BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037D05

Length=738
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase        222   6e-64   Nicotiana sylvestris
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase        222   7e-64   Nicotiana tomentosiformis
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                         222   1e-63   Petunia x hybrida [garden petunia]
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    221   2e-63   Solanum tuberosum [potatoes]
gb|ACF17649.1|  putative cytochrome reductase                           221   2e-63   Capsicum annuum
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                         218   2e-62   Centaurium erythraea
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase        216   8e-62   Solanum lycopersicum
gb|KDO81195.1|  hypothetical protein CISIN_1g005496mg                   210   2e-61   Citrus sinensis [apfelsine]
emb|CDP11509.1|  unnamed protein product                                215   3e-61   Coffea canephora [robusta coffee]
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                       215   3e-61   Ophiorrhiza pumila
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    214   5e-61   Nicotiana sylvestris
ref|XP_010439016.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    213   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010433757.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    213   2e-60   Camelina sativa [gold-of-pleasure]
ref|XP_010448554.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    212   4e-60   Camelina sativa [gold-of-pleasure]
gb|ADI49691.1|  cytochrome P450 reductase                               212   5e-60   Withania somnifera [ashwagandha]
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg             211   8e-60   Citrus clementina [clementine]
gb|KDO81194.1|  hypothetical protein CISIN_1g005496mg                   209   1e-59   Citrus sinensis [apfelsine]
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    210   2e-59   Citrus sinensis [apfelsine]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                   210   2e-59   Citrus sinensis [apfelsine]
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg             210   2e-59   Prunus persica
ref|XP_009137451.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    207   3e-59   Brassica rapa
emb|CDY34288.1|  BnaA01g13910D                                          210   3e-59   Brassica napus [oilseed rape]
ref|XP_009138145.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    209   3e-59   Brassica rapa
emb|CDY03447.1|  BnaC01g16350D                                          209   6e-59   
ref|XP_002867662.1|  hypothetical protein ARALYDRAFT_492391             209   7e-59   
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg                208   8e-59   Erythranthe guttata [common monkey flower]
emb|CDY11017.1|  BnaA03g46760D                                          208   8e-59   Brassica napus [oilseed rape]
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    208   1e-58   Glycine max [soybeans]
ref|XP_006413419.1|  hypothetical protein EUTSA_v10024568mg             208   1e-58   Eutrema salsugineum [saltwater cress]
ref|XP_009137450.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    208   1e-58   Brassica rapa
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    208   1e-58   Prunus mume [ume]
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                   207   2e-58   Morus notabilis
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                       207   2e-58   Azadirachta indica [Indian-lilac]
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                        207   2e-58   Glycine soja [wild soybean]
ref|NP_001236742.1|  NADPH:P450 reductase                               207   2e-58   
emb|CAC27143.1|  NADPH-cytochrome P450 reductase                        195   2e-58   Picea abies
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    207   3e-58   
gb|ACN54323.1|  NADPH:cytochrome P450 reductase                         207   3e-58   Gossypium hirsutum [American cotton]
emb|CDX92639.1|  BnaC07g38970D                                          207   4e-58   
ref|XP_010277516.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    206   5e-58   
emb|CDY34287.1|  BnaA01g13900D                                          206   6e-58   Brassica napus [oilseed rape]
ref|XP_007141274.1|  hypothetical protein PHAVU_008G182200g             206   9e-58   Phaseolus vulgaris [French bean]
gb|AHB33949.1|  cytochrome P450 reductase                               206   9e-58   Santalum album
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g             206   1e-57   Phaseolus vulgaris [French bean]
gb|KJB58863.1|  hypothetical protein B456_009G229300                    206   1e-57   Gossypium raimondii
gb|KJB58865.1|  hypothetical protein B456_009G229300                    205   1e-57   Gossypium raimondii
ref|XP_010277515.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    205   1e-57   Nelumbo nucifera [Indian lotus]
gb|KDP41487.1|  hypothetical protein JCGZ_15894                         205   1e-57   Jatropha curcas
ref|XP_002307336.1|  NADPH-cytochrome P450 oxydoreductase isoform...    205   1e-57   
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase        205   1e-57   Vitis vinifera
ref|NP_194183.1|  NADPH--cytochrome P450 reductase 1                    205   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                    205   1e-57   Medicago truncatula
ref|NP_001190823.1|  NADPH--cytochrome P450 reductase 1                 205   2e-57   Arabidopsis thaliana [mouse-ear cress]
emb|CAA46814.1|  NADPH-ferrihemoprotein reductase                       205   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    204   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_002514049.1|  cytochrome P450, putative                          204   2e-57   Ricinus communis
ref|XP_006386427.1|  hypothetical protein POPTR_0002s10680g             201   3e-57   
gb|ABK92896.1|  unknown                                                 192   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_006285937.1|  hypothetical protein CARUB_v10007449mg             204   4e-57   Capsella rubella
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase        204   4e-57   Glycine max [soybeans]
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase        204   5e-57   Malus domestica [apple tree]
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    203   6e-57   Tarenaya hassleriana [spider flower]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase        203   6e-57   Fragaria vesca subsp. vesca
ref|XP_007018235.1|  P450 reductase 1 isoform 2                         199   9e-57   
gb|KHG05124.1|  NADPH--cytochrome P450 reductase                        203   9e-57   Gossypium arboreum [tree cotton]
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...    202   1e-56
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...    202   1e-56   Vigna radiata var. radiata [golden gram]
ref|XP_009138137.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    202   2e-56   Brassica rapa
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                       202   2e-56   Vicia sativa [spring vetch]
ref|XP_010254555.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    201   3e-56   Nelumbo nucifera [Indian lotus]
ref|XP_009414761.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    201   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase        201   5e-56   Pyrus x bretschneideri [bai li]
ref|XP_010692385.1|  PREDICTED: NADPH--cytochrome P450 reductase        200   7e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                  199   1e-55   Nothapodytes nimmoniana
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    199   3e-55   Cicer arietinum [garbanzo]
ref|XP_007018234.1|  P450 reductase 1 isoform 1                         199   3e-55   
ref|XP_010928663.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    199   4e-55   Elaeis guineensis
dbj|BAJ97446.1|  predicted protein                                      189   5e-55   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010523339.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    191   5e-55   
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3         198   5e-55   
ref|XP_004165700.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    195   6e-55   
gb|AIG15452.1|  NADPH-cytochrome P450 reductase 2                       198   7e-55   Azadirachta indica [Indian-lilac]
gb|KJB14707.1|  hypothetical protein B456_002G138900                    197   8e-55   Gossypium raimondii
ref|XP_010046982.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    197   9e-55   Eucalyptus grandis [rose gum]
gb|ACP43317.1|  NADPH cytochrome P450 reductase                         186   9e-55   Citrus maxima [buntan]
ref|XP_010523336.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    191   2e-54   
ref|XP_010523337.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    191   2e-54   
ref|XP_011015338.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    197   2e-54   Populus euphratica
ref|XP_009385909.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    197   2e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006372089.1|  hypothetical protein POPTR_0018s09980g             193   2e-54   
gb|AEA86315.1|  NADPH-cytochrome P450 reductase                         183   2e-54   Solanum nigrum
ref|NP_001131393.1|  uncharacterized protein LOC100192720               186   4e-54   
ref|XP_008781895.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    196   4e-54   Phoenix dactylifera
gb|AAT76449.1|  NADPH:cytochrome P450 reductase                         196   5e-54   Taxus cuspidata [ichii]
gb|AAX59902.1|  cytochrome P450 reductase                               195   5e-54   Taxus wallichiana var. chinensis [Chinese yew]
gb|AEW43314.1|  NADPH cytochrome P450 reductase                         195   7e-54   Picrorhiza kurrooa
ref|XP_004146317.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    195   7e-54   Cucumis sativus [cucumbers]
ref|XP_010447753.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    190   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_008453604.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      195   8e-54   Cucumis melo [Oriental melon]
ref|XP_002462826.1|  hypothetical protein SORBIDRAFT_02g032640          195   8e-54   Sorghum bicolor [broomcorn]
ref|XP_010048643.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    195   8e-54   Eucalyptus grandis [rose gum]
gb|ACF35280.1|  cytochrome P450 reductase-like protein                  195   9e-54   Nothapodytes nimmoniana
ref|XP_010523335.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    191   9e-54   
ref|XP_011069915.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    194   1e-53   Sesamum indicum [beniseed]
gb|KJB53794.1|  hypothetical protein B456_009G005600                    194   1e-53   Gossypium raimondii
gb|KJB53797.1|  hypothetical protein B456_009G005600                    194   1e-53   Gossypium raimondii
emb|CAC83301.1|  cytochrome P450 reductase                              194   1e-53   Triticum aestivum [Canadian hard winter wheat]
gb|AGL46979.1|  cytochrome P450 reductase                               194   1e-53   Salvia miltiorrhiza [Chinese salvia]
ref|XP_011043963.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    194   2e-53   Populus euphratica
gb|AIL29328.1|  cytochrome P450 reductase                               194   2e-53   Pinus contorta
ref|XP_010093854.1|  NADPH--cytochrome P450 reductase                   194   2e-53   Morus notabilis
gb|AAK15261.1|AF302498_1  NADPH-cytochrome P450 oxydoreductase is...    194   2e-53   Populus trichocarpa x Populus deltoides
gb|KHG09184.1|  NADPH--cytochrome P450 reductase                        194   2e-53   Gossypium arboreum [tree cotton]
gb|AAK56276.1|AF367288_1  AT4g30210/F9N11_60                            187   2e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AIC73829.1|  cytochrome P450 reductase                               193   2e-53   Panax ginseng [Asiatic ginseng]
gb|ACN54324.1|  NADPH:cytochrome P450 reductase                         194   2e-53   Gossypium hirsutum [American cotton]
ref|NP_001063914.1|  Os09g0558900                                       194   2e-53   
gb|EEE61817.1|  hypothetical protein OsJ_16444                          193   2e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010523334.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    191   2e-53   
emb|CAN77401.1|  hypothetical protein VITISV_027794                     194   3e-53   Vitis vinifera
ref|XP_010913661.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    193   3e-53   Elaeis guineensis
ref|NP_001136741.1|  uncharacterized protein LOC100216882               184   3e-53   
emb|CBI17838.3|  unnamed protein product                                193   3e-53   Vitis vinifera
emb|CAE01547.2|  OSJNBb0022F16.2                                        193   3e-53   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002270732.2|  PREDICTED: NADPH--cytochrome P450 reductase        193   3e-53   Vitis vinifera
ref|XP_011079296.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    193   3e-53   Sesamum indicum [beniseed]
ref|XP_010525727.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      193   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_006381796.1|  putative NADPH-cytochrome P450 reductase fam...    193   4e-53   Populus trichocarpa [western balsam poplar]
ref|XP_006661531.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   5e-53   
ref|XP_004148333.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   6e-53   Cucumis sativus [cucumbers]
ref|XP_004168364.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   7e-53   
gb|EMT14573.1|  NADPH--cytochrome P450 reductase                        192   7e-53   
dbj|BAG68945.1|  cytochrome P450 reductase                              192   8e-53   Lotus japonicus
ref|XP_002324469.1|  putative NADPH-cytochrome P450 reductase fam...    192   9e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011010331.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   9e-53   Populus euphratica
ref|XP_007014268.1|  P450 reductase 2                                   192   9e-53   
emb|CCO62220.1|  putative cytochrome P450 reductase                     192   1e-52   Actaea racemosa
gb|EMS66177.1|  NADPH--cytochrome P450 reductase                        191   1e-52   Triticum urartu
gb|EAZ10065.1|  hypothetical protein OsI_32371                          192   1e-52   Oryza sativa Indica Group [Indian rice]
emb|CAA89837.3|  NADPH-cytochrome P450 reductase                        192   1e-52   Pseudotsuga menziesii
gb|AAS00459.1|  NADPH:cytochrome P450-reductase                         191   1e-52   Hypericum androsaemum
gb|KDO43876.1|  hypothetical protein CISIN_1g005072mg                   189   1e-52   Citrus sinensis [apfelsine]
ref|XP_008391625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    192   1e-52   Malus domestica [apple tree]
ref|XP_008653023.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    191   1e-52   Zea mays [maize]
ref|XP_009382841.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    191   1e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006653834.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    190   2e-52   Oryza brachyantha
ref|XP_004507858.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    191   2e-52   Cicer arietinum [garbanzo]
gb|AHA50098.1|  CYP450 reductase                                        191   2e-52   Panax ginseng [Asiatic ginseng]
ref|XP_010914150.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    191   2e-52   Elaeis guineensis
gb|KJB22140.1|  hypothetical protein B456_004G0316002                   186   3e-52   Gossypium raimondii
gb|AGC92176.1|  cytochrome P450 oxidoreductase                          191   3e-52   Ocimum basilicum [basil]
ref|XP_006453369.1|  hypothetical protein CICLE_v10007535mg             191   3e-52   
ref|XP_009795589.1|  PREDICTED: NADPH--cytochrome P450 reductase        191   3e-52   Nicotiana sylvestris
ref|XP_006453370.1|  hypothetical protein CICLE_v10007535mg             191   3e-52   
gb|AFW59699.1|  hypothetical protein ZEAMMB73_961001                    187   4e-52   
