glycine soja]
Length=371

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T S+W YDLGR++NFEQVFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + 
Sbjct  309  AYEKKTASKWHYDLGRRKNFEQVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNA  368

Query  562  QEF  554
            QEF
Sbjct  369  QEF  371



>emb|CBI38870.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D+ YWFIPAY+EEDLR +P L GLE+P KP +D 
Sbjct  238  AYEKKTTLKWRYDLGRKKNFEQVFGTDKLYWFIPAYTEEDLRRMPVLQGLEFPSKPDLDA  297

Query  562  QEF  554
            QEF
Sbjct  298  QEF  300



>ref|XP_002279896.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 ref|XP_010661650.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 emb|CAN80505.1| hypothetical protein VITISV_010744 [Vitis vinifera]
Length=307

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D+ YWFIPAY+EEDLR +P L GLE+P KP +D 
Sbjct  245  AYEKKTTLKWRYDLGRKKNFEQVFGTDKLYWFIPAYTEEDLRRMPVLQGLEFPSKPDLDA  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_011017489.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+ED R +PAL G+EYP KP  D 
Sbjct  245  AYEKKTTPKWRYDLGRKKNFEQVFGADKRYWFIPAYSDEDTRRMPALQGIEYPSKPDFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>gb|AFW57919.1| palmitoyltransferase ZDHHC20, mRNA [Zea mays]
Length=243

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T   W YDLGRKRNF QVFG DR+YWFIPAYSEEDLR  PAL GL+YP++P  DG
Sbjct  181  AYEKKTTPHWIYDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRTPALQGLDYPVRPDFDG  240

Query  562  QEF  554
            QE 
Sbjct  241  QEL  243



>ref|XP_003552340.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Glycine 
max]
Length=309

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T S+W YDLGR++NFEQVFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + 
Sbjct  247  AYEKKTASKWHYDLGRRKNFEQVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNA  306

Query  562  QEF  554
            QEF
Sbjct  307  QEF  309



>ref|XP_004975099.1| PREDICTED: probable S-acyltransferase At3g60800-like [Setaria 
italica]
Length=316

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T   W YDLGRKRNF QVFG DR+YWFIPAYSEEDLR +PAL GL+YP++P  DG
Sbjct  254  AYEKKTTPHWIYDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRIPALQGLDYPVRPDFDG  313

Query  562  QEF  554
            QE 
Sbjct  314  QEL  316



>ref|XP_006602748.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Glycine 
max]
Length=307

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T S+W YDLGR++NFEQVFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + 
Sbjct  245  AYEKKTASKWHYDLGRRKNFEQVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNA  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_009398464.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW+YDLGRK+NFEQVFG D++YWFIP YSEEDLR +PAL GLEYP KP +D 
Sbjct  254  AYEKKTTPRWKYDLGRKKNFEQVFGADKRYWFIPLYSEEDLRRMPALQGLEYPTKPDLDA  313

Query  562  Q  560
            Q
Sbjct  314  Q  314



>ref|XP_010910428.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=136

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W+Y+LGRK+NFEQVFG DR+YWFIPAYSEEDL+  PAL GL+YP K     
Sbjct  74   AYEKKTTPKWKYNLGRKKNFEQVFGADRRYWFIPAYSEEDLKKTPALQGLDYPTKADFSA  133

Query  562  QEF  554
            QEF
Sbjct  134  QEF  136



>gb|KFK35280.1| hypothetical protein AALP_AA5G264300 [Arabis alpina]
Length=305

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLGRK+NFEQVFGMD++YWFIP Y+EEDLR +P L GLEYP KP  D 
Sbjct  245  AYEKKTSTKWRYDLGRKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELQGLEYPSKPNFDS  304

Query  562  Q  560
            Q
Sbjct  305  Q  305



>ref|XP_008232660.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Prunus 
mume]
Length=581

 Score =   104 bits (260),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFGMD++YWFIPAYSEEDLR +PAL GLEYP +P  + 
Sbjct  519  AYEKKTSPKWRYDLGRKKNFEQVFGMDKRYWFIPAYSEEDLRRIPALQGLEYPSRPEFNS  578

Query  562  QEF  554
            QEF
Sbjct  579  QEF  581



>ref|XP_006402542.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
 gb|ESQ43995.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
Length=305

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLGRK+NFEQVFGMD++YWFIP YSEEDLR +P L GLEYP KP  D 
Sbjct  245  AYEKKTSTKWRYDLGRKKNFEQVFGMDKKYWFIPGYSEEDLRRMPELQGLEYPSKPDFDS  304

Query  562  Q  560
            Q
Sbjct  305  Q  305



>ref|XP_009389071.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W+YDLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GL+YP KP +D 
Sbjct  255  AYEKKTTPKWKYDLGRKKNFEQVFGTDKKYWFIPAYSEEDLRRMPALQGLKYPTKPNLDV  314

Query  562  Q  560
            Q
Sbjct  315  Q  315



>ref|XP_002446206.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
 gb|EES10534.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
Length=316

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T   W YDLGRKRNF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++P  DG
Sbjct  254  AYEKKTTPHWIYDLGRKRNFAQVFGNDKKYWFIPAYSEEDLRRIPALQGLDYPVRPDFDG  313

Query  562  QEF  554
            QE 
Sbjct  314  QEL  316



>gb|KHN29455.1| Putative S-acyltransferase [Glycine soja]
Length=307

 Score =   102 bits (253),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T S+WRYDLGR++NFEQVFGMD++YWFIPAYSEED+R +  L GLEYP  P  + 
Sbjct  245  AYEKKTTSKWRYDLGRRKNFEQVFGMDKRYWFIPAYSEEDIRRMAVLQGLEYPSTPDFNA  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|NP_001148846.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACF83769.1| unknown [Zea mays]
 gb|ACG33116.1| palmitoyltransferase ZDHHC20 [Zea mays]
Length=316

 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T   W YDLGRKRNF QVFG DR+YWFIPAYSEEDLR  PAL GL+YP++P  DG
Sbjct  254  AYEKKTTPHWIYDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRTPALQGLDYPVRPDFDG  313

Query  562  QEF  554
            QE 
Sbjct  314  QEL  316



>ref|XP_010413515.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=155

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D 
Sbjct  95   AYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDS  154

Query  562  Q  560
            Q
Sbjct  155  Q  155



>gb|KJB49336.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=257

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLE+P  P  D 
Sbjct  195  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEFPSNPDFDS  254

Query  562  QEF  554
            +EF
Sbjct  255  EEF  257



>ref|XP_003517050.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
1 [Glycine max]
 gb|KHN40156.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D 
Sbjct  244  AYEKKTTPKWRYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDS  303

Query  562  Q  560
            Q
Sbjct  304  Q  304



>ref|XP_007134881.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
 gb|ESW06875.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
Length=304

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D 
Sbjct  244  AYEKKTTPKWRYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDS  303

Query  562  Q  560
            Q
Sbjct  304  Q  304



>gb|AHA84213.1| palmitoyltransferase [Phaseolus vulgaris]
Length=304

 Score =   102 bits (253),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D 
Sbjct  244  AYEKKTTPKWRYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDS  303

Query  562  Q  560
            Q
Sbjct  304  Q  304



>ref|XP_003521795.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Glycine max]
 gb|KHN35648.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 52/61 (85%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQVFGMD++YWFIPAYS+ED+R +PAL GL+YP KP  D 
Sbjct  244  AYEKKTTPKWRYDLGRRKNFEQVFGMDKKYWFIPAYSDEDIRKMPALQGLDYPSKPDFDS  303

Query  562  Q  560
            Q
Sbjct  304  Q  304



>gb|KJB41110.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
 gb|KJB41111.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=307

 Score =   101 bits (252),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK +  +WRYDLGRK+NFEQVFG D+ YWFIP YS+EDLR +PAL GLEYP KP  D 
Sbjct  245  AYEKKSTPKWRYDLGRKKNFEQVFGTDKLYWFIPGYSDEDLRRMPALQGLEYPSKPDFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>gb|KHG30156.1| hypothetical protein F383_14468 [Gossypium arboreum]
Length=314

 Score =   101 bits (252),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK +  +WRYDLGRK+NFEQVFG D+ YWFIP YS+EDLR +PAL GLEYP KP  D 
Sbjct  252  AYEKKSTPKWRYDLGRKKNFEQVFGTDKLYWFIPGYSDEDLRRMPALQGLEYPSKPDFDS  311

Query  562  QEF  554
            QEF
Sbjct  312  QEF  314



>gb|KJB49335.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=307

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWFIPAYS+EDLR +PAL GLE+P  P  D 
Sbjct  245  AYEKKTTPKWRYDLGRKKNFEQVFGTDKRYWFIPAYSDEDLRRIPALQGLEFPSNPDFDS  304

Query  562  QEF  554
            +EF
Sbjct  305  EEF  307



>emb|CDX71345.1| BnaC07g06240D [Brassica napus]
Length=300

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFGMD++YWFIP YSEEDLR +P L GLEYP KP  D 
Sbjct  240  AYEKKTSGKWRYDLGRKKNFEQVFGMDKRYWFIPGYSEEDLRRMPELQGLEYPSKPDFDS  299