emb|CDP02981.1|  unnamed protein product                                190   4e-52   Coffea canephora [robusta coffee]
ref|XP_010265447.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    190   4e-52   Nelumbo nucifera [Indian lotus]
ref|XP_009384791.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    190   4e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004957625.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    190   4e-52   Setaria italica
ref|XP_009607226.1|  PREDICTED: NADPH--cytochrome P450 reductase        190   5e-52   Nicotiana tomentosiformis
dbj|BAJ41269.1|  NADPH-P450 reductase 2                                 190   5e-52   Zingiber officinale [ginger]
emb|CDY14183.1|  BnaA08g13140D                                          190   5e-52   Brassica napus [oilseed rape]
gb|EEE70211.1|  hypothetical protein OsJ_30318                          190   6e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CDY28169.1|  BnaA01g06800D                                          189   6e-52   Brassica napus [oilseed rape]
gb|KDO43875.1|  hypothetical protein CISIN_1g005072mg                   188   6e-52   Citrus sinensis [apfelsine]
ref|XP_009108997.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      189   6e-52   Brassica rapa
gb|KDO43874.1|  hypothetical protein CISIN_1g005072mg                   188   6e-52   Citrus sinensis [apfelsine]
ref|XP_007227446.1|  hypothetical protein PRUPE_ppa002142mg             189   7e-52   Prunus persica
ref|XP_004296434.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      189   7e-52   Fragaria vesca subsp. vesca
emb|CAA81210.1|  NADPH-ferrihemoprotein reductase                       187   7e-52   Helianthus tuberosus [Jerusalem artichoke]
ref|XP_002444097.1|  hypothetical protein SORBIDRAFT_07g007640          189   7e-52   Sorghum bicolor [broomcorn]
ref|XP_008223694.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      189   7e-52   Prunus mume [ume]
ref|XP_010438203.1|  PREDICTED: NADPH--cytochrome P450 reductase 2      189   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_010447751.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    189   7e-52   Camelina sativa [gold-of-pleasure]
ref|XP_003578634.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    189   9e-52   Brachypodium distachyon [annual false brome]
gb|AAZ39649.1|  cytochrome P450 NADPH-reductase                         189   1e-51   Petunia x hybrida [garden petunia]
ref|XP_010688489.1|  PREDICTED: NADPH--cytochrome P450 reductase        189   1e-51   Beta vulgaris subsp. vulgaris [field beet]
gb|AGX85599.1|  NADPH:cytochrome P450 reductase                         189   1e-51   Scoparia dulcis [escobilla]
ref|XP_009130253.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    189   1e-51   Brassica rapa
ref|XP_008789667.1|  PREDICTED: NADPH--cytochrome P450 reductase        189   1e-51   Phoenix dactylifera
ref|XP_008383105.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    189   1e-51   Malus domestica [apple tree]
ref|XP_008383106.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    189   1e-51   Malus domestica [apple tree]
gb|ADC94831.1|  cytochrome P450 reductase                               189   1e-51   Perilla frutescens [beefsteak-mint]
gb|KDO43868.1|  hypothetical protein CISIN_1g005072mg                   189   1e-51   Citrus sinensis [apfelsine]
gb|KDO43871.1|  hypothetical protein CISIN_1g005072mg                   188   2e-51   Citrus sinensis [apfelsine]
dbj|BAD05443.1|  putative cytochrome P450 reductase                     187   2e-51   Oryza sativa Japonica Group [Japonica rice]
gb|KDO43870.1|  hypothetical protein CISIN_1g005072mg                   188   2e-51   Citrus sinensis [apfelsine]
gb|KDO43869.1|  hypothetical protein CISIN_1g005072mg                   188   2e-51   Citrus sinensis [apfelsine]
emb|CDX68634.1|  BnaC01g08190D                                          188   2e-51   
ref|XP_006845640.1|  hypothetical protein AMTR_s00019p00222550          188   2e-51   
ref|XP_006283224.1|  hypothetical protein CARUB_v10004254mg             188   2e-51   Capsella rubella
emb|CDY03543.1|  BnaC03g68020D                                          188   2e-51   
ref|XP_010548619.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    188   2e-51   Tarenaya hassleriana [spider flower]
ref|NP_001159331.1|  uncharacterized protein LOC100304425               188   2e-51   Zea mays [maize]
ref|XP_002447240.1|  hypothetical protein SORBIDRAFT_06g031110          188   2e-51   Sorghum bicolor [broomcorn]
ref|XP_010259920.1|  PREDICTED: NADPH--cytochrome P450 reductase        188   3e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010433014.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    187   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_003579401.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    187   3e-51   Brachypodium distachyon [annual false brome]
ref|XP_003541616.1|  PREDICTED: NADPH--cytochrome P450 reductase        187   3e-51   Glycine max [soybeans]
ref|NP_001061346.1|  Os08g0243500                                       187   3e-51   
gb|KHN22700.1|  NADPH--cytochrome P450 reductase                        187   4e-51   Glycine soja [wild soybean]
gb|EEE68301.1|  hypothetical protein OsJ_26563                          187   5e-51   Oryza sativa Japonica Group [Japonica rice]
emb|CDY51656.1|  BnaAnng10960D                                          187   5e-51   Brassica napus [oilseed rape]
gb|AHB33950.1|  cytochrome P450 reductase                               187   6e-51   Santalum album
ref|XP_006659239.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    185   6e-51   
ref|XP_006474186.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    187   6e-51   Citrus sinensis [apfelsine]
ref|XP_006412733.1|  hypothetical protein EUTSA_v10024546mg             187   6e-51   Eutrema salsugineum [saltwater cress]
dbj|BAJ33878.1|  unnamed protein product                                187   6e-51   Eutrema halophilum
ref|XP_006474185.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    187   6e-51   Citrus sinensis [apfelsine]
emb|CBX24555.1|  NADPH:cytochrome P450 reductase                        187   7e-51   Salvia miltiorrhiza [Chinese salvia]
emb|CDX72222.1|  BnaC07g42440D                                          186   7e-51   
gb|AAC05022.1|  NADPH:ferrihemoprotein oxidoreductase                   186   7e-51   Eschscholzia californica
gb|ABB88839.2|  NADPH cytochrome P450 reductase                         186   8e-51   Stevia rebaudiana
ref|XP_004960247.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    186   9e-51   Setaria italica
gb|EYU42400.1|  hypothetical protein MIMGU_mgv1a002170mg                186   9e-51   Erythranthe guttata [common monkey flower]
ref|XP_004242931.1|  PREDICTED: NADPH--cytochrome P450 reductase        186   1e-50   Solanum lycopersicum
ref|XP_003610110.1|  NADPH cytochrome P450 reductase                    183   1e-50   
gb|ABL09938.1|  cytochrome P450 reductase                               186   1e-50   Artemisia annua [sweet Annie]
gb|KHN17598.1|  NADPH--cytochrome P450 reductase                        186   1e-50   Glycine soja [wild soybean]
ref|XP_008661364.1|  PREDICTED: uncharacterized protein LOC100192...    186   1e-50   
ref|XP_003549436.1|  PREDICTED: NADPH--cytochrome P450 reductase        186   1e-50   Glycine max [soybeans]
gb|AAC09468.2|  putative NADPH-cytochrome P450 reductase                186   2e-50   Pisum sativum [garden pea]
gb|ABM88789.1|  cytochrome P450 reductase                               186   2e-50   Artemisia annua [sweet Annie]
gb|ABI98819.1|  cytochrome P450 reductase                               186   2e-50   Artemisia annua [sweet Annie]
gb|ABC47946.1|  cytochrome P450 reductase                               186   2e-50   Artemisia annua [sweet Annie]
emb|CAA46815.1|  NADPH-ferrihemoprotein reductase                       186   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAC05021.1|  NADPH:ferrihemoprotein oxidoreductase                   185   2e-50   Papaver somniferum
ref|NP_849472.2|  NADPH--cytochrome P450 reductase 2                    186   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194750.1|  NADPH--cytochrome P450 reductase 2                    185   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154761.1|  hypothetical protein PHAVU_003G145400g             185   2e-50   Phaseolus vulgaris [French bean]
ref|XP_010929254.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    185   2e-50   Elaeis guineensis
ref|XP_008667834.1|  PREDICTED: uncharacterized protein LOC100279...    185   2e-50   
ref|XP_008667833.1|  PREDICTED: uncharacterized protein LOC100279...    185   3e-50   Zea mays [maize]
ref|XP_009408053.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    184   4e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS66345.1|  hypothetical protein M569_08425                         184   4e-50   Genlisea aurea
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    184   5e-50   Populus euphratica
ref|XP_002869386.1|  hypothetical protein ARALYDRAFT_913457             184   6e-50   Arabidopsis lyrata subsp. lyrata
gb|AFO64618.1|  cytochrome P450 reductase                               184   6e-50   Artemisia annua [sweet Annie]
gb|KFK29577.1|  nadph-ferrihemoprotein reductase                        184   7e-50   Arabis alpina [alpine rockcress]
gb|AAB97736.1|  NADPH cytochrome P450 reductase                         183   8e-50   Petroselinum crispum
gb|AAG17471.1|AF123610_10  NADPH-cytochrome P450 reductase              183   9e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008676669.1|  PREDICTED: uncharacterized protein LOC100216...    183   9e-50   
emb|CAA81209.1|  NADPH-ferrihemoprotein reductase                       182   1e-49   Helianthus tuberosus [Jerusalem artichoke]
gb|ACG27711.1|  NADPH--cytochrome P450 reductase                        183   1e-49   Zea mays [maize]
ref|XP_003610109.1|  NADPH cytochrome P450 reductase                    183   1e-49   Medicago truncatula
gb|AGO03799.1|  cytochrome P450-like protein                            183   1e-49   Tanacetum cinerariifolium [pyrethrum]
gb|KDP36395.1|  hypothetical protein JCGZ_08664                         183   1e-49   Jatropha curcas
ref|XP_004973052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    183   1e-49   Setaria italica
gb|EPS73891.1|  hypothetical protein M569_00858                         183   1e-49   Genlisea aurea
gb|KHG21257.1|  NADPH--cytochrome P450 reductase                        183   2e-49   Gossypium arboreum [tree cotton]
ref|XP_010234513.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    183   2e-49   Brachypodium distachyon [annual false brome]
gb|AAS90127.1|  NADPH cytochrome P450 reductase                         182   2e-49   Ammi majus [ameo mayor]
gb|EPS67504.1|  hypothetical protein M569_07270                         183   2e-49   Genlisea aurea
gb|EYU20907.1|  hypothetical protein MIMGU_mgv1a002097mg                182   2e-49   Erythranthe guttata [common monkey flower]
sp|Q05001.1|NCPR_CATRO  RecName: Full=NADPH--cytochrome P450 redu...    182   3e-49   Catharanthus roseus [chatas]
gb|AAB97737.1|  NADPH cytochrome P450 reductase                         182   3e-49   Petroselinum crispum
gb|ADG29353.1|  cytochrome P450 reductase                               182   4e-49   Withania somnifera [ashwagandha]
dbj|BAJ99370.1|  predicted protein                                      181   4e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAQ37789.1|  NADPH:cytochrome P450 reductase                        181   4e-49   Plectranthus scutellarioides
gb|AHM95445.1|  cytochrome P450 reductase                               181   9e-49   Matricaria chamomilla var. recutita [German chamomile]
ref|XP_002984697.1|  hypothetical protein SELMODRAFT_234596             179   2e-48   
gb|AIO11759.1|  cytochrome p450 reductase                               179   3e-48   Croton stellatopilosus
ref|XP_002978784.1|  hypothetical protein SELMODRAFT_152770             178   5e-48   
dbj|BAJ41268.1|  NADPH-P450 reductase 1                                 175   6e-47   Zingiber officinale [ginger]
ref|XP_001770150.1|  predicted protein                                  171   1e-45   
ref|XP_010526342.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    171   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_001785882.1|  predicted protein                                  171   3e-45   
ref|XP_008451695.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    171   3e-45   
gb|EMS53484.1|  NADPH--cytochrome P450 reductase                        169   4e-45   Triticum urartu
gb|EMT19472.1|  NADPH--cytochrome P450 reductase                        169   5e-45   
ref|XP_001779575.1|  predicted protein                                  170   6e-45   
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                   165   2e-43   Citrus sinensis [apfelsine]
gb|KJB14708.1|  hypothetical protein B456_002G138900                    158   6e-41   Gossypium raimondii
ref|XP_001758838.1|  predicted protein                                  157   2e-40   
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    155   1e-39   
ref|XP_008808352.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    147   1e-39   
gb|KCW80968.1|  hypothetical protein EUGRSUZ_C02330                     154   2e-39   Eucalyptus grandis [rose gum]
gb|KJB22141.1|  hypothetical protein B456_004G0316002                   150   4e-39   Gossypium raimondii
ref|XP_008680517.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    144   6e-39   
ref|XP_002986144.1|  hypothetical protein SELMODRAFT_157822             151   2e-38   
ref|XP_004960246.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    149   1e-37   
ref|XP_002534464.1|  cytochrome P450, putative                          149   2e-37   
ref|XP_004507857.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    148   4e-37   
ref|XP_002984958.1|  hypothetical protein SELMODRAFT_181373             147   5e-37   
gb|AFW62956.1|  hypothetical protein ZEAMMB73_744602                    144   2e-36   
gb|ACF35282.1|  cytochrome P450 reductase-like protein                  141   7e-35   
ref|XP_005846436.1|  hypothetical protein CHLNCDRAFT_36035              137   2e-33   
ref|XP_002960044.1|  hypothetical protein SELMODRAFT_401997             130   4e-31   
gb|ABR25415.1|  NADPH-cytochrome p450 reductase                         119   2e-30   
gb|KDD72489.1|  hypothetical protein H632_c3282p1                       120   3e-30   
ref|XP_007680859.1|  hypothetical protein BAUCODRAFT_28100              128   5e-30   
gb|KIY99765.1|  hypothetical protein MNEG_8195                          127   8e-30   
ref|XP_002953937.1|  hypothetical protein VOLCADRAFT_76078              126   2e-29   
ref|XP_009051974.1|  hypothetical protein LOTGIDRAFT_187717             125   6e-29   
emb|CDW58665.1|  NAD binding 1 domain containing protein                116   2e-28   
ref|XP_001690130.1|  NADPH-cytochrome P450 reductase                    122   3e-28   
gb|EPY30731.1|  NADPH-ferrihemoprotein reductase                        122   6e-28   
gb|EPY26135.1|  NADPH-ferrihemoprotein reductase                        122   7e-28   
ref|XP_011427038.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    120   2e-27   
ref|XP_002108516.1|  hypothetical protein TRIADDRAFT_63169              120   2e-27   
gb|ACF83106.1|  unknown                                                 111   2e-27   
emb|CEP08857.1|  hypothetical protein                                   120   2e-27   
gb|KJE97834.1|  NADPH-cytochrome P450 reductase, variant                119   6e-27   
dbj|BAN82201.1|  hypothetical protein                                   119   6e-27   
ref|XP_004343008.1|  NADPH-cytochrome P450 reductase                    119   9e-27   
emb|CCD52117.1|  hypothetical protein BofuT4_P082760.1                  111   1e-26   
gb|EFA83496.1|  NADPH-cytochrome-P450 oxidoreductase                    119   1e-26   
gb|ELU16857.1|  hypothetical protein CAPTEDRAFT_153661                  116   1e-26   
ref|XP_007931123.1|  hypothetical protein MYCFIDRAFT_157570             118   1e-26   
ref|XP_007433824.1|  PREDICTED: NADPH--cytochrome P450 reductase        118   1e-26   
ref|WP_043986383.1|  FAD-binding protein                                117   2e-26   
ref|XP_001631497.1|  predicted protein                                  118   2e-26   
ref|WP_043391935.1|  FAD-binding protein                                117   2e-26   
ref|WP_006896602.1|  putative nitrate/sulfite reductase                 119   2e-26   
gb|EPY24868.1|  NADPH-ferrihemoprotein reductase                        115   2e-26   
ref|XP_009658187.1|  NADPH-cytochrome P450 reductase                    117   2e-26   
gb|KIN00315.1|  hypothetical protein OIDMADRAFT_123965                  117   3e-26   
ref|XP_008186078.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    114   6e-26   
gb|EKC21191.1|  NADPH--cytochrome P450 reductase                        117   8e-26   
gb|ELT87080.1|  hypothetical protein CAPTEDRAFT_173459                  116   8e-26   
ref|XP_003074517.1|  NADPH-cytochrome P-450 reductase (ISS)             115   9e-26   
ref|XP_001415936.1|  predicted protein                                  115   1e-25   
ref|XP_009022160.1|  hypothetical protein HELRODRAFT_113572             115   1e-25   
gb|ACE86176.1|  Molybdopterin oxidoreductase Fe4S4 domain family        117   1e-25   
emb|CEF99664.1|  Flavoprotein pyridine nucleotide cytochrome redu...    116   1e-25   
emb|CEF96794.1|  Flavoprotein pyridine nucleotide cytochrome redu...    115   1e-25   
prf||1103184A  reductase,NADPH cytochrome P450                          109   1e-25
ref|WP_041552449.1|  reductase                                          117   1e-25   
ref|XP_002130153.1|  PREDICTED: NADPH--cytochrome P450 reductase        115   1e-25   
ref|XP_003082028.1|  NADPH-ferrihemoprotein reductase (ISS)             116   1e-25   
emb|CEI90083.1|  Putative NADPH--cytochrome P450 reductase              115   1e-25   
gb|ETE65154.1|  NADPH-cytochrome reductase                              115   1e-25   
emb|CEG74525.1|  Putative NADPH--cytochrome P450 reductase              115   1e-25   
emb|CBY19304.1|  unnamed protein product                                113   1e-25   
gb|EPY33847.1|  NADPH-ferrihemoprotein reductase                        115   2e-25   
dbj|GAD97695.1|  NADPH cytochrome P450 reductase                        115   2e-25   
ref|XP_008120878.1|  PREDICTED: NADPH--cytochrome P450 reductase        115   2e-25   
ref|WP_007922873.1|  NADPH--cytochrome P450 reductase                   115   3e-25   
ref|XP_010891864.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    113   3e-25   
ref|XP_007590680.1|  NADPH-cytochrome P450 reductase                    114   3e-25   
gb|EIE89541.1|  hypothetical protein RO3G_14252                         114   4e-25   
emb|CCF32060.1|  NADPH-cytochrome P450 reductase                        114   4e-25   
ref|XP_002612108.1|  hypothetical protein BRAFLDRAFT_288748             114   4e-25   
emb|CEJ03087.1|  Putative NADPH--cytochrome P450 reductase              114   4e-25   
emb|CCD15772.1|  unnamed protein product                                109   5e-25   
gb|KEY74237.1|  hypothetical protein S7711_00395                        114   5e-25   
ref|XP_006640872.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    114   5e-25   
ref|XP_003378184.1|  NADPH--cytochrome P450 reductase                   115   5e-25   
gb|EUA71951.1|  oxidoreductase NAD-binding domain protein               107   5e-25   
gb|KFA72831.1|  hypothetical protein S40288_08553                       114   5e-25   
ref|XP_009218896.1|  NADPH-cytochrome P450 reductase                    114   5e-25   
ref|XP_010852620.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    114   5e-25   
sp|Q3SYT8.3|NCPR_BOVIN  RecName: Full=NADPH--cytochrome P450 redu...    114   5e-25   
ref|XP_006962366.1|  NADPH cytochrome P450 oxidoreductase               114   5e-25   
ref|NP_001030467.1|  NADPH--cytochrome P450 reductase                   114   6e-25   
gb|KFA61935.1|  hypothetical protein S40285_02840                       114   6e-25   
ref|XP_010891863.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    113   6e-25   
ref|XP_001945312.1|  PREDICTED: NADPH--cytochrome P450 reductase        113   7e-25   
gb|EPS33038.1|  hypothetical protein PDE_07999                          113   7e-25   
ref|WP_040518010.1|  reductase                                          114   7e-25   
gb|EGD55572.1|  molybdopterin oxidoreductase                            114   7e-25   
dbj|BAF49701.1|  NADPH-P450 reductase                                   113   7e-25   
gb|KFY32966.1|  hypothetical protein V495_08561                         114   7e-25   
ref|NP_001078953.1|  P450 (cytochrome) oxidoreductase                   113   7e-25   
gb|ENH85424.1|  nadph-cytochrome p450 reductase                         113   8e-25   
ref|XP_007278117.1|  cytochrome p450 oxidoreductase                     113   8e-25   
gb|EKG13469.1|  Flavodoxin                                              113   9e-25   
ref|XP_009849280.1|  NADPH-cytochrome P450 reductase                    113   1e-24   
ref|XP_007776209.1|  NADPH-cytochrome P450 reductase                    113   1e-24   
ref|XP_964443.1|  NADPH-cytochrome P450 reductase                       113   1e-24   
ref|XP_007104040.1|  PREDICTED: NADPH--cytochrome P450 reductase        113   1e-24   
ref|XP_007186623.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    113   1e-24   
gb|EKV15852.1|  NADPH--cytochrome P450 reductase                        113   1e-24   
gb|ACG28940.1|  NADPH--cytochrome P450 reductase                        112   1e-24   
emb|CAD84764.1|  Sulfite reductase flavoprotein subunit                 112   1e-24   
ref|XP_808628.1|  P450 reductase                                        108   1e-24   
ref|WP_041356566.1|  sulfite reductase [NADPH] flavoprotein alpha...    112   1e-24   
ref|XP_008947241.1|  PREDICTED: NADPH--cytochrome P450 reductase        111   1e-24   
gb|KFQ23534.1|  NADPH--cytochrome P450 reductase                        111   1e-24   
ref|XP_008493329.1|  PREDICTED: NADPH--cytochrome P450 reductase        112   1e-24   
ref|XP_005109645.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    112   1e-24   
ref|XP_003715306.1|  NADPH-cytochrome P450 reductase, variant           112   1e-24   
ref|XP_006201451.1|  PREDICTED: NADPH--cytochrome P450 reductase        112   2e-24   
gb|KEQ71821.1|  cytochrome P450 reductase 1                             112   2e-24   
gb|EKC32196.1|  Methionine synthase reductase, mitochondrial            110   2e-24   
dbj|GAN10969.1|  NADPh-cytochrome p450 reductase protein                112   2e-24   
gb|ACS36160.1|  NADPH-cytochrome P450 oxidoreductase                    111   2e-24   
gb|KEQ60063.1|  cytochrome P450 reductase 1                             112   2e-24   
gb|EPB87224.1|  hypothetical protein HMPREF1544_05946                   112   2e-24   
ref|XP_001558194.1|  hypothetical protein BC1G_03226                    112   2e-24   
ref|XP_004688336.1|  PREDICTED: NADPH--cytochrome P450 reductase        112   2e-24   
gb|EQB57087.1|  hypothetical protein CGLO_02825                         112   2e-24   
gb|EHK43307.1|  hypothetical protein TRIATDRAFT_33220                   112   3e-24   
ref|XP_004326617.1|  PREDICTED: NADPH--cytochrome P450 reductase        112   3e-24   
emb|CDQ65983.1|  unnamed protein product                                112   3e-24   
ref|XP_005172735.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    111   3e-24   
ref|XP_007733055.1|  NADPH-ferrihemoprotein reductase                   112   3e-24   
gb|EHK22188.1|  hypothetical protein TRIVIDRAFT_71556                   111   3e-24   
gb|KEQ88142.1|  cytochrome P450 reductase 1                             111   3e-24   
ref|XP_011115941.1|  hypothetical protein H072_10480                    111   3e-24   
ref|XP_646400.1|  NADPH-cytochrome-P450 oxidoreductase                  111   3e-24   
ref|NP_001030154.1|  NADPH--cytochrome P450 reductase                   111   3e-24   
ref|WP_020475376.1|  hypothetical protein                               110   4e-24   
ref|XP_001821060.1|  NADPH--cytochrome P450 reductase                   111   4e-24   
ref|XP_002836851.1|  hypothetical protein                               111   4e-24   
ref|WP_017207328.1|  FAD-binding protein                                110   4e-24   
ref|WP_005088242.1|  MULTISPECIES: FAD-binding protein                  110   4e-24   
ref|WP_025239425.1|  FAD-binding protein                                110   4e-24   
ref|WP_005079611.1|  MULTISPECIES: FAD-binding protein                  110   4e-24   
ref|WP_005093337.1|  FAD-binding protein                                110   4e-24   
ref|XP_005645698.1|  NADPH-cytochrome P450 reductase                    111   4e-24   
ref|XP_006693773.1|  NADPH-cytochrome P450 reductase-like protein       111   4e-24   
gb|KFU95881.1|  NADPH--cytochrome P450 reductase                        111   5e-24   
ref|XP_003727585.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    104   5e-24   
ref|XP_003283983.1|  NADPH-cytochrome-P450 oxidoreductase               110   5e-24   
ref|XP_010004325.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    111   5e-24   
ref|XP_002484207.1|  NADPH cytochrome P450 reductase (CprA), puta...    111   5e-24   
ref|XP_010004324.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    110   5e-24   
emb|CCE28101.1|  probable NCP1-NADPH-cytochrome P450 reductase          110   5e-24   
gb|ABQ22774.1|  NADPH-cytochrome P450 reductase-like protein            103   6e-24   
sp|Q00141.2|NCPR_ASPNG  RecName: Full=NADPH--cytochrome P450 redu...    110   6e-24   
gb|KGO39386.1|  Oxidoreductase FAD/NAD(P)-binding                       110   7e-24   
gb|KDN70201.1|  putative FAD binding domain-containing protein          110   7e-24   
ref|WP_016342621.1|  putative NADPH--sulfite reductase flavoprote...    109   7e-24   
gb|KER00200.1|  hypothetical protein AUEXF2481DRAFT_34398               110   7e-24   
ref|XP_001420330.1|  predicted protein                                  108   7e-24   
ref|XP_007587627.1|  putative nadph-cytochrome p450 reductase pro...    110   7e-24   
ref|WP_005058322.1|  FAD-binding protein                                109   7e-24   
emb|CAA81550.1|  NADPH cytochrome P450 oxidoreductase                   110   7e-24   
ref|XP_006088353.1|  PREDICTED: NADPH--cytochrome P450 reductase        110   7e-24   
ref|XP_008139684.1|  PREDICTED: NADPH--cytochrome P450 reductase        110   8e-24   
gb|AAX37331.1|  NADPH-cytochrome P450 oxidoreductase                    110   8e-24   
gb|EMF09667.1|  NADPH cytochrome P450 oxidoreductase                    110   8e-24   
ref|XP_006918626.1|  PREDICTED: NADPH--cytochrome P450 reductase        110   8e-24   
ref|XP_002902687.1|  NADPH-cytochrome P450 reductase, putative          110   8e-24   
ref|XP_005879217.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    110   8e-24   
ref|XP_005879216.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    110   8e-24   
gb|EPQ15742.1|  NADPH--cytochrome P450 reductase                        110   9e-24   
gb|EFA80409.1|  NADPH-cytochrome-P450 oxidoreductase                    110   9e-24   
gb|ELK06871.1|  NADPH--cytochrome P450 reductase                        110   9e-24   
gb|EME40620.1|  hypothetical protein DOTSEDRAFT_74237                   110   9e-24   
gb|KEZ41267.1|  NADPH--cytochrome P450 reductase                        110   1e-23   
gb|ESZ97734.1|  NADPH-cytochrome P450 reductase                         110   1e-23   
ref|NP_001123431.1|  NADPH--cytochrome P450 reductase                   110   1e-23   
gb|EFQ30590.1|  FAD binding domain-containing protein                   110   1e-23   
gb|KIV99574.1|  NADPH-cytochrome P450 reductase                         110   1e-23   
sp|P04175.2|NCPR_PIG  RecName: Full=NADPH--cytochrome P450 reduct...    110   1e-23   
ref|XP_007518012.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    110   1e-23   
ref|XP_628906.1|  NADPH-cytochrome-P450 oxidoreductase                  110   1e-23   
gb|KIL92537.1|  nadph-cytochrome p450 reductase                         110   1e-23   
ref|XP_007639858.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    103   1e-23   
gb|KFZ10954.1|  hypothetical protein V501_04969                         110   1e-23   
gb|KFY70284.1|  hypothetical protein V499_09298                         110   1e-23   
gb|AAG23833.1|AF290425_1  NADPH cytochrome P450 oxidoreductase is...    110   1e-23   
gb|KFX87390.1|  hypothetical protein V490_08289                         110   1e-23   
ref|XP_005495092.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   1e-23   
ref|XP_004911688.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    109   1e-23   
ref|XP_010970634.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...    109   1e-23   
ref|WP_038542131.1|  sulfite reductase [NADPH] flavoprotein alpha...    107   1e-23   
gb|KGO76390.1|  NADPH-cytochrome p450 reductase, FAD-binding, alp...    109   1e-23   
ref|XP_007468859.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   1e-23   
ref|XP_004268859.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    109   1e-23   
ref|XP_003660497.1|  hypothetical protein MYCTH_2314176                 109   1e-23   
ref|XP_002933864.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    109   1e-23   
ref|XP_002150062.1|  NADPH cytochrome P450 reductase (CprA), puta...    109   1e-23   
ref|WP_017023910.1|  sulfite reductase subunit alpha                    109   1e-23   
ref|XP_010703415.1|  methionine synthase reductase, mitochondrial...    110   1e-23   
ref|XP_001569114.2|  methionine synthase reductase, mitochondrial...    110   1e-23   
ref|XP_011369842.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   2e-23   
gb|ADM18969.1|  NADPH-cytochrome P450 oxidoreductase                    109   2e-23   
gb|KFQ49850.1|  NADPH--cytochrome P450 reductase                        109   2e-23   
ref|NP_001182725.1|  NADPH--cytochrome P450 reductase                   109   2e-23   
ref|XP_009477365.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   2e-23   
ref|XP_005454398.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    109   2e-23   
ref|XP_004350080.1|  NADPH-cytochrome-P450 oxidoreductase               109   2e-23   
ref|XP_003449358.1|  PREDICTED: NADPH--cytochrome P450 reductase-...    109   2e-23   
gb|EEX38010.1|  sulfite reductase [NADPH] flavoprotein alpha-comp...    109   2e-23   
ref|XP_009558457.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   2e-23   
dbj|GAA83054.1|  NADPH cytochrome P450 oxidoreductase                   109   2e-23   
ref|XP_005425451.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   2e-23   
gb|KFO75627.1|  NADPH--cytochrome P450 reductase                        109   2e-23   
gb|ETI69776.1|  CysJ                                                    107   2e-23   
ref|XP_011434228.1|  PREDICTED: methionine synthase reductase-like      109   2e-23   
ref|XP_009092939.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   2e-23   
ref|WP_034723470.1|  sulfite reductase [NADPH] flavoprotein alpha...    107   2e-23   
ref|WP_040904718.1|  sulfite reductase subunit alpha                    108   2e-23   
emb|CDS03498.1|  hypothetical protein LRAMOSA00900                      109   2e-23   
gb|AGT15701.1|  CPR                                                     109   2e-23   
gb|EXX70271.1|  Ncp1p                                                   108   2e-23   
ref|XP_001392901.1|  NADPH--cytochrome P450 reductase                   109   2e-23   
ref|XP_004761691.1|  PREDICTED: NADPH--cytochrome P450 reductase ...    109   2e-23   
gb|ABW86977.1|  cytochrome P450 reductase 1                             109   2e-23   
ref|WP_011634260.1|  sulfite reductase subunit alpha                    108   2e-23   
ref|WP_028046553.1|  reductase                                          110   2e-23   
ref|XP_009695858.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   2e-23   
gb|ESA02196.1|  hypothetical protein GLOINDRAFT_337546                  109   2e-23   
gb|EUN24256.1|  hypothetical protein COCVIDRAFT_106524                  109   2e-23   
emb|CDH48577.1|  nadph-cytochrome p450 reductase                        109   2e-23   
ref|XP_006033298.1|  PREDICTED: NADPH--cytochrome P450 reductase        109   2e-23   
gb|KGL93369.1|  NADPH--cytochrome P450 reductase                        108   2e-23   