Query  562  Q  560
            Q
Sbjct  300  Q  300



>emb|CDX89079.1| BnaA04g01070D [Brassica napus]
Length=300

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/61 (74%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFGMD++YWFIP YSEEDLR +P L GLEYP KP  D 
Sbjct  240  AYEKKTSGKWRYDLGRKKNFEQVFGMDKRYWFIPGYSEEDLRRMPELQGLEYPSKPDFDS  299

Query  562  Q  560
            Q
Sbjct  300  Q  300



>ref|XP_010524364.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=307

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFGMD++YWF+P YSEEDLR +P L GL+YP KP  D 
Sbjct  245  AYEKKTSPKWRYDLGRKKNFEQVFGMDKRYWFLPTYSEEDLRRMPELQGLKYPSKPDFDS  304

Query  562  QEF  554
            +EF
Sbjct  305  EEF  307



>ref|XP_008343300.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFG D++YWF+PAYS+EDLR +PAL GLEYP  P  D 
Sbjct  245  AYEKKTSFKWRYDLGRKKNFEQVFGTDKRYWFMPAYSDEDLRRIPALQGLEYPSNPEFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_008798535.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score =   100 bits (249),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W+YDLGRK+NFEQVFG D+++WFIPAY+EEDLR +PAL GL+YP +P    
Sbjct  255  AYEKKTTPKWKYDLGRKKNFEQVFGTDKRFWFIPAYTEEDLRKIPALQGLDYPTRPDFST  314

Query  562  QEF  554
            QEF
Sbjct  315  QEF  317



>emb|CDY51805.1| BnaC04g53110D [Brassica napus]
Length=309

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTSPKWPYDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  QEF  554
            Q+F
Sbjct  307  QDF  309



>ref|XP_009143135.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Brassica 
rapa]
Length=337

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  275  AYEKKTSPKWPYDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  334

Query  562  QEF  554
            Q+F
Sbjct  335  QDF  337



>emb|CDX74736.1| BnaA05g04820D [Brassica napus]
Length=309

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTSPKWPYDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  QEF  554
            Q+F
Sbjct  307  QDF  309



>ref|XP_006291552.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
 gb|EOA24450.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
Length=306

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLG+K+NFEQVFGMD++YWFIP Y+EEDLR +P L GLEYP KP  D 
Sbjct  246  AYEKKTSTKWRYDLGKKKNFEQVFGMDKRYWFIPGYTEEDLRRMPELQGLEYPSKPDFDS  305

Query  562  Q  560
            Q
Sbjct  306  Q  306



>ref|XP_006652138.1| PREDICTED: probable protein S-acyltransferase 14-like [Oryza 
brachyantha]
Length=316

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW YDLGRKRNF QVFG D++YWFIPAYSEEDLR +P L GL+YP++  +DG
Sbjct  254  AYEKKTTPRWMYDLGRKRNFVQVFGNDKRYWFIPAYSEEDLRRMPVLQGLDYPVRTDLDG  313

Query  562  QEF  554
            QE 
Sbjct  314  QEL  316



>ref|XP_009143136.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Brassica 
rapa]
Length=309

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTSPKWPYDLGRKKNFEQVFGMDKKYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  QEF  554
            Q+F
Sbjct  307  QDF  309



>gb|EMT07089.1| Putative S-acyltransferase [Aegilops tauschii]
Length=308

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW YDLGRK+NF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++  +DG
Sbjct  246  AYEKKTSPRWMYDLGRKKNFAQVFGNDKKYWFIPAYSEEDLRRMPALQGLDYPVRTDLDG  305

Query  562  QEF  554
            QE 
Sbjct  306  QEL  308



>ref|XP_008776787.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W+YDLGRK+NFEQVFG D++YWFIPAYSEEDLR  PAL GL+YP K     
Sbjct  255  AYEKKTTPKWKYDLGRKKNFEQVFGTDKRYWFIPAYSEEDLRKTPALQGLDYPTKADFSA  314

Query  562  QEF  554
            QEF
Sbjct  315  QEF  317



>ref|XP_002882009.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58268.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  246  AYEKKTSPKWPYDLGRKKNFEQVFGMDKRYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  305

Query  562  QEF  554
            Q+F
Sbjct  306  QDF  308



>dbj|BAJ93966.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89372.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW YDLGRK+NF QVFG D++YWFIPAYSEEDLR +PAL GL+YP++  +DG
Sbjct  254  AYEKKTSPRWMYDLGRKKNFAQVFGNDKKYWFIPAYSEEDLRRMPALQGLDYPVRTDLDG  313

Query  562  QEF  554
            QE 
Sbjct  314  QEL  316



>ref|XP_004492612.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=307

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK   S+WRY+LG ++N EQVFG D++YWFIPAYSEED+R +P L GLEYP +PG D 
Sbjct  245  AYEKEATSKWRYNLGTRKNLEQVFGTDKRYWFIPAYSEEDIRRMPVLQGLEYPSRPGFDS  304

Query  562  QEF  554
            QEF
Sbjct  305  QEF  307



>ref|XP_006851861.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
 gb|ERN13328.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
Length=305

 Score = 99.4 bits (246),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLG ++NFEQVFG D+ YWFIP YSEEDLR +PAL GLEYP KP +D 
Sbjct  245  AYEKKTSPKWRYDLGGRKNFEQVFGTDKAYWFIPTYSEEDLRRMPALQGLEYPCKPDLDA  304

Query  562  Q  560
            Q
Sbjct  305  Q  305



>ref|NP_191639.2| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q8VYP5.1|ZDH14_ARATH RecName: Full=Probable protein S-acyltransferase 14; AltName: 
Full=Probable palmitoyltransferase At3g60800; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g60800 [Arabidopsis 
thaliana]
 gb|AAL49877.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20224.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01138.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80109.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=307

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  Q  560
            Q
Sbjct  307  Q  307



>ref|NP_001051618.1| Os03g0804300 [Oryza sativa Japonica Group]
 gb|AAS07218.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|ABF99420.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13532.1| Os03g0804300 [Oryza sativa Japonica Group]
Length=316

 Score = 99.0 bits (245),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW YD+GRKRNF QVFG D++YWFIPAYSEEDLR +P L GL+YP++  +DG
Sbjct  254  AYEKKTTPRWMYDIGRKRNFIQVFGNDKRYWFIPAYSEEDLRRMPVLQGLDYPVRTDLDG  313

Query  562  QEF  554
            QE 
Sbjct  314  QEL  316



>emb|CAB82684.1| putative protein [Arabidopsis thaliana]
Length=273

 Score = 98.6 bits (244),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D 
Sbjct  213  AYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDS  272

Query  562  Q  560
            Q
Sbjct  273  Q  273



>gb|EEC76365.1| hypothetical protein OsI_13959 [Oryza sativa Indica Group]
Length=308

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  RW YD+GRKRNF QVFG D++YWFIPAYSEEDLR +P L GL+YP++  +DG
Sbjct  246  AYEKKTTPRWMYDIGRKRNFIQVFGNDKRYWFIPAYSEEDLRRMPVLQGLDYPVRTDLDG  305

Query  562  QEF  554
            QE 
Sbjct  306  QEL  308



>ref|XP_010469144.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  Q  560
            Q
Sbjct  307  Q  307



>ref|XP_006397719.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
 gb|ESQ39172.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
Length=308

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GL+YP KP  D 
Sbjct  246  AYEKKTSPKWPYDLGRKKNFEQVFGMDKRYWLIPAYSEEDLRRMPELQGLDYPSKPDFDS  305

Query  562  QEF  554
            Q+F
Sbjct  306  QDF  308



>ref|XP_010413516.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  Q  560
            Q
Sbjct  307  Q  307



>ref|XP_010910146.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W+Y+LGRK+NFEQVFG DR+YWFIPAYSEEDL+  PAL GL+YP K     
Sbjct  255  AYEKKTTPKWKYNLGRKKNFEQVFGADRRYWFIPAYSEEDLKKTPALQGLDYPTKADFSA  314

Query  562  QEF  554
            QEF
Sbjct  315  QEF  317



>ref|XP_002302535.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE81808.2| zinc finger family protein [Populus trichocarpa]
Length=310

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQ---VFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPG  572
            AYEK T  +WRYDLGRK+NFEQ   VFG D++YWFIPAYS+ED R +PAL GLEYP KP 
Sbjct  245  AYEKKTTPKWRYDLGRKKNFEQANYVFGADKRYWFIPAYSDEDTRRMPALQGLEYPSKPD  304

Query  571  IDGQEF  554
             D QEF
Sbjct  305  FDSQEF  310



>gb|KHG01247.1| hypothetical protein F383_23406 [Gossypium arboreum]
Length=235

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLG+K+NFEQVFG D++YWFIPAYS+EDLR + AL GLE+P  P  D 
Sbjct  173  AYEKKTTPKWRYDLGQKKNFEQVFGTDKRYWFIPAYSDEDLRRMAALQGLEFPSNPDFDS  232

Query  562  QEF  554
            +EF
Sbjct  233  EEF  235



>ref|XP_002878349.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54608.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=306

 Score = 98.2 bits (243),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++WRYDLG+K+NFEQVFGMD++YW IP Y+EEDLR +P L GLEYP KP  D 
Sbjct  246  AYEKKTSTKWRYDLGKKKNFEQVFGMDKRYWLIPGYTEEDLRRMPELQGLEYPSKPDFDS  305