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQ
Sbjct  573  FFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMLEKASHVWSLISQ  632

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQ+KVDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  633  EGYLYVCGDAKGMARDVHRTLHTIVQEQDKVDSTKAEAIVKKLQMDGRYLRDVW  686



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score =   222 bits (566),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 111/114 (97%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQ
Sbjct  573  FFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMLEKASHVWSLISQ  632

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTI+QEQ+KVDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  633  EGYLYVCGDAKGMARDVHRTLHTIIQEQDKVDSTKAEAIVKKLQMDGRYLRDVW  686



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score =   222 bits (565),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQ
Sbjct  574  FFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMMEKASHVWSLISQ  633

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQEK DSSKAEA VKKLQM+GRYLRDVW
Sbjct  634  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKADSSKAEATVKKLQMDGRYLRDVW  687



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score =   221 bits (563),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL++F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQ
Sbjct  573  FFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREGPQKEYVQHKMMEKASHVWSLISQ  632

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE  DSSKAEA+VKKLQM+GRYLRDVW
Sbjct  633  EGYLYVCGDAKGMARDVHRTLHTIVQEQENADSSKAEAVVKKLQMDGRYLRDVW  686



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEELK+F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS+VWSLISQ
Sbjct  573  FFGCRNRRMDFIYEEELKSFVDQGVISELIIAFSREGPQKEYVQHKMMEKASEVWSLISQ  632

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            +GYLYVCGDAKGMARDVHRTLHTIVQEQE  +SSKAEAIVKKLQM+GRYLRDVW
Sbjct  633  DGYLYVCGDAKGMARDVHRTLHTIVQEQENANSSKAEAIVKKLQMDGRYLRDVW  686



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE ELK +ED+G++SELIVAFSREGPQK+YVQHK+ E+A+++WSL+SQ
Sbjct  579  FFGCRNRRMDFIYESELKKYEDEGVVSELIVAFSREGPQKEYVQHKMMEKAAEIWSLLSQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHR LHTIVQEQEK DSSKAEAIVK+LQMNGRYLRDVW
Sbjct  639  EGYLYVCGDAKGMARDVHRALHTIVQEQEKTDSSKAEAIVKQLQMNGRYLRDVW  692



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score =   216 bits (551),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL++F DQG+ISELI+AFSREG QK+YVQHK+ E+AS VWSLISQ
Sbjct  573  FFGCRNRRMDFIYEEELQSFVDQGVISELIIAFSREGSQKEYVQHKMMEKASDVWSLISQ  632

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE  DSSKAEA+VKKLQM+GRYLRDVW
Sbjct  633  EGYLYVCGDAKGMARDVHRTLHTIVQEQENADSSKAEAVVKKLQMDGRYLRDVW  686



>gb|KDO81195.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=429

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+
Sbjct  316  FFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSK  375

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  376  EGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  429



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score =   215 bits (548),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF DQG+IS+LIVAFSREGPQKDYVQHK+ E+A++ WSLISQ
Sbjct  578  FFGCRNRRMDFIYEDELNNFVDQGVISKLIVAFSREGPQKDYVQHKMIEKAAEFWSLISQ  637

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            +G+LYVCGDAKGMARDVHRTLHTIVQEQEKVDS++AEA+VKKLQM+GRYLRDVW
Sbjct  638  KGHLYVCGDAKGMARDVHRTLHTIVQEQEKVDSTEAEAMVKKLQMDGRYLRDVW  691



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL  F +QG+ISELIVAFSREGPQK+YVQHK+TE+A+Q WSLISQ
Sbjct  577  FFGCRNRRMDFIYEDELSGFVNQGVISELIVAFSREGPQKEYVQHKMTEKAAQFWSLISQ  636

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAEAIVKKLQ +GRYLRDVW
Sbjct  637  VGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAEAIVKKLQTDGRYLRDVW  690



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score =   214 bits (546),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL  F DQG+ISELI+AFSREGPQK+YVQHK+ E+AS VWSLISQ
Sbjct  573  FFGCRNRRMDFIYEEELLGFVDQGVISELIIAFSREGPQKEYVQHKMLEKASHVWSLISQ  632

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAK MARDVHRTLHTIVQEQ+KVDS+KAEAI+KKLQM+GRYLRD+W
Sbjct  633  EGYLYVCGDAKEMARDVHRTLHTIVQEQDKVDSTKAEAIMKKLQMDGRYLRDMW  686



>ref|XP_010439016.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHKITE+A+QVW+LI +
Sbjct  578  FFGCRNRRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKITEKAAQVWNLIKE  637

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMA+DVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  638  EGYLYVCGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  691



>ref|XP_010433757.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Camelina 
sativa]
 ref|XP_010433758.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433759.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X3 [Camelina 
sativa]
Length=691

 Score =   213 bits (542),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHKITE+A+QVW+LI +
Sbjct  578  FFGCRNRRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKITEKAAQVWNLIKE  637

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMA+DVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  638  EGYLYVCGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  691



>ref|XP_010448554.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Camelina 
sativa]
Length=691

 Score =   212 bits (540),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHKITE+A+QVW+LI  
Sbjct  578  FFGCRNRRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKITEKAAQVWNLIKD  637

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMA+DVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  638  EGYLYVCGDAKGMAKDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  691



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score =   212 bits (539),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFG RNRRMDFIYEEEL+ F DQG++SELIVAFSREGPQK+YVQHK+ E+AS VWSLISQ
Sbjct  573  FFGYRNRRMDFIYEEELQRFVDQGVLSELIVAFSREGPQKEYVQHKMMEKASHVWSLISQ  632

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHR LHTIVQEQE  DSSKAEA VKKLQM+GRYLRDVW
Sbjct  633  EGYLYVCGDAKGMARDVHRALHTIVQEQENADSSKAEATVKKLQMDGRYLRDVW  686



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score =   211 bits (537),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF ++G+ISELI+AFSREGPQK+YVQHK+ ++A+Q+WSL+S+
Sbjct  581  FFGCRNRRMDFIYEDELNNFVEEGVISELILAFSREGPQKEYVQHKMMDKAAQLWSLLSK  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  641  EGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  694



>gb|KDO81194.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=558

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+
Sbjct  445  FFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSK  504

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  505  EGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  558



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+
Sbjct  581  FFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSK  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  641  EGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  694



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NFE++G+ISELI+AFSREG QK+YVQHK+ ++A+Q+WSL+S+
Sbjct  581  FFGCRNRRMDFIYEDELNNFEEEGVISELILAFSREGSQKEYVQHKMMDKAAQLWSLLSK  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE+IVKK QM GRYLRDVW
Sbjct  641  EGYLYVCGDAKGMARDVHRTLHTIVQEQENVDSSKAESIVKKFQMEGRYLRDVW  694



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score =   210 bits (534),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF D+G++SELIVAFSREGP K+YVQHK+ +RA+ +W LISQ
Sbjct  579  FFGCRNRRMDFIYEDELNNFVDEGVLSELIVAFSREGPTKEYVQHKMMDRAAHMWDLISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAIVK+LQM+GRYLRDVW
Sbjct  639  GGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAIVKQLQMDGRYLRDVW  692



>ref|XP_009137451.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X2 [Brassica 
rapa]
Length=556

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHK+ E+ASQVW+LI +
Sbjct  443  FFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKMIEKASQVWNLIKE  502

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  503  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  556



>emb|CDY34288.1| BnaA01g13910D [Brassica napus]
Length=695

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL N+ DQG+ISELIVAFSREG QK+YVQHKI E+A+QVW+LI +
Sbjct  582  FFGCRNRRMDFIYEDELNNYADQGVISELIVAFSREGAQKEYVQHKIIEKATQVWNLIKE  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  642  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_009138145.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=695

 Score =   209 bits (533),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL N+ DQG+ISELIVAFSREG QK+YVQHKI E+A+QVW+LI +
Sbjct  582  FFGCRNRRMDFIYEDELNNYADQGVISELIVAFSREGAQKEYVQHKIIEKATQVWNLIKE  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  642  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>emb|CDY03447.1| BnaC01g16350D [Brassica napus]
Length=695

 Score =   209 bits (531),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHKI E+A+QVW+LI +
Sbjct  582  FFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKIVEKAAQVWNLIKE  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  642  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_002867662.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43921.1| hypothetical protein ARALYDRAFT_492391 [Arabidopsis lyrata subsp. 
lyrata]
Length=692

 Score =   209 bits (531),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI +
Sbjct  579  FFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMMEKAAQVWNLIKE  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  639  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE EL +F DQG+ISELIVAFSREG QKDYVQHK+ E+A+QVWSLIS 
Sbjct  577  FFGCRNRRMDFIYENELNDFVDQGVISELIVAFSREGSQKDYVQHKMMEKAAQVWSLISG  636

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR+LHTIVQ QE VDS+KAEA VKKLQM+GRYLRDVW
Sbjct  637  GGYLYVCGDAKGMARDVHRSLHTIVQTQENVDSTKAEATVKKLQMDGRYLRDVW  690



>emb|CDY11017.1| BnaA03g46760D [Brassica napus]
Length=695

 Score =   208 bits (530),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI +
Sbjct  582  FFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMIEKAAQVWNLIKE  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  642  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRR+DFIYEEELKNF +QG +SELIVAFSREG +K+YVQHK+ ++A+Q+WSLISQ
Sbjct  578  FFGCRNRRLDFIYEEELKNFVEQGSLSELIVAFSREGAEKEYVQHKMMDQAAQLWSLISQ  637

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQ+QE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  638  GGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSTKAEAIVKKLQMDGRYLRDVW  691



>ref|XP_006413419.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
 gb|ESQ54872.1| hypothetical protein EUTSA_v10024568mg [Eutrema salsugineum]
Length=694

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -3

Query  721  LNLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERAS  542
            ++L     FFGCRNRRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+
Sbjct  573  VDLGSSLLFFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMIEKAA  632

Query  541  QVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
            QVW+LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEA+VKKLQ  GRYLRD
Sbjct  633  QVWNLIKEEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAVVKKLQTEGRYLRD  692

Query  361  VW  356
            VW
Sbjct  693  VW  694



>ref|XP_009137450.1| PREDICTED: NADPH--cytochrome P450 reductase 1 isoform X1 [Brassica 
rapa]
Length=695

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHK+ E+ASQVW+LI +
Sbjct  582  FFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKMIEKASQVWNLIKE  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  642  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL +F D+G++SELIVAFSREGP K+YVQHK+ +RA+ +W LISQ
Sbjct  579  FFGCRNRRMDFIYEDELNDFVDEGVLSELIVAFSREGPTKEYVQHKMMDRAAHMWDLISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAIVK+LQM+GRYLRDVW
Sbjct  639  GGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAIVKQLQMDGRYLRDVW  692



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QG +SELIVAFSREGP+K+YVQHK+ ++AS +WSLISQ
Sbjct  574  FFGCRNRRMDFIYEDELNNFVEQGAMSELIVAFSREGPEKEYVQHKMMDKASCIWSLISQ  633

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLHTIVQ+QE VDSSKAE+IVKKLQM+GRYLRDVW
Sbjct  634  GGYFYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAESIVKKLQMDGRYLRDVW  687



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 108/121 (89%), Gaps = 0/121 (0%)
 Frame = -3

Query  718  NLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQ  539
            +L     FFGCRNRRMDFIY++EL NF DQG+ISELIVAFSREGPQK+YVQHK+ ++A+ 
Sbjct  575  DLGPALLFFGCRNRRMDFIYKDELYNFVDQGVISELIVAFSREGPQKEYVQHKMMDKAAY  634

Query  538  VWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDV  359
            +WSL+S++GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSS AEA VKKLQM GRYLRDV
Sbjct  635  LWSLLSKDGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSTAEATVKKLQMEGRYLRDV  694

Query  358  W  356
            W
Sbjct  695  W  695



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELKNF +QG +SELIV FSREGP+K+YVQHK+ ++A+ +W+LISQ
Sbjct  576  FFGCRNRQMDFIYEDELKNFMEQGALSELIVTFSREGPEKEYVQHKMMDKAANLWNLISQ  635

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQ+QE VDSSKAEAIVKKLQM+GRYLRDVW
Sbjct  636  GGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAEAIVKKLQMDGRYLRDVW  689



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score =   207 bits (527),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELKNF +QG +SELIV FSREGP+K+YVQHK+ ++A+ +W+LISQ
Sbjct  576  FFGCRNRQMDFIYEDELKNFMEQGALSELIVTFSREGPEKEYVQHKMMDKAANLWNLISQ  635

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQ+QE VDSSKAEAIVKKLQM+GRYLRDVW
Sbjct  636  GGYLYVCGDAKGMARDVHRTLHTIVQQQENVDSSKAEAIVKKLQMDGRYLRDVW  689



>emb|CAC27143.1| NADPH-cytochrome P450 reductase [Picea abies]
Length=196

 Score =   195 bits (496),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+ELKN+ D G++S+L++AFSREG  K+YVQHKITE+AS +W+LISQ
Sbjct  83   FFGCRNRQMDYIYEDELKNYVDNGVLSDLVLAFSREGTTKEYVQHKITEKASYIWNLISQ  142

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH IVQEQE VDS+ AEA VKKLQ  GRYLRDVW
Sbjct  143  GGYLYVCGDAKGMARDVHRTLHNIVQEQESVDSTSAEATVKKLQTEGRYLRDVW  196



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score =   207 bits (528),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL +F D+G++SELIVAFSREGP K+YVQHK+ +RA+ +W LISQ
Sbjct  615  FFGCRNRRMDFIYEDELNDFVDEGVLSELIVAFSREGPTKEYVQHKMMDRAAHMWDLISQ  674

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLHTIVQEQEKVDS+KAEAIVK+LQM+GRYLRDVW
Sbjct  675  GGYFYVCGDAKGMARDVHRTLHTIVQEQEKVDSTKAEAIVKQLQMDGRYLRDVW  728



>gb|ACN54323.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=693

 Score =   207 bits (527),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QG +SEL+VAFSREGPQK+YVQHK+ ++A+ +W+LIS+
Sbjct  580  FFGCRNRRMDFIYEDELNNFVEQGALSELVVAFSREGPQKEYVQHKMMDKAADIWNLISK  639

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  640  GGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  693



>emb|CDX92639.1| BnaC07g38970D [Brassica napus]
Length=695

 Score =   207 bits (526),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI +
Sbjct  582  FFGCRNRRMDFIYEDELNNFVDQGVISELIVAFSREGAQKEYVQHKMIEKAAQVWNLIKE  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            +GYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  642  KGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  695



>ref|XP_010277516.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Nelumbo 
nucifera]
Length=651

 Score =   206 bits (523),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL +F +QG++SELIVAFSREGP K+YVQHK+ ++A++VW+LIS+
Sbjct  538  FFGCRNRKMDFIYEDELNSFVEQGVLSELIVAFSREGPNKEYVQHKMMDKATEVWNLISR  597

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH+IVQEQE  DSSKAEAIVKKLQM GRYLRDVW
Sbjct  598  NGYLYVCGDAKGMARDVHRTLHSIVQEQESTDSSKAEAIVKKLQMEGRYLRDVW  651



>emb|CDY34287.1| BnaA01g13900D [Brassica napus]
Length=694

 Score =   206 bits (524),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF D+G+ISELIVAFSREG QK+YVQHKI ++A+Q W+LI +
Sbjct  581  FFGCRNRRMDFIYEDELNNFVDKGVISELIVAFSREGAQKEYVQHKIVQKAAQFWNLIKE  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  641  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  694



>ref|XP_007141274.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
 gb|ESW13268.1| hypothetical protein PHAVU_008G182200g [Phaseolus vulgaris]
Length=685

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL  F +QG +SELIVAFSREGP+K+YVQHK+ ++A+ +W+LISQ
Sbjct  572  FFGCRNRQMDFIYEDELNKFVEQGALSELIVAFSREGPEKEYVQHKMIDKAANLWNLISQ  631

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQ+QEKVDSSKAEAIVKKLQM+GRYLRDVW
Sbjct  632  GGYLYVCGDAKGMARDVHRTLHTIVQQQEKVDSSKAEAIVKKLQMDGRYLRDVW  685



>gb|AHB33949.1| cytochrome P450 reductase [Santalum album]
Length=692

 Score =   206 bits (523),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QG+ISELIVAFSR+GP K+YVQHK+ ++A+ +WSLISQ
Sbjct  579  FFGCRNRRMDFIYEDELNNFVEQGVISELIVAFSRDGPTKEYVQHKMMDKAAYIWSLISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHT+VQ+QE VDSSKAE+IVKKLQM+GRYLRDVW
Sbjct  639  GAYLYVCGDAKGMARDVHRTLHTLVQQQESVDSSKAESIVKKLQMDGRYLRDVW  692