Query  562  Q  560
            Q
Sbjct  306  Q  306



>gb|KJB37584.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
 gb|KJB37586.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=308

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +WRYDLG K+NFEQVFG+D++YWFIPAYSE+DLR LPALHG EYP +P ++
Sbjct  245  AYEKKTSPKWRYDLGWKKNFEQVFGLDKKYWFIPAYSEDDLRRLPALHGFEYPTRPDLE  303



>ref|XP_010508175.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010508176.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFG D++YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTSPKWPYDLGRKKNFEQVFGTDKRYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  QEF  554
            Q+F
Sbjct  307  QDF  309



>ref|XP_009399491.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 52/61 (85%), Gaps = 1/61 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W++DLGRK+NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP +D 
Sbjct  256  AYEKTT-PKWKFDLGRKKNFEQVFGTDKRYWFIPAYSEEDLRRMPALRGLEYPTKPHLDV  314

Query  562  Q  560
            Q
Sbjct  315  Q  315



>ref|XP_010506482.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 97.4 bits (241),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFG D+ YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTSPKWPYDLGRKKNFEQVFGTDKMYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  QEF  554
            Q+F
Sbjct  307  QDF  309



>gb|KFK37316.1| hypothetical protein AALP_AA4G241200 [Arabis alpina]
Length=307

 Score = 97.1 bits (240),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFGMD++YW IPAYSEEDLR +P L GLEYP KP    
Sbjct  245  AYEKKTSPKWPYDLGRKKNFEQVFGMDKRYWLIPAYSEEDLRRMPELQGLEYPSKPDFGS  304

Query  562  QEF  554
            Q+F
Sbjct  305  QDF  307



>gb|KHG16541.1| hypothetical protein F383_02611 [Gossypium arboreum]
Length=308

 Score = 96.7 bits (239),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +WRYDLG K+NFEQVFG+D++YWFIPAYSE+DLR +PALHG EYP +P ++
Sbjct  245  AYEKKTSPKWRYDLGWKKNFEQVFGLDKKYWFIPAYSEDDLRRMPALHGFEYPTQPDLE  303



>gb|EPS68199.1| hypothetical protein M569_06570, partial [Genlisea aurea]
Length=315

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 50/58 (86%), Gaps = 0/58 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGI  569
            AYEK T  +WRYDLG+KRNFEQVFG+D++YWFIP+YS+EDL+ LPA+ GLEYP  P +
Sbjct  258  AYEKKTTPKWRYDLGKKRNFEQVFGLDKKYWFIPSYSKEDLKRLPAIQGLEYPTNPEV  315



>ref|XP_009138811.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=300

 Score = 96.7 bits (239),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFGMD++Y FIP Y+EEDLR +P L GLEYP KP  D 
Sbjct  240  AYEKKTSGKWRYDLGRKKNFEQVFGMDKRYCFIPGYTEEDLRRMPELQGLEYPSKPDFDS  299

Query  562  Q  560
            Q
Sbjct  300  Q  300



>ref|XP_010544651.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=305

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGRK+NFEQVFGMD++YW +P YSEEDLR +P LHGLE+P +P  D 
Sbjct  245  AYEKKTSPKWRYDLGRKKNFEQVFGMDKRYWLLPGYSEEDLRRMPELHGLEFPSRPDFDS  304

Query  562  Q  560
            +
Sbjct  305  E  305



>ref|XP_002535239.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF27145.1| zinc finger protein, putative [Ricinus communis]
Length=261

 Score = 95.9 bits (237),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +WRYDLGRK+NFEQVFG+D++YW IPAYSE+DL+ +PAL G EYP +P +D
Sbjct  198  AYEKRTDPKWRYDLGRKKNFEQVFGIDKRYWLIPAYSEDDLKCMPALKGFEYPTRPNLD  256



>ref|XP_010518152.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010518153.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGRK+NFEQVFG D+ YW IPAYSEEDLR +P L GLEYP KP  D 
Sbjct  247  AYEKKTSPKWPYDLGRKKNFEQVFGPDKIYWLIPAYSEEDLRRMPELQGLEYPSKPDFDS  306

Query  562  QEF  554
            Q+F
Sbjct  307  QDF  309



>ref|XP_010647607.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=136

 Score = 92.4 bits (228),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A+EK   S WRYD+GRK+NFEQVFGMD+++W IPAYSEED+  +P L GLEYP +P +D 
Sbjct  73   AFEKKRTSTWRYDIGRKKNFEQVFGMDKRFWLIPAYSEEDILQMPELQGLEYPSRPNLDA  132

Query  562  -QEF  554
             Q+F
Sbjct  133  LQQF  136



>ref|XP_010108133.1| putative S-acyltransferase [Morus notabilis]
 gb|EXC17865.1| putative S-acyltransferase [Morus notabilis]
Length=307

 Score = 95.5 bits (236),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 48/60 (80%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +W YDLGR  NFEQVFG D++YWFIPAYSEEDLR +PAL GLEYP KP ++ 
Sbjct  244  AYEKKTTPKWHYDLGRSINFEQVFGTDKRYWFIPAYSEEDLRRIPALQGLEYPTKPELNA  303



>gb|KJB37583.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=523

 Score = 97.1 bits (240),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +WRYDLG K+NFEQVFG+D++YWFIPAYSE+DLR LPALHG EYP +P ++
Sbjct  460  AYEKKTSPKWRYDLGWKKNFEQVFGLDKKYWFIPAYSEDDLRRLPALHGFEYPTRPDLE  518



>gb|KCW78273.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=235

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++W +DLGRKRNFEQVFG D+ YWFIPAY EED + +P L+GL+YP++P  D 
Sbjct  173  AYEKKTTTKWHFDLGRKRNFEQVFGTDKLYWFIPAYLEEDKKRIPCLNGLDYPVRPEFDS  232

Query  562  QEF  554
            + F
Sbjct  233  EAF  235



>ref|XP_010053896.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW78271.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=307

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T ++W +DLGRKRNFEQVFG D+ YWFIPAY EED + +P L+GL+YP++P  D 
Sbjct  245  AYEKKTTTKWHFDLGRKRNFEQVFGTDKLYWFIPAYLEEDKKRIPCLNGLDYPVRPEFDS  304

Query  562  QEF  554
            + F
Sbjct  305  EAF  307



>ref|XP_007209402.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
 gb|EMJ10601.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
Length=301

 Score = 93.6 bits (231),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK    +W+YDLGRK+NFEQVFG D+ YWFIPAYSEEDLR +PAL G++YP +P ++ 
Sbjct  238  AYEKKATPKWQYDLGRKKNFEQVFGTDKWYWFIPAYSEEDLRQIPALQGIDYPTRPELNA  297

Query  562  QE  557
             +
Sbjct  298  LQ  299



>ref|XP_008238650.1| PREDICTED: probable protein S-acyltransferase 14 [Prunus mume]
Length=301

 Score = 93.2 bits (230),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK    +W+YDLGRK+NFEQVFG D+ YWFIPAYSEEDLR +PAL G++YP +P ++ 
Sbjct  238  AYEKKATPKWQYDLGRKKNFEQVFGTDKWYWFIPAYSEEDLRRIPALQGIDYPTRPELNA  297

Query  562  QE  557
             +
Sbjct  298  LQ  299



>ref|XP_011033891.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=318

 Score = 93.2 bits (230),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A+EK T  +WRYDLGR++NFEQVFG+D++ WFIPAYSEEDL  +P L G EYP +P +DG
Sbjct  255  AFEKKTNPKWRYDLGRRKNFEQVFGLDKRCWFIPAYSEEDLERMPVLRGFEYPTRPDLDG  314

Query  562  QE  557
             +
Sbjct  315  LQ  316



>ref|XP_004952412.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X1 [Setaria italica]
 ref|XP_004952413.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X2 [Setaria italica]
Length=317

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T   W+YDLGRKRNF QVFG ++ YWFIP+YSEEDLR +PAL GL+YP++   DG
Sbjct  255  AYEKKTTPFWKYDLGRKRNFAQVFGNNKWYWFIPSYSEEDLRIIPALQGLDYPVRSDFDG  314

Query  562  Q  560
            Q
Sbjct  315  Q  315



>ref|XP_008345376.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=334

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK   ++W+YDLGRK+NFEQVFG D  YWFIPAYSEEDLR +PAL G++YP +P ++ 
Sbjct  271  AYEKKATTKWQYDLGRKKNFEQVFGTDMWYWFIPAYSEEDLRRIPALQGIDYPTRPELNA  330

Query  562  QE  557
             +
Sbjct  331  LQ  332



>ref|NP_001169109.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACN31678.1| unknown [Zea mays]
 tpg|DAA38384.1| TPA: palmitoyltransferase ZDHHC20 [Zea mays]
Length=312

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
            AYEK T   W YDLGRKRNF QVFG DR+YWFIPAYSEEDLR +PAL GL+YP+ 
Sbjct  254  AYEKKTTPHWIYDLGRKRNFAQVFGNDRKYWFIPAYSEEDLRRIPALQGLDYPVS  308