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELKNF +QG +SELIVAFSREGP+K+YVQHKI ++A+ VWSLISQ
Sbjct  579  FFGCRNRQMDFIYEDELKNFVEQGSLSELIVAFSREGPEKEYVQHKIMDQAAHVWSLISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAK MARDVHRTLH+IVQ+QE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  639  GGYLYVCGDAKCMARDVHRTLHSIVQQQENVDSTKAEAIVKKLQMDGRYLRDVW  692



>gb|KJB58863.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=693

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QG +S+L+VAFSREGPQK+YVQHK+ ++A+ +W+LIS+
Sbjct  580  FFGCRNRRMDFIYEDELNNFVEQGALSDLLVAFSREGPQKEYVQHKMMDKAADIWNLISK  639

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  640  GGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  693



>gb|KJB58865.1| hypothetical protein B456_009G229300 [Gossypium raimondii]
Length=694

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QG +S+L+VAFSREGPQK+YVQHK+ ++A+ +W+LIS+
Sbjct  581  FFGCRNRRMDFIYEDELNNFVEQGALSDLLVAFSREGPQKEYVQHKMMDKAADIWNLISK  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  641  GGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  694



>ref|XP_010277515.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Nelumbo 
nucifera]
Length=691

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL +F +QG++SELIVAFSREGP K+YVQHK+ ++A++VW+LIS+
Sbjct  578  FFGCRNRKMDFIYEDELNSFVEQGVLSELIVAFSREGPNKEYVQHKMMDKATEVWNLISR  637

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH+IVQEQE  DSSKAEAIVKKLQM GRYLRDVW
Sbjct  638  NGYLYVCGDAKGMARDVHRTLHSIVQEQESTDSSKAEAIVKKLQMEGRYLRDVW  691



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QG+ISELIVAFSREGPQK+YVQHK+ ++A+Q+W++ISQ
Sbjct  576  FFGCRNRRMDFIYEDELNNFVEQGVISELIVAFSREGPQKEYVQHKMVQKAAQIWAIISQ  635

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH IVQEQ  +D+SK E++VKKLQM+GRYLRDVW
Sbjct  636  GGYLYVCGDAKGMARDVHRTLHNIVQEQGNLDASKTESMVKKLQMDGRYLRDVW  689



>ref|XP_002307336.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
 gb|AAK15259.1|AF302496_1 NADPH-cytochrome P450 oxydoreductase isoform 1 [Populus trichocarpa 
x Populus deltoides]
 gb|EEE94332.1| NADPH-cytochrome P450 oxydoreductase isoform 1 family protein 
[Populus trichocarpa]
Length=692

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -3

Query  721  LNLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERAS  542
            + L     FFGCRNRRMDFIYE+EL NF +QG+ISELIVAFSREGPQK+YVQHK+ +RA+
Sbjct  571  VKLGPALLFFGCRNRRMDFIYEDELNNFVEQGVISELIVAFSREGPQKEYVQHKMVDRAA  630

Query  541  QVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
            ++W++ISQ GY YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VKKLQM GRYLRD
Sbjct  631  EIWTIISQGGYFYVCGDAKGMARDVHRTLHTIVQEQGGLDSSKTESMVKKLQMEGRYLRD  690

Query  361  VW  356
            VW
Sbjct  691  VW  692



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QGI+SELI+AFSREGPQK+YVQHK+ +RAS +W++ISQ
Sbjct  575  FFGCRNRRMDFIYEDELNNFVEQGILSELILAFSREGPQKEYVQHKMMDRASYIWNIISQ  634

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTLHTIVQEQE V+SSKAEAIVKKL   GRYLRDVW
Sbjct  635  GGYLYVCGDAKGMAKDVHRTLHTIVQEQENVESSKAEAIVKKLHTEGRYLRDVW  688



>ref|NP_194183.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 sp|Q9SB48.1|NCPR1_ARATH RecName: Full=NADPH--cytochrome P450 reductase 1 [Arabidopsis 
thaliana]
 emb|CAA23011.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 emb|CAB79362.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAK96879.1| NADPH-ferrihemoprotein reductase ATR1 [Arabidopsis thaliana]
 gb|AAP37785.1| At4g24520 [Arabidopsis thaliana]
 gb|AEE84919.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AGA15807.1| CPR1 [Expression vector pUDE172]
Length=692

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF DQG+ISELI+AFSREG QK+YVQHK+ E+A+QVW LI +
Sbjct  579  FFGCRNRQMDFIYEDELNNFVDQGVISELIMAFSREGAQKEYVQHKMMEKAAQVWDLIKE  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  639  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -3

Query  721  LNLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERAS  542
            + L     FFGCRNR+MDFIYEEEL NF +QG +SELIVAFSREGP+K+YVQHK+ ++AS
Sbjct  571  VQLGPALLFFGCRNRQMDFIYEEELNNFVEQGSLSELIVAFSREGPEKEYVQHKMMDKAS  630

Query  541  QVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
              WSLISQ GYLYVCGDAKGMARDVHRTLHTIVQ+QE  DSSKAEA VKKLQM+GRYLRD
Sbjct  631  YFWSLISQGGYLYVCGDAKGMARDVHRTLHTIVQQQENADSSKAEATVKKLQMDGRYLRD  690

Query  361  VW  356
            VW
Sbjct  691  VW  692



>ref|NP_001190823.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
 gb|AEE84920.1| NADPH--cytochrome P450 reductase 1 [Arabidopsis thaliana]
Length=688

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF DQG+ISELI+AFSREG QK+YVQHK+ E+A+QVW LI +
Sbjct  575  FFGCRNRQMDFIYEDELNNFVDQGVISELIMAFSREGAQKEYVQHKMMEKAAQVWDLIKE  634

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  635  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  688



>emb|CAA46814.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=692

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF DQG+ISELI+AFSREG QK+YVQHK+ E+A+QVW LI +
Sbjct  579  FFGCRNRQMDFIYEDELNNFVDQGVISELIMAFSREGAQKEYVQHKMMEKAAQVWDLIKE  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  639  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 110/124 (89%), Gaps = 4/124 (3%)
 Frame = -3

Query  718  NLVQL---CCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITER  548
            N VQL     FFGCRNR+MDFIYE+EL N+ DQG++SELIVAFSREGPQK+YVQHK+ E+
Sbjct  572  NGVQLGPSLLFFGCRNRKMDFIYEDELYNYVDQGVLSELIVAFSREGPQKEYVQHKMMEK  631

Query  547  ASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            A++VW LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEA+VKKLQM GRYL
Sbjct  632  AAEVWKLI-KEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAVVKKLQMEGRYL  690

Query  367  RDVW  356
            RDVW
Sbjct  691  RDVW  694



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score =   204 bits (520),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL  F +QG+ISELIVAFSREGPQK+YVQHK+ ++A+Q+WSLIS+
Sbjct  579  FFGCRNRRMDFIYEDELNYFVEQGVISELIVAFSREGPQKEYVQHKMMDKAAQIWSLISE  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VKKLQM+GRYLRDVW
Sbjct  639  RGYIYVCGDAKGMARDVHRTLHTIVQEQGNLDSSKTESMVKKLQMDGRYLRDVW  692



>ref|XP_006386427.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
 gb|ERP64224.1| hypothetical protein POPTR_0002s10680g [Populus trichocarpa]
Length=521

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF  QG+ISEL+VAFSREGPQK+YVQHK+ ++A+++WS+ISQ
Sbjct  408  FFGCRNRQMDFIYEDELNNFVAQGVISELLVAFSREGPQKEYVQHKMVDKAAEIWSIISQ  467

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VKKLQM GRYLRDVW
Sbjct  468  GGYLYVCGDAKGMARDVHRTLHTIVQEQGGLDSSKTESMVKKLQMEGRYLRDVW  521



>gb|ABK92896.1| unknown [Populus trichocarpa]
Length=183

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  70   FFGCRNRQMDFIYEDELNNFVESGALSELSVAFSREGPTKEYVQHKMMQKASDIWNMISQ  129

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTLHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  130  GGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTESFVKGLQMNGRYLRDVW  183



>ref|XP_006285937.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
 gb|EOA18835.1| hypothetical protein CARUB_v10007449mg [Capsella rubella]
Length=692

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+ELKNF DQG+ISELIVAFSREG QK+YVQHK+ E+A+QVW+LI +
Sbjct  579  FFGCRNRRMDFIYEDELKNFVDQGVISELIVAFSREGAQKEYVQHKMMEKAAQVWNLIQE  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTLHTIV EQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  639  GGYLYVCGDAKGMAKDVHRTLHTIVIEQEGVSSSEAEAIVKKLQTEGRYLRDVW  692



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score =   204 bits (518),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+ELKNF +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ
Sbjct  578  FFGCRNRRMDFIYEDELKNFVEQGSLSELIVAFSREGAEKEYVQHKMMDQAAHLWSLISQ  637

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTIVQ+QE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  638  GGYLYVCGDAKGMARDVHRILHTIVQQQENVDSTKAEAIVKKLQMDGRYLRDVW  691



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score =   204 bits (518),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF ++G++SELIVAFSREGP K+YVQHK+ ++A+ VW L+SQ
Sbjct  579  FFGCRNRRMDFIYEDELNNFVEEGVLSELIVAFSREGPTKEYVQHKLMDKAAYVWDLVSQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLHTIVQ+QEKVDS+KAEA VK+LQM+GRYLRDVW
Sbjct  639  GGYFYVCGDAKGMARDVHRTLHTIVQQQEKVDSTKAEATVKRLQMDGRYLRDVW  692



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 4/124 (3%)
 Frame = -3

Query  718  NLVQL---CCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITER  548
            N VQL     FFGCRNRRMDFIYE+EL NF DQG +SE +VAFSREGPQK+YVQHK+TE+
Sbjct  572  NGVQLGLSLLFFGCRNRRMDFIYEDELYNFVDQGTLSEFVVAFSREGPQKEYVQHKMTEK  631

Query  547  ASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            A++VW LI +EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  632  AAEVWKLI-KEGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQNEGRYL  690

Query  367  RDVW  356
            RDVW
Sbjct  691  RDVW  694



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score =   203 bits (517),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF +QG +SELIVAFSREGP K+YVQHK+ E+A+ +W+LISQ
Sbjct  576  FFGCRNRQMDFIYEDELNNFVEQGALSELIVAFSREGPSKEYVQHKMMEKAAYMWNLISQ  635

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLHTIVQ+++KVDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  636  GGYFYVCGDAKGMARDVHRTLHTIVQQEDKVDSTKAEAIVKKLQMDGRYLRDVW  689



>ref|XP_007018235.1| P450 reductase 1 isoform 2 [Theobroma cacao]
 gb|EOY15460.1| P450 reductase 1 isoform 2 [Theobroma cacao]
Length=495

 Score =   199 bits (507),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF  QG +SELIVAFSRE PQK+YVQHK+ ++A+ +WSL+S+
Sbjct  382  FFGCRNRRMDFIYEDELNNFVAQGALSELIVAFSRERPQKEYVQHKMMDKAAYMWSLLSK  441

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIV EQE VDSSKAE++VKKLQM GRYLRDVW
Sbjct  442  GGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAESMVKKLQMEGRYLRDVW  495



>gb|KHG05124.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=693

 Score =   203 bits (516),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +QG +S L++AFSREGPQK+YVQHK+ ++A+ +W+LIS+
Sbjct  580  FFGCRNRRMDFIYEDELNNFVEQGALSVLVLAFSREGPQKEYVQHKMMDKAADIWNLISK  639

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTI+QEQE VDSSKAE++VKKLQM+GRYLRDVW
Sbjct  640  GGYLYVCGDAKGMARDVHRTLHTIIQEQENVDSSKAESMVKKLQMDGRYLRDVW  693



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELK+F +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ
Sbjct  577  FFGCRNRQMDFIYEDELKSFVEQGSLSELIVAFSREGAEKEYVQHKMMDKAAHLWSLISQ  636

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH+IVQEQE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  637  GGYLYVCGDAKGMARDVHRTLHSIVQEQENVDSTKAEAIVKKLQMDGRYLRDVW  690



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELK+F +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ
Sbjct  577  FFGCRNRQMDFIYEDELKSFVEQGSLSELIVAFSREGAEKEYVQHKMMDKAAHLWSLISQ  636