>ref|XP_009362134.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=301

 Score = 92.8 bits (229),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK   ++W+YDLGRK+NFEQVFG D  YWFIPAYSEEDLR +PAL G++YP +P ++ 
Sbjct  238  AYEKKATTKWQYDLGRKKNFEQVFGTDIWYWFIPAYSEEDLRRIPALQGIDYPTRPELNA  297

Query  562  QE  557
             +
Sbjct  298  LQ  299



>ref|XP_007039984.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOY24485.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=312

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/56 (70%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKP  575
            AYEK T  +WRYDLG K+NFEQVFG ++++WFIPAYSEEDLR +P+L GLEYP +P
Sbjct  249  AYEKKTTPKWRYDLGWKKNFEQVFGTEKKFWFIPAYSEEDLRCMPSLQGLEYPTRP  304



>ref|XP_002994078.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
 gb|EFJ04865.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
Length=313

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK   +RWRYDLGR++NFEQVFG  + +WF+P Y+EED+R +P   GLEYP++  ++G
Sbjct  251  AYEKKATARWRYDLGRRKNFEQVFGTKKLFWFLPMYAEEDVRRMPVFKGLEYPVRSDMEG  310

Query  562  QEF  554
            QEF
Sbjct  311  QEF  313



>ref|XP_002989117.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
 gb|EFJ09911.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
Length=314

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK   +RWRYDLGR++NFEQVFG  + +WF+P Y+EED+R +P   GLEYP++  ++G
Sbjct  252  AYEKKATARWRYDLGRRKNFEQVFGTKKLFWFLPMYAEEDVRRMPVFKGLEYPVRSDMEG  311

Query  562  QEF  554
            QEF
Sbjct  312  QEF  314



>ref|XP_010662159.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=310

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/64 (63%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A+EK   S WRYD+GRK+NFEQVFGMD+++W IPAYSEED+  +P L GLEYP +P +D 
Sbjct  247  AFEKKRTSTWRYDIGRKKNFEQVFGMDKRFWLIPAYSEEDIIQMPELQGLEYPSRPNLDA  306

Query  562  -QEF  554
             Q+F
Sbjct  307  LQQF  310



>ref|XP_008437153.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=310

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +W YDLGR++NFEQVFGMD++YWFIPAYS+ED++ +P L GLEYP++  ++
Sbjct  247  AYEKKTTPKWHYDLGRRKNFEQVFGMDKKYWFIPAYSQEDIKRMPNLQGLEYPMRSDLN  305



>gb|KDP42560.1| hypothetical protein JCGZ_24334 [Jatropha curcas]
Length=316

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 49/59 (83%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +W+YDLGRK+NFEQVFG D++YW IPAYSE+DL+ +P L G EYP++P +D
Sbjct  253  AYEKKTNPKWQYDLGRKKNFEQVFGTDKRYWLIPAYSEDDLKRMPVLRGFEYPIRPDLD  311



>ref|XP_002304438.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
 gb|EEE79417.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
Length=318

 Score = 91.3 bits (225),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK T  +WRYDLGR++NFEQVFG+D++ WFIPAYSEEDL  +P L G EYP +P +D
Sbjct  255  AFEKKTNPKWRYDLGRRKNFEQVFGVDKRCWFIPAYSEEDLECMPVLRGFEYPTRPDLD  313



>ref|XP_011463771.1| PREDICTED: probable protein S-acyltransferase 14 [Fragaria vesca 
subsp. vesca]
Length=310

 Score = 91.3 bits (225),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 38/56 (68%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKP  575
            AYEK ++ +W YDLGRK+NFEQVFG ++ YWFIPAYSEEDLR +PAL G++YP +P
Sbjct  247  AYEKKSIPKWHYDLGRKQNFEQVFGTNKWYWFIPAYSEEDLRRMPALQGIDYPTRP  302



>ref|XP_004147573.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 ref|XP_004165772.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
Length=310

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +W YDLGR++NFEQVFGMD++YWFIPAYS++D++ +P L GLEYP++  ++
Sbjct  247  AYEKKTTPKWHYDLGRRKNFEQVFGMDKKYWFIPAYSQDDIKRMPNLQGLEYPMRSDLN  305



>gb|KGN50197.1| hypothetical protein Csa_5G158530 [Cucumis sativus]
Length=316

 Score = 90.5 bits (223),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 50/59 (85%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            AYEK T  +W YDLGR++NFEQVFGMD++YWFIPAYS++D++ +P L GLEYP++  ++
Sbjct  253  AYEKKTTPKWHYDLGRRKNFEQVFGMDKKYWFIPAYSQDDIKRMPNLQGLEYPMRSDLN  311



>ref|XP_006368710.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
 gb|ERP65279.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
Length=304

 Score = 90.5 bits (223),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 37/59 (63%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK +  +W YDLGR++NFEQVFG D++YWFIPAYSEEDL  +P L G EYP +P +D
Sbjct  241  AFEKKSNPKWHYDLGRRKNFEQVFGTDKRYWFIPAYSEEDLECMPVLQGFEYPTRPDLD  299



>ref|XP_011029093.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Populus 
euphratica]
Length=271

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK +  +W YDLGR++NFEQVFG D+ YWFIPAYSEEDL  +  L G EYP +P +D
Sbjct  208  AFEKKSSPKWHYDLGRRKNFEQVFGTDKIYWFIPAYSEEDLECMQVLQGFEYPTRPDLD  266



>ref|XP_011029092.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Populus 
euphratica]
Length=310

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK +  +W YDLGR++NFEQVFG D+ YWFIPAYSEEDL  +  L G EYP +P +D
Sbjct  247  AFEKKSSPKWHYDLGRRKNFEQVFGTDKIYWFIPAYSEEDLECMQVLQGFEYPTRPDLD  305



>ref|XP_001781101.1| predicted protein [Physcomitrella patens]
 gb|EDQ54049.1| predicted protein, partial [Physcomitrella patens]
Length=306

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T +RW +DLG KRNFEQVFG  + YWF+P Y +EDLR + AL+GL+YP++  ++G
Sbjct  244  AYEKKTSTRWLFDLGWKRNFEQVFGTRKLYWFLPLYDKEDLRKITALNGLDYPMRSDLEG  303

Query  562  QEF  554
            QE+
Sbjct  304  QEY  306



>emb|CDP08627.1| unnamed protein product [Coffea canephora]
Length=74

 Score = 81.3 bits (199),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 43/53 (81%), Gaps = 0/53 (0%)
 Frame = -1

Query  739  YEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPL  581
            YEK     W+YDLGRKRNFEQVFG  + +WF P +SEEDL+++PALHGL++P+
Sbjct  16   YEKKKAVHWKYDLGRKRNFEQVFGTKKMFWFFPLFSEEDLKNIPALHGLDFPI  68



>gb|ADE76560.1| unknown [Picea sitchensis]
Length=309

 Score = 85.1 bits (209),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             YEK   SRWRYD+GRK+NFEQVFG  +  W  P Y+EEDL +LP L+GL++P++P ++G
Sbjct  250  VYEKKKTSRWRYDMGRKKNFEQVFGKQKLCWLFPLYAEEDLETLPVLNGLDFPVRPDVEG  309



>ref|XP_010540019.1| PREDICTED: probable protein S-acyltransferase 13 [Tarenaya hassleriana]
Length=307

 Score = 84.7 bits (208),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
            AYEK T   WR+DLGRK NF+QVFG D++YWF+PAY+E+D++ +PAL G+E+P
Sbjct  244  AYEKKTTPNWRFDLGRKENFKQVFGTDKRYWFVPAYTEDDMKRMPALRGVEFP  296



>ref|XP_004515766.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=299

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 47/62 (76%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A +  T  +W Y+LG ++N+EQ+FG D++YW IPAYSEEDLR + ALHGLEYP+ P ++ 
Sbjct  236  AIKTSTTPKWHYNLGWRKNYEQIFGNDKRYWLIPAYSEEDLRQMTALHGLEYPIDPDLEA  295

Query  562  QE  557
             +
Sbjct  296  LQ  297



>ref|XP_010100672.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB83834.1| putative S-acyltransferase [Morus notabilis]
Length=259

 Score = 80.9 bits (198),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 45/59 (76%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             YEK  + RW+YDLGRK+NFEQVFG  +  WF P +S++DL ++PALHGLE+P +  ++
Sbjct  200  VYEKKRVVRWQYDLGRKKNFEQVFGTKKTLWFFPLFSKDDLDNIPALHGLEFPTRADVE  258



>ref|XP_011039088.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Populus 
euphratica]
Length=307

 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             YEK   +RW+YDLGRK+NFEQVFG  +  WF P +S+ED+  +PALHGL++P++  ++ 
Sbjct  248  VYEKKGAARWKYDLGRKKNFEQVFGTKKALWFFPLFSKEDVDKIPALHGLDFPIRADLES  307



>ref|XP_011039097.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Populus 
euphratica]
Length=298

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             YEK   +RW+YDLGRK+NFEQVFG  +  WF P +S+ED+  +PALHGL++P++  ++ 
Sbjct  239  VYEKKGAARWKYDLGRKKNFEQVFGTKKALWFFPLFSKEDVDKIPALHGLDFPIRADLES  298



>ref|XP_002320223.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
 gb|EEE98538.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
Length=331