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH+IVQEQE VDS+KAEAIVKKLQM+GRYLRDVW
Sbjct  637  GGYLYVCGDAKGMARDVHRTLHSIVQEQENVDSTKAEAIVKKLQMDGRYLRDVW  690



>ref|XP_009138137.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Brassica 
rapa]
Length=694

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL N+ DQ +ISELIVAFSREG QK+YVQHKI ++A+Q W+LI +
Sbjct  581  FFGCRNRRMDFIYEDELNNYVDQRVISELIVAFSREGAQKEYVQHKIVQKAAQFWNLIKE  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGYLYVCGDAKGMARDVHRTLHTIVQEQE V SS+AEAIVKKLQ  GRYLRDVW
Sbjct  641  EGYLYVCGDAKGMARDVHRTLHTIVQEQEGVSSSEAEAIVKKLQTEGRYLRDVW  694



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF  QG ISELIVAFSREGP+K+YVQHK+ ++A  +WSLISQ
Sbjct  579  FFGCRNRQMDFIYEDELNNFVQQGAISELIVAFSREGPEKEYVQHKMMDKAEYLWSLISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR+LHTIVQ+QE  DSSKAEA VKKLQM+GRYLRDVW
Sbjct  639  GGYLYVCGDAKGMARDVHRSLHTIVQQQENADSSKAEATVKKLQMDGRYLRDVW  692



>ref|XP_010254555.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=692

 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 3/124 (2%)
 Frame = -3

Query  718  NLVQL---CCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITER  548
            N VQL     FFGCRNRRMDFIYE+EL +F +QG++SELIVAFSREGP K YVQHK+ ++
Sbjct  569  NGVQLGPALLFFGCRNRRMDFIYEDELNSFVEQGVLSELIVAFSREGPNKQYVQHKMMDK  628

Query  547  ASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            A+ +W++IS+ GYLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAEA VKKLQM+GRYL
Sbjct  629  AADIWNIISKNGYLYVCGDAKGMARDVHRTLHTIVQEQGSMDSSKAEATVKKLQMDGRYL  688

Query  367  RDVW  356
            RDVW
Sbjct  689  RDVW  692



>ref|XP_009414761.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=700

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF D+G++SELIVAFSREGP K+YVQHK+TE+AS VW++ISQ
Sbjct  587  FFGCRNRKMDFIYEDELHNFVDRGVLSELIVAFSREGPTKEYVQHKMTEKASSVWNIISQ  646

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  647  GGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESLVKSLQMEGRYLRDVW  700



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/114 (78%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIY++EL NF ++G++SELIVAFSREGP K+YVQHK+ E+A+  W L+SQ
Sbjct  579  FFGCRNRRMDFIYQDELNNFVEEGVLSELIVAFSREGPTKEYVQHKLMEKAAYTWDLVSQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLHTIVQEQE+VDS+KAEA VK+LQM+GRYLRDVW
Sbjct  639  GGYFYVCGDAKGMARDVHRTLHTIVQEQERVDSTKAEARVKQLQMDGRYLRDVW  692



>ref|XP_010692385.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=693

 Score =   200 bits (509),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL  F ++G +SEL+VAFSREG QK+YVQHK+ ++AS +W+LIS 
Sbjct  580  FFGCRNRRMDFIYEEELHKFVEEGAVSELVVAFSREGTQKEYVQHKMVDKASYLWNLISS  639

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH IVQEQEKV+SSKAEAIVKKLQM+GRYLRDVW
Sbjct  640  GGYLYVCGDAKGMARDVHRTLHNIVQEQEKVESSKAEAIVKKLQMDGRYLRDVW  693



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score =   199 bits (507),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF D G+ISELI+AFSREG +K+YVQHK+ E+A Q+W+LIS+
Sbjct  579  FFGCRNRRMDFIYEDELNNFMDSGVISELILAFSREGLKKEYVQHKMMEKAVQLWNLISK  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EGY+YVCGDAKGMARDVHRTLHTIVQEQE V SS+AEA+VKKLQ  GRYLRDVW
Sbjct  639  EGYIYVCGDAKGMARDVHRTLHTIVQEQENVRSSEAEAVVKKLQTEGRYLRDVW  692



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF +QG +SELIVAFSREG +K+YVQHK+ ++A+ +WSLISQ
Sbjct  579  FFGCRNRQMDFIYEDELNNFVEQGSLSELIVAFSREGSEKEYVQHKMMDKAAYLWSLISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQ+QE  DS+KAEA VKKLQM+GRYLRDVW
Sbjct  639  GGYLYVCGDAKGMARDVHRTLHTIVQQQENADSTKAEATVKKLQMDGRYLRDVW  692



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score =   199 bits (505),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF  QG +SELIVAFSRE PQK+YVQHK+ ++A+ +WSL+S+
Sbjct  580  FFGCRNRRMDFIYEDELNNFVAQGALSELIVAFSRERPQKEYVQHKMMDKAAYMWSLLSK  639

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIV EQE VDSSKAE++VKKLQM GRYLRDVW
Sbjct  640  GGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAESMVKKLQMEGRYLRDVW  693



>ref|XP_010928663.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=706

 Score =   199 bits (505),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+ELKNF + G +SELIVAFSREGP K+YVQHK+ E+AS +WS+ISQ
Sbjct  593  FFGCRNRKLDFIYEDELKNFVETGALSELIVAFSREGPTKEYVQHKMAEKASDIWSVISQ  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  653  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESMVKSLQMEGRYLRDVW  706



>dbj|BAJ97446.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+ +WS++SQ
Sbjct  142  FFGCRNRQMDFIYEDELNNFTESGALSELVVAFSREGPTKEYVQHKMAEKAADLWSIVSQ  201

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E  VK LQ  GRYLRDVW
Sbjct  202  GGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTEGYVKNLQTEGRYLRDVW  255



>ref|XP_010523339.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X5 
[Tarenaya hassleriana]
 ref|XP_010523341.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X5 
[Tarenaya hassleriana]
Length=339

 Score =   191 bits (485),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 4/120 (3%)
 Frame = -3

Query  718  NLVQL---CCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITER  548
            N VQL     FFGCRNRRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+
Sbjct  200  NGVQLGPSLLFFGCRNRRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEK  259

Query  547  ASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            A++VW L ++EGYLYVCGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  260  AAEVWKL-TKEGYLYVCGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF  QG +SELIVAFSRE PQK+YVQHK+ ++A+ +WSL+S+
Sbjct  623  FFGCRNRRMDFIYEDELNNFVAQGALSELIVAFSRERPQKEYVQHKMMDKAAYMWSLLSK  682

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIV EQE VDSSKAE++VKKLQM GRYLRDVW
Sbjct  683  GGYLYVCGDAKGMARDVHRTLHTIVLEQESVDSSKAESMVKKLQMEGRYLRDVW  736



>ref|XP_004165700.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Cucumis 
sativus]
Length=503

 Score =   195 bits (495),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL NF + G +SEL++AFSREGP K+YVQHK+TE+AS +W+LISQ
Sbjct  390  FFGCRNRAMDYIYEDELNNFVETGALSELVIAFSREGPTKEYVQHKMTEKASDIWNLISQ  449

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQ +GRYLRDVW
Sbjct  450  GAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQTSGRYLRDVW  503



>gb|AIG15452.1| NADPH-cytochrome P450 reductase 2 [Azadirachta indica]
Length=715

 Score =   198 bits (503),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +SEL+VAFSR+GP K+YVQHK+ E+AS +W++ISQ
Sbjct  602  FFGCRNRQMDYIYEDELNNFVQSGALSELVVAFSRQGPTKEYVQHKMMEKASDIWNMISQ  661

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQEQ  VDSSKAE+IVK LQM GRYLRDVW
Sbjct  662  GGYLYVCGDAKGMARDVHRTLHTIVQEQGSVDSSKAESIVKNLQMTGRYLRDVW  715



>gb|KJB14707.1| hypothetical protein B456_002G138900 [Gossypium raimondii]
Length=693

 Score =   197 bits (502),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL N  +QG +SELIVA SREGPQK+YVQHK+ ++A+ +WSLIS+
Sbjct  580  FFGCRNRKMDFIYEDELNNLVEQGALSELIVALSREGPQKEYVQHKMMDKAAHIWSLISK  639

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQEQ  ++SSKAE++VKKLQM GRYLRDVW
Sbjct  640  GGYLYVCGDAKGMARDVHRTLHTIVQEQGNMESSKAESMVKKLQMEGRYLRDVW  693



>ref|XP_010046982.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Eucalyptus 
grandis]
 gb|KCW78706.1| hypothetical protein EUGRSUZ_C00154 [Eucalyptus grandis]
Length=683

 Score =   197 bits (501),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+AS +W +IS+
Sbjct  570  FFGCRNRRMDFIYEDELNNFVNAGALSELLVAFSREGPTKEYVQHKMLEKASDIWKIISE  629

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VK LQMNGRYLRDVW
Sbjct  630  GGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESLVKNLQMNGRYLRDVW  683



>gb|ACP43317.1| NADPH cytochrome P450 reductase [Citrus maxima]
Length=209

 Score =   186 bits (473),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W++ S+
Sbjct  96   FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMFSE  155

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  156  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  209



>ref|XP_010523336.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X3 
[Tarenaya hassleriana]
Length=374

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 4/120 (3%)
 Frame = -3

Query  718  NLVQL---CCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITER  548
            N VQL     FFGCRNRRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+
Sbjct  200  NGVQLGPSLLFFGCRNRRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEK  259

Query  547  ASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            A++VW L ++EGYLYVCGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  260  AAEVWKL-TKEGYLYVCGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>ref|XP_010523337.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X4 
[Tarenaya hassleriana]
 ref|XP_010523338.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X4 
[Tarenaya hassleriana]
Length=370

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 1/110 (1%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++
Sbjct  210  FFGCRNRRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TK  268

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            EGYLYVCGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  269  EGYLYVCGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>ref|XP_011015338.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
 ref|XP_011015339.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=692

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF +Q +ISELIVAFSREGP+K+YVQHK+ +RA+++W++ISQ
Sbjct  579  FFGCRNRRMDFIYEDELNNFVEQVVISELIVAFSREGPRKEYVQHKMVDRAAEIWTIISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY YVCGDAKGMARDVHRTLH IVQEQ  +D+SK E++VKKLQM GRYLRDVW
Sbjct  639  GGYFYVCGDAKGMARDVHRTLHAIVQEQGGLDASKTESMVKKLQMEGRYLRDVW  692



>ref|XP_009385909.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=703

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+TE+AS VW++ISQ
Sbjct  590  FFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREGPTKEYVQHKMTEKASDVWNIISQ  649

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  650  GGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESFVKSLQMEGRYLRDVW  703



>ref|XP_006372089.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
 gb|ERP49886.1| hypothetical protein POPTR_0018s09980g [Populus trichocarpa]
Length=471

 Score =   193 bits (490),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  358  FFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQ  417

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHR LHTIVQEQ   D+S+ E+ VK LQMNGRYLRDVW
Sbjct  418  GGYLYVCGDAKGMAKDVHRALHTIVQEQGSFDNSRTESFVKSLQMNGRYLRDVW  471



>gb|AEA86315.1| NADPH-cytochrome P450 reductase [Solanum nigrum]
Length=141

 Score =   183 bits (465),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IY++EL NF + G +SEL+VAFSREGP K+YVQHK+TE+A+ +W++ISQ
Sbjct  28   FFGCRNRQMDYIYQDELDNFLEAGALSELVVAFSREGPNKEYVQHKMTEKAADIWNMISQ  87

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKG+ARDVHRTLHTI Q+Q  +D+SK E+ VK LQ  GRYLRDVW
Sbjct  88   GGYVYVCGDAKGVARDVHRTLHTIAQDQGSLDNSKTESFVKNLQTTGRYLRDVW  141



>ref|NP_001131393.1| uncharacterized protein LOC100192720 [Zea mays]
 gb|ACF79787.1| unknown [Zea mays]
Length=248

 Score =   186 bits (472),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN  MDFIYE+EL NF +QG + EL++AFSR+GP K+YVQHK+ ++AS++W +ISQ
Sbjct  135  FFGCRNSNMDFIYEDELSNFLEQGALFELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQ  194

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  195  GAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  248



>ref|XP_008781895.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Phoenix dactylifera]
Length=706

 Score =   196 bits (497),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELK F ++G +SELIVAFSREGP K+YVQHK+TE+AS +W++ISQ
Sbjct  593  FFGCRNRKMDFIYEDELKIFVERGALSELIVAFSREGPTKEYVQHKMTEKASDIWNIISQ  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLH IVQEQ  +DSSK E++VK LQM+GRYLRDVW
Sbjct  653  GGYIYVCGDAKGMARDVHRTLHAIVQEQGSLDSSKTESMVKSLQMDGRYLRDVW  706