 Score = 80.5 bits (197),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             YEK   +RW+YDLGRK+NFEQVFG  +  WF P +S+ED+  +PALHGL++P++  ++ 
Sbjct  272  VYEKKGAARWKYDLGRKKNFEQVFGTKKALWFFPLFSKEDVDKIPALHGLDFPIRADLES  331



>ref|XP_006491350.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12-like [Citrus sinensis]
Length=303

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             YEK    RW+YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  246  VYEKKRTVRWKYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  298



>ref|XP_006444756.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
 gb|ESR57996.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
Length=278

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             YEK    RW+YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  224  VYEKKRTVRWKYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  276



>ref|XP_006444753.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
 gb|ESR57993.1| hypothetical protein CICLE_v10021463mg [Citrus clementina]
Length=283

 Score = 79.0 bits (193),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             YEK    RW+YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  229  VYEKKRTVRWKYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  281



>gb|KDO86582.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=300

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             YEK    RW+YDLGRK+NFEQVFG ++  WF P +S+ED  S+PALHGL++P
Sbjct  246  VYEKKRTVRWKYDLGRKKNFEQVFGTNKALWFFPLFSKEDSDSIPALHGLDFP  298



>ref|XP_004506505.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=305

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            AYEK T  +WRYDLGR++NFEQV+  D       AYSEED+R +PAL GLEYP KP  D 
Sbjct  245  AYEKKTTPKWRYDLGRRKNFEQVYFFDXXXXXXXAYSEEDIRRMPALQGLEYPSKPDFDS  304

Query  562  Q  560
            Q
Sbjct  305  Q  305



>gb|KJB09590.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=234

 Score = 78.2 bits (191),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             +EK  + RW+YDLGRK+NFEQVFG  +  W  P +SE+DL  +PAL GLE+P +  +D 
Sbjct  175  VHEKKGVIRWKYDLGRKKNFEQVFGTKKSLWLFPLFSEDDLEKIPALRGLEFPTRSDVDA  234



>ref|XP_006440414.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53654.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|KDO63756.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=253

 Score = 77.8 bits (190),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK T  +WRYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  193  AFEKKTSPKWRYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  251



>ref|XP_002263621.1| PREDICTED: probable protein S-acyltransferase 12 [Vitis vinifera]
 emb|CBI38696.3| unnamed protein product [Vitis vinifera]
Length=308

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             YEK    RW+YDLGRK NFEQVFG  +  W  P YSE+D  S+PALHGL++P +  ++ 
Sbjct  249  VYEKRRAVRWKYDLGRKTNFEQVFGKKKALWLFPLYSEDDFSSIPALHGLDFPTRSDVEA  308



>gb|KJB09587.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
 gb|KJB09589.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=295

 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             +EK  + RW+YDLGRK+NFEQVFG  +  W  P +SE+DL  +PAL GLE+P +  +D 
Sbjct  236  VHEKKGVIRWKYDLGRKKNFEQVFGTKKSLWLFPLFSEDDLEKIPALRGLEFPTRSDVDA  295



>ref|XP_006477282.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477283.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X2 [Citrus sinensis]
Length=316

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK T  +WRYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  256  AFEKKTSPKWRYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  314



>gb|KDO63753.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
 gb|KDO63754.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=316

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK T  +WRYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  256  AFEKKTSPKWRYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  314



>ref|XP_006440415.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 ref|XP_006440416.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53655.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53656.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
Length=315

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            A+EK T  +WRYDLG K NFEQVFG +++YW IPAYS++DL  LP+   +EYP +P  D
Sbjct  255  AFEKKTSPKWRYDLGWKINFEQVFGKNKKYWLIPAYSKDDLEWLPSFQCVEYPTRPDSD  313



>ref|XP_009804295.1| PREDICTED: probable protein S-acyltransferase 12 [Nicotiana sylvestris]
Length=160

 Score = 75.5 bits (184),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YEK    RW+YDLG KRNFEQVFG ++  WF+P +S++DL ++PAL+G+E+P +
Sbjct  101  VYEKKKTVRWKYDLGWKRNFEQVFGANKALWFLPMFSKKDLENIPALYGVEFPTR  155



>gb|AFK47432.1| unknown [Medicago truncatula]
Length=74

 Score = 73.2 bits (178),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 30/58 (52%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  739  YEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            +EK    RWRYD+G K+NFEQVFG  +  W  P +SEEDL ++PAL G+E+P +  +D
Sbjct  16   HEKKKGVRWRYDVGGKKNFEQVFGTKKALWLFPLFSEEDLENIPALKGIEFPTRSDVD  73



>ref|XP_007051453.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOX95610.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=294

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             +EK    RW+YDLGRK+NF+QVFG  +  WF P +SE+DL ++PALHG+++P +  ++ 
Sbjct  235  VHEKKGAVRWKYDLGRKKNFDQVFGTKKTLWFFPMFSEDDLDNIPALHGIDFPTRSDVEA  294



>ref|XP_006830293.1| hypothetical protein AMTR_s00121p00069490, partial [Amborella 
trichopoda]
 gb|ERM97709.1| hypothetical protein AMTR_s00121p00069490, partial [Amborella 
trichopoda]
Length=367

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGI  569
             YEK  + RW+YDLGR++NFEQVFG  + YW IP  S EDL ++PAL GL++P++  +
Sbjct  310  VYEKRGVVRWKYDLGRRKNFEQVFGTKKAYWMIPVLSTEDLVNVPALRGLDFPIRSDV  367



>ref|XP_003626591.1| Palmitoyltransferase PFA4 [Medicago truncatula]
 gb|AES82809.1| DHHC-type zinc finger protein [Medicago truncatula]
Length=307

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RWRYD+GRK+NFEQVFG  +  W  P +SEEDL ++PAL G+E+P +  +D
Sbjct  248  VHEKKKGVRWRYDVGRKKNFEQVFGTKKALWLFPLFSEEDLENIPALRGIEFPTRSDVD  306



>ref|XP_010054971.1| PREDICTED: probable protein S-acyltransferase 12 [Eucalyptus 
grandis]
 gb|KCW71455.1| hypothetical protein EUGRSUZ_E00018 [Eucalyptus grandis]
Length=306

 Score = 76.3 bits (186),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             YEK    RW+YDLGR++NFEQVFG  +  W  P  SEEDL  +PALHGLE+P +  ++ 
Sbjct  247  VYEKKKGVRWKYDLGRRKNFEQVFGTKKALWLFPLLSEEDLGKIPALHGLEFPTRSDVEA  306



>ref|XP_004240115.1| PREDICTED: probable protein S-acyltransferase 12 [Solanum lycopersicum]
Length=309

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGI  569
             YEK    +WRYD+G KRNFEQVFG ++  WF P +S++D+ S+PALHG+E+P +  +
Sbjct  250  VYEKKKSPQWRYDMGWKRNFEQVFGANKVLWFFPLFSKKDMESIPALHGMEFPTRSDV  307



>ref|XP_008355759.1| PREDICTED: probable protein S-acyltransferase 12 [Malus domestica]
Length=155

 Score = 73.9 bits (180),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             +EK    RW+YDLGRK+NFEQVFG  +  W +P +S+EDL ++PAL GLE+P
Sbjct  96   VHEKRGAIRWKYDLGRKKNFEQVFGTKKALWLLPLFSKEDLDNVPALRGLEFP  148



>gb|KHG08036.1| hypothetical protein F383_35334 [Gossypium arboreum]
Length=303

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A +K T   WRYDLG K+N+EQVFG +++ W IP YS++D+R +PAL G EYP +P  D 
Sbjct  242  AKDKKTGLTWRYDLGWKKNYEQVFGTEKKLWLIPVYSKDDIRRMPALQGFEYPTRPNWDP  301

Query  562  QE  557
            Q 
Sbjct  302  QH  303



>gb|KFK28858.1| hypothetical protein AALP_AA7G057700 [Arabis alpina]
Length=304

 Score = 75.9 bits (185),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/52 (65%), Positives = 41/52 (79%), Gaps = 1/52 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T + W YDLGRK NFEQVFG D+ YWFIP Y+E D++ LPAL GL++
Sbjct  241  AYEKHT-TNWPYDLGRKTNFEQVFGRDKMYWFIPLYTEVDMKRLPALRGLDF  291



>ref|XP_004494854.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cicer arietinum]
Length=365

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RWRYDLGRK+NFEQVFG  +  W  P +SEEDL ++PAL G+E+P +  +D
Sbjct  306  VHEKKKGVRWRYDLGRKKNFEQVFGTKKALWLFPLFSEEDLDNIPALRGIEFPTRSDVD  364



>emb|CDX98764.1| BnaA03g45490D [Brassica napus]
Length=305

 Score = 75.9 bits (185),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     YDLGRK NFEQVFG D+ YWF+P Y+EED++ LPAL GL++
Sbjct  241  AYEKYTTPNSPYDLGRKANFEQVFGRDKMYWFVPLYTEEDMKRLPALGGLDF  292



>emb|CDX94118.1| BnaC07g37520D [Brassica napus]
Length=305

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/52 (63%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     YDLGRK NFEQVFG D+ YWF+P Y+EED++ LPAL GL++
Sbjct  241  AYEKYTTPNSPYDLGRKANFEQVFGRDKMYWFVPLYTEEDMKRLPALGGLDF  292



>ref|XP_010919145.1| PREDICTED: probable protein S-acyltransferase 12 [Elaeis guineensis]
Length=315

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK   + W+YDLG++RNFEQVFG  +  WF+P YS+EDL  +PAL GL++P +  ++
Sbjct  256  VHEKKKAAVWKYDLGKRRNFEQVFGTKKSLWFLPLYSQEDLEKMPALQGLDFPTRSDVE  314



>ref|XP_008437841.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Cucumis 
melo]
Length=306

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             +EK    +W+YDLG+K+NFEQVFG     WF P +S+EDL  +PAL GLE+P++ G++ 
Sbjct  247  VHEKRRAVQWKYDLGKKKNFEQVFGTKAALWFFPLFSKEDLEKIPALRGLEFPIRTGMES  306



>gb|KJB25655.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=238

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A +K T   WRYDLG K+N+EQVFG +++ W IP YS++D R +PAL G EYP +P  D 
Sbjct  177  AKDKKTGLTWRYDLGWKKNYEQVFGTEKKLWLIPVYSKDDKRRMPALQGFEYPTRPNWDP  236

Query  562  QE  557
            Q 
Sbjct  237  QH  238



>ref|XP_009136121.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=79

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ +PAL GL++
Sbjct  15   AYEKHTAPNSPYNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPALRGLDF  66



>ref|XP_010448848.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=304

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  590
            AYEK T++ W Y+LGRK NFEQVFG D+ YWF+P Y+EED++ LPA+ GL+
Sbjct  242  AYEKHTVN-WPYNLGRKTNFEQVFGSDKMYWFVPLYTEEDMKKLPAVGGLD  291



>gb|KFK30666.1| hypothetical protein AALP_AA6G012100 [Arabis alpina]
Length=289

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 44/59 (75%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL ++ +LHGLE+P +  ID
Sbjct  230  VHEKNGEVRWKYDLGKKKNFEQVFGKKKVFWLLPLYSKDDLDNMTSLHGLEFPTRSDID  288



>emb|CDY41296.1| BnaA01g12430D [Brassica napus]
Length=125

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ +PAL GL++
Sbjct  61   AYEKHTAPNSPYNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPALRGLDF  112



>gb|KDP28430.1| hypothetical protein JCGZ_14201 [Jatropha curcas]
Length=309

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             YEK     W+YD+GRK NFEQVFG  +  W +P +S+EDL ++PALHGL++P +  ++ 
Sbjct  250  VYEKKGAVGWKYDMGRKNNFEQVFGAKKTLWLLPLFSKEDLDNIPALHGLDFPTRSDVEA  309



>ref|XP_010433998.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  590
            AYEK T++ W Y+LGRK NFEQVFG ++ YWF+P Y+EED++ LPAL GL+
Sbjct  243  AYEKHTVN-WPYNLGRKTNFEQVFGSNKMYWFVPLYTEEDMKKLPALGGLD  292



>ref|XP_010439292.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/51 (65%), Positives = 41/51 (80%), Gaps = 1/51 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  590
            AYEK T++ W Y+LGRK NFEQVFG D+ YWF+P Y EED++ LPAL GL+
Sbjct  243  AYEKHTVN-WPYNLGRKTNFEQVFGSDKMYWFVPLYIEEDMKKLPALGGLD  292



>ref|XP_006360644.1| PREDICTED: probable protein S-acyltransferase 12-like [Solanum 
tuberosum]
Length=309

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YEK   ++W+YD+G KRNFEQVFG ++  WF P +S++D+ ++PALHG+E+P +
Sbjct  250  VYEKKKSAQWKYDMGWKRNFEQVFGANKVLWFFPLFSKKDMENIPALHGMEFPTR  304



>gb|KJB25653.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=285

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A +K T   WRYDLG K+N+EQVFG +++ W IP YS++D R +PAL G EYP +P  D 
Sbjct  224  AKDKKTGLTWRYDLGWKKNYEQVFGTEKKLWLIPVYSKDDKRRMPALQGFEYPTRPNWDP  283

Query  562  QE  557
            Q 
Sbjct  284  QH  285



>emb|CDX91862.1| BnaC03g31640D [Brassica napus]
Length=291

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL S+ +L GLE+P +  ID
Sbjct  232  VHEKNGDVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHSITSLQGLEFPTRSDID  290



>ref|XP_004167123.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cucumis 
sativus]
Length=306

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    +W YDLG+K+NFEQVFG     WF P +S+EDL  +PAL GLE+P++ G++
Sbjct  247  VHEKRRAVQWMYDLGKKKNFEQVFGTKAALWFFPLFSKEDLEKIPALRGLEFPIRTGME  305



>emb|CDX74374.1| BnaA03g26730D [Brassica napus]
Length=291

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL S+ +L GLE+P +  ID
Sbjct  232  VHEKNGDVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHSITSLQGLEFPTRSDID  290



>gb|KJB25654.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=292

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            A +K T   WRYDLG K+N+EQVFG +++ W IP YS++D R +PAL G EYP +P  D 
Sbjct  231  AKDKKTGLTWRYDLGWKKNYEQVFGTEKKLWLIPVYSKDDKRRMPALQGFEYPTRPNWDP  290

Query  562  QE  557
            Q 
Sbjct  291  QH  292



>ref|XP_004133790.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cucumis 
sativus]
 gb|KGN56387.1| hypothetical protein Csa_3G118230 [Cucumis sativus]
Length=306

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             +EK    +W YDLG+K+NFEQVFG     WF P +S+EDL  +PAL GLE+P++ G++ 
Sbjct  247  VHEKRRAVQWMYDLGKKKNFEQVFGTKAALWFFPLFSKEDLEKIPALRGLEFPIRSGMES  306



>ref|XP_009137276.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=305

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     YDLGRK NFEQVFG D+ YW +P Y+EED++ LPAL GL++
Sbjct  241  AYEKYTTPNSPYDLGRKANFEQVFGRDKMYWLVPLYTEEDMKRLPALGGLDF  292



>ref|XP_009607103.1| PREDICTED: probable protein S-acyltransferase 12, partial [Nicotiana 
tomentosiformis]
Length=277

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YEK     W+YDLG KRNFEQVFG ++  WF+P +S++DL ++PAL+G+E+P +
Sbjct  218  VYEKKKTVHWKYDLGWKRNFEQVFGANKALWFLPLFSKKDLENIPALYGVEFPTR  272



>ref|XP_009366621.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Pyrus x bretschneideri]
Length=303

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             +EK    RW+YDLGRK+NFEQVFG  +  W +P +S+EDL ++PAL GLE+P
Sbjct  244  VHEKRGAIRWKYDLGRKKNFEQVFGTKKALWLLPLFSKEDLDNVPALRGLEFP  296



>ref|XP_008779828.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Phoenix 
dactylifera]
Length=315

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK   + W+YDLG++RNFEQVFG  +  WF+P YS+EDL  +PAL GL++P +  ++
Sbjct  256  VHEKKKGAVWKYDLGKRRNFEQVFGTKKLLWFLPLYSQEDLEKMPALQGLDFPTRSDVE  314



>ref|XP_009134494.1| PREDICTED: probable protein S-acyltransferase 12 [Brassica rapa]
Length=291

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W  P YS++DL S+ +L GLE+P +  ID
Sbjct  232  VHEKNGDVRWKYDLGKKKNFEQVFGKKKAFWLFPLYSKDDLHSITSLQGLEFPTRSDID  290



>ref|XP_004306624.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468902.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468903.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
Length=308

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             +EK   +RW+YDLGRK+NFEQVFG  +  WF P  S+ED+ ++PAL GLE+P
Sbjct  249  VHEKRRGTRWKYDLGRKKNFEQVFGTKKALWFFPLLSKEDIDNIPALRGLEFP  301



>emb|CDY07150.1| BnaCnng01650D [Brassica napus]
Length=289

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  230  VHEKSGDVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLHNITSLQGLEFPTRSDID  288



>ref|XP_002462839.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
 gb|EER99360.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
Length=293

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YE+     W+YDLG KRN EQVFG  + +WF+P YS EDL ++PAL GLE+P +
Sbjct  234  VYERKKSVSWKYDLGWKRNLEQVFGTKKLFWFVPMYSTEDLHNIPALQGLEFPTR  288



>dbj|BAJ34112.1| unnamed protein product [Thellungiella halophila]
Length=304

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     Y+LGRK NFEQVFG D+ YWF+P Y+E+D++ LPAL GL++
Sbjct  240  AYEKYTAPNSPYNLGRKTNFEQVFGRDKMYWFVPLYTEDDMKRLPALRGLDF  291



>ref|XP_010267431.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Nelumbo 
nucifera]
Length=296

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  736  EKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            EK    RW+YDLG K+NFEQVFG  + +WF P +S+EDL  + ALHGL++P +  ++ 
Sbjct  239  EKKKAVRWKYDLGWKKNFEQVFGTKKVFWFFPLFSKEDLEKITALHGLDFPTRSDVEA  296



>ref|XP_010267425.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267426.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267427.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267428.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267429.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267430.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
Length=306

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -1

Query  736  EKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
            EK    RW+YDLG K+NFEQVFG  + +WF P +S+EDL  + ALHGL++P +  ++ 
Sbjct  249  EKKKAVRWKYDLGWKKNFEQVFGTKKVFWFFPLFSKEDLEKITALHGLDFPTRSDVEA  306



>gb|AAM65313.1| unknown [Arabidopsis thaliana]
Length=302

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T++ W Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  238  AYEKHTVN-WPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  288



>ref|NP_567668.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q94C49.1|ZDH18_ARATH RecName: Full=Probable protein S-acyltransferase 13; AltName: 
Full=Probable palmitoyltransferase At4g22750; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g22750 [Arabidopsis 
thaliana]
 gb|AAK59683.1| unknown protein [Arabidopsis thaliana]
 gb|AAL33803.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84651.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=302

 Score = 72.8 bits (177),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T++ W Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  238  AYEKHTVN-WPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  288



>ref|XP_008779824.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Phoenix 
dactylifera]
Length=339

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK   + W+YDLG++RNFEQVFG  +  WF+P YS+EDL  +PAL GL++P +  ++
Sbjct  280  VHEKKKGAVWKYDLGKRRNFEQVFGTKKLLWFLPLYSQEDLEKMPALQGLDFPTRSDVE  338



>ref|XP_008233069.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233070.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233071.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
Length=308

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             +EK    RW+YDLGRK+NFEQVFG  +  WF P  S+EDL ++PAL GLE+P
Sbjct  249  VHEKRRGIRWKYDLGRKKNFEQVFGTKKALWFFPLVSKEDLNNIPALRGLEFP  301



>ref|NP_001154264.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 gb|AEE84652.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=324

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T++ W Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  260  AYEKHTVN-WPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  310



>ref|XP_006288366.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
 gb|EOA21264.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
Length=291

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  739  YEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  233  HEKNGEVRWKYDLGKKKNFEQVFGRKKAFWLLPLYSKDDLENITSLQGLEFPTRSDID  290



>ref|XP_010422733.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  232  VHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  290



>ref|XP_010456165.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  232  VHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  290



>ref|XP_006283414.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
 gb|EOA16312.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
Length=574

 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/51 (63%), Positives = 42/51 (82%), Gaps = 1/51 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLE  590
            AYEK T++ W Y+LGRK NFEQVFG D+ YWF+P Y+EED++ LP+L GL+
Sbjct  512  AYEKHTVN-WPYNLGRKTNFEQVFGRDKMYWFVPLYTEEDMKKLPSLGGLD  561



>ref|XP_010428132.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=292

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  233  VHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  291



>ref|XP_009111388.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Brassica rapa]
Length=292

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+++NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  233  VHEKSGDVRWKYDLGKRKNFEQVFGKKKAFWLLPLYSKDDLHNITSLQGLEFPTRSDID  291



>emb|CDY51717.1| BnaA09g52040D [Brassica napus]
Length=289

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+++NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  230  VHEKSGDVRWKYDLGKRKNFEQVFGKKKAFWLLPLYSKDDLHNITSLQGLEFPTRSDID  288



>ref|XP_002872926.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49185.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -1

Query  739  YEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
            +EK    RW+YDLG+K+NFE+VFG  + +W +P YS+EDL ++ +L GLE+P +  ID
Sbjct  233  HEKNGEVRWKYDLGKKKNFEEVFGKKKAFWLLPLYSKEDLDNMTSLQGLEFPTRSDID  290



>ref|XP_010238650.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Brachypodium 
distachyon]
Length=298

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPG  572
             YE+     W+YDLG ++N EQVFG  + +WF+P +S EDL ++PAL GL +P +PG
Sbjct  239  VYERKKTVSWQYDLGWRKNLEQVFGTKKLFWFLPVHSSEDLHNIPALQGLGFPARPG  295



>ref|XP_009136109.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=301

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 41/52 (79%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ +PAL GL++
Sbjct  237  AYEKHTAPNSPYNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPALRGLDF  288



>ref|XP_003560239.2| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Brachypodium 
distachyon]
Length=312

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPG  572
             YE+     W+YDLG ++N EQVFG  + +WF+P +S EDL ++PAL GL +P +PG
Sbjct  253  VYERKKTVSWQYDLGWRKNLEQVFGTKKLFWFLPVHSSEDLHNIPALQGLGFPARPG  309



>ref|XP_009401747.1| PREDICTED: probable protein S-acyltransferase 12 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             YEK     W+YDLG+++NFEQVFG  +  WF+P +S EDL  +PAL GL++P +  ++
Sbjct  254  VYEKKKAVIWKYDLGKRKNFEQVFGTKKLLWFLPLFSAEDLEKIPALKGLDFPTRSDVE  312



>ref|XP_006396329.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
 gb|ESQ37782.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
Length=290

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+++NFEQVFG  + +W +P YS++DL ++ +L GLE+P +  ID
Sbjct  231  VHEKNGEVRWKYDLGKRKNFEQVFGKKKAFWLLPLYSKDDLDNITSLQGLEFPTRSDID  289



>ref|XP_006413626.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
 gb|ESQ55079.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
Length=599

 Score = 72.4 bits (176),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T     Y+LGRK NFEQVFG D+ YWF+P Y+E+D++ LPAL GL++
Sbjct  535  AYEKYTAPNSPYNLGRKTNFEQVFGRDKMYWFVPLYTEDDMKRLPALRGLDF  586



>ref|XP_004957652.1| PREDICTED: probable S-acyltransferase At4g00840-like [Setaria 
italica]
Length=292

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YE+     W+YDLG +RN EQVFG  + +WF+P YS EDL ++PAL GLE+P +
Sbjct  233  VYERKKSVSWKYDLGWRRNLEQVFGTKKLFWFVPLYSAEDLHNIPALGGLEFPTR  287



>ref|XP_010556619.1| PREDICTED: probable protein S-acyltransferase 12 [Tarenaya hassleriana]
Length=293

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDG  563
             +EK    RW+YDLG+K+NFEQVFG  +  W +P YS+ED  S+ AL G+ +P +  ID 
Sbjct  234  VHEKTGDDRWKYDLGKKKNFEQVFGKSKALWLLPLYSKEDAESITALRGVNFPTRSDIDA  293



>ref|XP_008376192.1| PREDICTED: probable protein S-acyltransferase 12 [Malus domestica]
Length=308

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             +EK     W+YDLGRK+NFEQVFG  +  W +P +S+EDL ++PAL GLE+P
Sbjct  249  VHEKRGAIGWKYDLGRKKNFEQVFGTKKALWLLPLFSKEDLDNVPALRGLEFP  301



>ref|NP_001190801.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
 gb|AEE84650.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
Length=581

 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T++ W Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  517  AYEKHTVN-WPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  567



>tpg|DAA40774.1| TPA: hypothetical protein ZEAMMB73_782285 [Zea mays]
Length=258

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YE+     W+YDLG KRN EQVFG  +  WF+P YS EDL ++PAL G+E+P +
Sbjct  199  VYERKKSVSWKYDLGWKRNLEQVFGTKKLLWFVPLYSTEDLHNIPALRGMEFPTR  253



>ref|NP_567193.2| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q5M757.1|ZDH15_ARATH RecName: Full=Probable protein S-acyltransferase 12; AltName: 
Full=Probable palmitoyltransferase At4g00840; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g00840 [Arabidopsis 
thaliana]
 gb|AAV91337.1| At4g00840 [Arabidopsis thaliana]
 gb|AAW39012.1| At4g00840 [Arabidopsis thaliana]
 dbj|BAF01156.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81944.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=291

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG+K+NFEQVFG  + +W +P YS++D+ ++ +L GLE+P    ID
Sbjct  232  VHEKNGEVRWKYDLGKKKNFEQVFGKKKAFWLLPLYSKDDIDNITSLEGLEFPTCSDID  290



>ref|XP_003521821.1| PREDICTED: probable protein S-acyltransferase 12-like [Glycine 
max]
 gb|KHN16412.1| Putative S-acyltransferase [Glycine soja]
Length=314

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/59 (51%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW YDLG KRNFEQVFG  +  W  P +S+EDL ++PAL G+E+P +  +D
Sbjct  255  VHEKKKGVRWMYDLGWKRNFEQVFGTKKALWLFPLFSKEDLDNIPALRGIEFPTRSDVD  313



>gb|ACF85839.1| unknown [Zea mays]
 gb|ACG46105.1| transposon protein [Zea mays]
 tpg|DAA40776.1| TPA: Transposon protein [Zea mays]
Length=293

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YE+     W+YDLG KRN EQVFG  +  WF+P YS EDL ++PAL G+E+P +
Sbjct  234  VYERKKSVSWKYDLGWKRNLEQVFGTKKLLWFVPLYSTEDLHNIPALRGMEFPTR  288



>emb|CAA16560.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79230.1| predicted protein [Arabidopsis thaliana]
Length=820

 Score = 71.2 bits (173),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T++ W Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  756  AYEKHTVN-WPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  806



>gb|EMT22691.1| hypothetical protein F775_15921 [Aegilops tauschii]
Length=163

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYP  584
             YE+     W YDLG ++N EQVFG ++  WF+P Y  EDL+++P + GLE+P
Sbjct  104  VYERKKTCSWEYDLGWRKNLEQVFGTNKLLWFLPMYCTEDLQNIPTIQGLEFP  156



>ref|XP_002867753.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44012.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score = 70.9 bits (172),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 1/52 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEY  587
            AYEK T++ W Y++GRK NFEQVFG D+ YWF+P Y+E+D + LPAL GL++
Sbjct  713  AYEKHTVN-WPYNVGRKTNFEQVFGSDKMYWFVPLYTEDDKKKLPALGGLDF  763



>ref|XP_006657678.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X2 [Oryza brachyantha]
Length=235

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             +E+     W+YDLG ++N EQVFG  R  WF+P YS EDL ++ ALHGLE+P +
Sbjct  176  VHEQRNSVSWKYDLGWRKNLEQVFGTKRLLWFLPLYSTEDLHNISALHGLEFPTR  230



>ref|XP_007147347.1| hypothetical protein PHAVU_006G116400g [Phaseolus vulgaris]
 gb|ESW19341.1| hypothetical protein PHAVU_006G116400g [Phaseolus vulgaris]
Length=293

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 40/59 (68%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW YDLG KRNFEQVFG  +  W  P +S+EDL ++PAL G+++P +  +D
Sbjct  234  VHEKKKGVRWMYDLGWKRNFEQVFGTKKALWLFPMFSKEDLDNIPALRGIDFPTRSDVD  292



>dbj|BAK01014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YE+     W YDLG ++N EQVFG  +  WF+P YS EDLR++PA+ GLE+P +
Sbjct  271  VYERKKTCSWEYDLGWRKNLEQVFGTKKLLWFLPMYSAEDLRNIPAIRGLEFPTR  325



>ref|XP_006602749.1| PREDICTED: probable protein S-acyltransferase 14 isoform X3 [Glycine 
max]
Length=287

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  679  QVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  554
            +VFGMD+ YWFIPAYSEED+R +P L GLEYP  P  + QEF
Sbjct  246  EVFGMDKGYWFIPAYSEEDIRRMPVLQGLEYPTTPDFNAQEF  287



>gb|KJB41112.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=285

 Score = 67.0 bits (162),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -1

Query  679  QVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  554
            +VFG D+ YWFIP YS+EDLR +PAL GLEYP KP  D QEF
Sbjct  244  EVFGTDKLYWFIPGYSDEDLRRMPALQGLEYPSKPDFDSQEF  285



>ref|XP_009136132.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=302

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSL-PALHGLEY  587
            AYEK T     Y+LGRK+NFEQVFG D+ YWF+P Y+++D++ + PAL GL++
Sbjct  237  AYEKHTAPNSPYNLGRKQNFEQVFGKDKLYWFVPLYTQDDMKRMPPALRGLDF  289



>gb|EEE67131.1| hypothetical protein OsJ_24176 [Oryza sativa Japonica Group]
Length=303

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             +E+     W+YDLG ++N EQVFG  +  WF+P YS EDL ++ ALHGLE+P +
Sbjct  244  VHERRNSVSWKYDLGWRKNLEQVFGTKKLLWFLPLYSAEDLHNIGALHGLEFPTR  298



>gb|EEC81995.1| hypothetical protein OsI_25930 [Oryza sativa Indica Group]
Length=304

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 38/55 (69%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             +E+     W+YDLG ++N EQVFG  +  WF+P YS EDL ++ ALHGLE+P +
Sbjct  245  VHERRNSVSWKYDLGWRKNLEQVFGTKKLLWFLPLYSAEDLHNIGALHGLEFPTR  299



>gb|KJB49337.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=285

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = -1

Query  679  QVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF  554
            +VFG D++YWFIPAYS+EDLR +PAL GLE+P  P  D +EF
Sbjct  244  EVFGTDKRYWFIPAYSDEDLRRIPALQGLEFPSNPDFDSEEF  285



>gb|EMS59025.1| hypothetical protein TRIUR3_20383 [Triticum urartu]
Length=250

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/55 (44%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
             YE+     W YDLG ++N EQVFG ++  WF+P Y  EDL+++  + GLE+P +
Sbjct  191  VYERKKTCSWEYDLGWRKNLEQVFGTNKLLWFLPMYCTEDLQNIATIQGLEFPTR  245



>ref|XP_010691320.1| PREDICTED: probable protein S-acyltransferase 12 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 38/48 (79%), Gaps = 0/48 (0%)
 Frame = -1

Query  721  SRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLK  578
            S+W+YDLG K+NFEQVFGM +  WF P ++++DL ++P+L G  +P++
Sbjct  258  SKWKYDLGWKQNFEQVFGMKKALWFFPLFAKDDLDNVPSLQGTYFPVR  305



>ref|XP_011082343.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Sesamum 
indicum]
Length=292

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG ++N EQVFG  +  W  P +S+EDL  +PAL G+++P +  I+
Sbjct  233  VHEKKNAVRWKYDLGWRKNIEQVFGTRKALWPFPLFSKEDLEQVPALRGIDFPTRSDIN  291



>ref|XP_011082342.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Sesamum 
indicum]
Length=306

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    RW+YDLG ++N EQVFG  +  W  P +S+EDL  +PAL G+++P +  I+
Sbjct  247  VHEKKNAVRWKYDLGWRKNIEQVFGTRKALWPFPLFSKEDLEQVPALRGIDFPTRSDIN  305



>ref|XP_006598426.1| PREDICTED: uncharacterized protein LOC100817234 [Glycine max]
Length=691

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 35/49 (71%), Gaps = 0/49 (0%)
 Frame = -1

Query  676  VFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF*GALSRKA  530
            VFGMD++ WFIPAYSEED+R +  L GLEYP  P  +  EF G +S+ +
Sbjct  28   VFGMDKRCWFIPAYSEEDIRRMAVLQGLEYPSTPDFNAPEFLGLISQDS  76



>ref|XP_006657677.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X1 [Oryza brachyantha]
Length=248

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/68 (41%), Positives = 38/68 (56%), Gaps = 13/68 (19%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVF-------------GMDRQYWFIPAYSEEDLRSLPAL  602
             +E+     W+YDLG ++N EQVF             G  R  WF+P YS EDL ++ AL
Sbjct  176  VHEQRNSVSWKYDLGWRKNLEQVFFTAFCTLIISLVFGTKRLLWFLPLYSTEDLHNISAL  235

Query  601  HGLEYPLK  578
            HGLE+P +
Sbjct  236  HGLEFPTR  243



>gb|EYU32291.1| hypothetical protein MIMGU_mgv1a010611mg [Erythranthe guttata]
Length=307

 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGID  566
             +EK    +W+YDLG K+N EQVFG ++  W  P  S++DL  +PAL GL +P +  ++
Sbjct  248  VHEKKKGMQWKYDLGWKKNIEQVFGTEKLMWPFPLLSKQDLEKVPALDGLNFPTRSDVN  306



>ref|XP_011469137.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=319

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 41/66 (62%), Gaps = 0/66 (0%)
 Frame = -2

Query  741  HMRR*LFQDGDMTLVEKEILSRCLGWTDSIGLSQLTRKKI*DHYLLSTGLNIH*SLALMV  562
            HMRR   ++G MTLV K IL+RCLG T   G S L +KKI D Y  S  L+IH SL L  
Sbjct  249  HMRRKPLRNGAMTLVGKRILNRCLGQTSYTGSSLLIQKKICDGYQRSRVLSIHLSLNLTP  308

Query  561  RNSREH  544
            + S+ H
Sbjct  309  KTSKHH  314



>emb|CDX82967.1| BnaC01g14170D [Brassica napus]
Length=583

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 33/46 (72%), Gaps = 2/46 (4%)
 Frame = -1

Query  742  AYEKMTLSRWRYDLGRKRNFEQVFGMDRQYWFIPAYSEED--LRSL  611
            AYEK T     Y+LGRK+NFEQVFG D+ YWF+P  SEE   L+SL
Sbjct  538  AYEKHTAPNSPYNLGRKQNFEQVFGKDKLYWFVPFRSEESEPLQSL  583



>emb|CBI22146.3| unnamed protein product [Vitis vinifera]
Length=407

 Score = 53.5 bits (127),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = -1

Query  667  MDRQYWFIPAYSEEDLRSLPALHGLEYPLKPGIDGQEF*GALSRKA  530
            MD+++W IPAYSEED+  +P L GLEYP +P +D  +  G  +R +
Sbjct  1    MDKRFWLIPAYSEEDIIQMPELQGLEYPSRPNLDALQQVGEDTRNS  46



>ref|XP_007052067.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOX96224.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
Length=336

 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 46/76 (61%), Gaps = 4/76 (5%)
 Frame = -2

Query  741  HMRR*LFQDGDMTLVEKEILSRCLGWTDSIGLSQLTRKKI*DHYLLSTGLNIH*SLALMV  562
            HMRR L Q+G MTLV ++ILSRCL  T   G  QLT+ +I D       LNIH SL L+ 
Sbjct  246  HMRRKLHQNGVMTLVGRKILSRCLEQTSDTGSFQLTQMRIYDGCQHFRVLNIHQSLILIP  305

Query  561  RNSRE--HYR--GKLS  526
            R+S+   H R  GK S
Sbjct  306  RSSKNLLHARKFGKFS  321



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1347639082210