>gb|AAT76449.1| NADPH:cytochrome P450 reductase [Taxus cuspidata]
Length=717

 Score =   196 bits (497),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/114 (77%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+ELK + ++GI++ LIVAFSREG  K+YVQHK+ E+AS  WSLI+Q
Sbjct  604  FFGCRNRQMDYIYEDELKGYVEKGILTNLIVAFSREGATKEYVQHKMLEKASDTWSLIAQ  663

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE +VKKLQM+GRYLRD+W
Sbjct  664  GGYLYVCGDAKGMARDVHRTLHTIVQEQESVDSSKAEFLVKKLQMDGRYLRDIW  717



>gb|AAX59902.1| cytochrome P450 reductase [Taxus wallichiana var. chinensis]
Length=717

 Score =   195 bits (496),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+ELK + ++G++++LIVAFSREG  K+YVQHK+ E+AS  WSLI+Q
Sbjct  604  FFGCRNRQMDYIYEDELKGYVEKGVLTDLIVAFSREGATKEYVQHKMLEKASDTWSLIAQ  663

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLHTIVQEQE VDSSKAE +VKKLQM+GRYLRD+W
Sbjct  664  GGYLYVCGDAKGMARDVHRTLHTIVQEQESVDSSKAEFLVKKLQMDGRYLRDIW  717



>gb|AEW43314.1| NADPH cytochrome P450 reductase [Picrorhiza kurrooa]
Length=710

 Score =   195 bits (496),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF   G+ISEL++AFSR+GP K+YVQHK+ ++AS +W++IS+
Sbjct  597  FFGCRNRQMDFIYEDELNNFVKAGVISELVLAFSRQGPTKEYVQHKMAQKASDIWNMISE  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK EA+VK LQM GRYLRDVW
Sbjct  657  GGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTEALVKNLQMTGRYLRDVW  710



>ref|XP_004146317.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Cucumis sativus]
 gb|AIT72028.1| cytochrome P450 reductase [Cucumis sativus]
 gb|KGN65457.1| hypothetical protein Csa_1G423150 [Cucumis sativus]
Length=708

 Score =   195 bits (495),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL NF + G +SEL++AFSREGP K+YVQHK+TE+AS +W+LISQ
Sbjct  595  FFGCRNRAMDYIYEDELNNFVETGALSELVIAFSREGPTKEYVQHKMTEKASDIWNLISQ  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQ +GRYLRDVW
Sbjct  655  GAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQTSGRYLRDVW  708



>ref|XP_010447753.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=414

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  301  FFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISQ  360

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  361  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  414



>ref|XP_008453604.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Cucumis melo]
Length=708

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL NF + G +SEL++AFSREGP K+YVQHK+TE+AS +W+LISQ
Sbjct  595  FFGCRNRAMDYIYEDELNNFVEAGALSELVIAFSREGPTKEYVQHKMTEKASDIWNLISQ  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQ +GRYLRDVW
Sbjct  655  GAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKSLQTSGRYLRDVW  708



>ref|XP_002462826.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
 gb|EER99347.1| hypothetical protein SORBIDRAFT_02g032640 [Sorghum bicolor]
Length=706

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF D G++SELI+AFSREGP K+YVQHK+ ++A+++WS+ISQ
Sbjct  593  FFGCRNRKMDFIYEDELNNFVDGGVLSELIIAFSREGPTKEYVQHKMAQKAAELWSIISQ  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  653  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSMDNSKTESYVKSLQMEGRYLRDVW  706



>ref|XP_010048643.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Eucalyptus 
grandis]
 gb|KCW80967.1| hypothetical protein EUGRSUZ_C02330 [Eucalyptus grandis]
Length=711

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMD+IYEEEL NF + G +SEL+VAFSREGP K+YVQHK+ E+AS +W+++SQ
Sbjct  598  FFGCRNRRMDYIYEEELNNFVESGALSELVVAFSREGPTKEYVQHKMMEKASDIWNMLSQ  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  658  GAYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  711



>gb|ACF35280.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=709

 Score =   195 bits (495),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/114 (76%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+AS  WS+ISQ
Sbjct  596  FFGCRNRKMDYIYEDELNNFVNTGALSELIVAFSREGPTKEYVQHKMAEKASDFWSMISQ  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  656  GAYIYVCGDAKGMARDVHRTLHTIVQEQGCLDSSKAESMVKNLQMTGRYLRDVW  709



>ref|XP_010523335.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X2 
[Tarenaya hassleriana]
Length=445

 Score =   191 bits (484),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 1/110 (1%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++
Sbjct  210  FFGCRNRRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TK  268

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            EGYLYVCGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  269  EGYLYVCGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>ref|XP_011069915.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=712

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIY++EL NF   G+ISEL++AFSREGP K+YVQHK+ ++AS+VW++IS+
Sbjct  599  FFGCRNSKMDFIYQDELNNFVKAGVISELVLAFSREGPTKEYVQHKMAQKASEVWNMISE  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  659  GGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  712



>gb|KJB53794.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=710

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ
Sbjct  597  FFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  657  GGYLYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>gb|KJB53797.1| hypothetical protein B456_009G005600 [Gossypium raimondii]
Length=711

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ
Sbjct  598  FFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQ  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  658  GGYLYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQMSGRYLRDVW  711



>emb|CAC83301.1| cytochrome P450 reductase [Triticum aestivum]
Length=703

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+++WS++SQ
Sbjct  590  FFGCRNRQMDFIYEDELNNFAESGALSELVVAFSREGPTKEYVQHKMAEKAAELWSIVSQ  649

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  650  GGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKAEGYVKNLQMEGRYLRDVW  703



>gb|AGL46979.1| cytochrome P450 reductase [Salvia miltiorrhiza]
Length=712

 Score =   194 bits (494),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYEEEL NF   G++SEL++AFSR+GP K+YVQHK+ ++AS++W++IS+
Sbjct  599  FFGCRNRKMDFIYEEELNNFVKDGVVSELVLAFSRDGPTKEYVQHKMAQKASELWNMISE  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  659  GGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESFVKNLQMTGRYLRDVW  712



>ref|XP_011043963.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  599  FFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHR LHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  659  GGYLYVCGDAKGMAKDVHRALHTIVQEQGSLDNSKTESFVKSLQMNGRYLRDVW  712



>gb|AIL29328.1| cytochrome P450 reductase [Pinus contorta]
Length=718

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+ELKN+ D G++++L++AFSREG  K+YVQHKI E+AS +W+LISQ
Sbjct  605  FFGCRNRQMDYIYEDELKNYVDTGVLTDLVLAFSREGATKEYVQHKIAEKASYIWNLISQ  664

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH I+QEQE VDS+ AEA VKKLQ  GRYLRDVW
Sbjct  665  GGYLYVCGDAKGMARDVHRTLHNIIQEQESVDSTSAEATVKKLQTEGRYLRDVW  718



>ref|XP_010093854.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB54742.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=715

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMD+IYEEEL NF + G +SEL+VAFSREGP K+YVQHK+ ++A+ +W +ISQ
Sbjct  602  FFGCRNRRMDYIYEEELANFVETGALSELVVAFSREGPTKEYVQHKMMQKAADIWDMISQ  661

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMA+DVHRTLHTI QEQ  +DSSKAE++VK LQMNGRYLRDVW
Sbjct  662  GAYIYVCGDAKGMAKDVHRTLHTIAQEQGSLDSSKAESMVKNLQMNGRYLRDVW  715



>gb|AAK15261.1|AF302498_1 NADPH-cytochrome P450 oxydoreductase isoform 3 [Populus trichocarpa 
x Populus deltoides]
Length=712

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  599  FFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHR LHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  659  GGYLYVCGDAKGMAKDVHRALHTIVQEQGSLDNSKTESFVKSLQMNGRYLRDVW  712



>gb|KHG09184.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=710

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ
Sbjct  597  FFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTI QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  657  GGYLYVCGDAKGMARDVHRALHTIFQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>gb|AAK56276.1|AF367288_1 AT4g30210/F9N11_60 [Arabidopsis thaliana]
 gb|AAL15387.1| AT4g30210/F9N11_60 [Arabidopsis thaliana]
Length=340

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  227  FFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQ  286

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  287  GAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  340



>gb|AIC73829.1| cytochrome P450 reductase [Panax ginseng]
Length=678

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            +FGCRNR++DFIYEEEL NF D G ISEL+VAFSREGP K+YVQHK++++AS+VW++IS+
Sbjct  565  YFGCRNRKLDFIYEEELNNFVDSGAISELVVAFSREGPTKEYVQHKMSQKASEVWNMISE  624

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTI QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  625  GAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAESLVKNLQMTGRYLRDVW  678



>gb|ACN54324.1| NADPH:cytochrome P450 reductase [Gossypium hirsutum]
Length=710

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W +ISQ
Sbjct  597  FFGCRNRKMDFIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKAKDIWDMISQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTI QEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  657  GGYLYVCGDAKGMARDVHRALHTIFQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>ref|NP_001063914.1| Os09g0558900 [Oryza sativa Japonica Group]
 dbj|BAD45947.1| putative NADPH-cytochrome P450 oxydoreductase isoform 3 [Oryza 
sativa Japonica Group]
 dbj|BAF25828.1| Os09g0558900 [Oryza sativa Japonica Group]
Length=714

 Score =   194 bits (492),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A ++WS+ISQ
Sbjct  601  FFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREGPSKEYVQHKMAEKAPEIWSIISQ  660

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRDVW
Sbjct  661  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRDVW  714



>gb|EEE61817.1| hypothetical protein OsJ_16444 [Oryza sativa Japonica Group]
Length=646

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+TE+A+++W+++SQ
Sbjct  533  FFGCRNRNMDYIYEDELQNFIQEGALSELIVAFSREGPAKEYVQHKMTEKATEIWNIVSQ  592

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM+GRYLRDVW
Sbjct  593  GGYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKSLQMDGRYLRDVW  646



>ref|XP_010523334.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like isoform X1 
[Tarenaya hassleriana]
Length=496

 Score =   191 bits (484),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 88/110 (80%), Positives = 99/110 (90%), Gaps = 1/110 (1%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL NF DQG +SELIVAFSREGP K+YVQHK+ E+A++VW L ++
Sbjct  210  FFGCRNRRMDFIYEDELYNFADQGALSELIVAFSREGPHKEYVQHKMVEKAAEVWKL-TK  268

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYL  368
            EGYLYVCGDAKGMARDVHRT+HTIVQEQE V SS+AEAIVKKLQ  GRYL
Sbjct  269  EGYLYVCGDAKGMARDVHRTMHTIVQEQEGVSSSEAEAIVKKLQTEGRYL  318



>emb|CAN77401.1| hypothetical protein VITISV_027794 [Vitis vinifera]
Length=745

 Score =   194 bits (492),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  632  FFGCRNRKMDYIYEDELNGFVESGALSELIVAFSREGPTKEYVQHKMMEKASDIWNVISQ  691

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  692  GGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMTGRYLRDVW  745



>ref|XP_010913661.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Elaeis guineensis]
Length=706

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELKNF ++G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  593  FFGCRNRKMDFIYEDELKNFVERGALSELIVAFSREGPTKEYVQHKMAEKASDIWNVISQ  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +D S+ E++VK LQM GRYLRDVW
Sbjct  653  GGYIYVCGDAKGMARDVHRALHTIVQEQGSLDGSRTESMVKSLQMEGRYLRDVW  706



>ref|NP_001136741.1| uncharacterized protein LOC100216882 [Zea mays]
 gb|ACF82516.1| unknown [Zea mays]
 gb|ACR38551.1| unknown [Zea mays]
Length=247

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE EL NF +QG +SEL++AFSR+G  K+YVQHK+ ++AS++W +ISQ
Sbjct  134  FFGCRNSKMDFIYEGELNNFVEQGALSELVLAFSRQGLAKEYVQHKMAQKASEIWDMISQ  193

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  194  GAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  247



>emb|CBI17838.3| unnamed protein product [Vitis vinifera]
Length=660

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  547  FFGCRNRKMDYIYEDELNGFVESGALSELIVAFSREGPTKEYVQHKMMEKASDIWNVISQ  606

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  607  GGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMTGRYLRDVW  660



>emb|CAE01547.2| OSJNBb0022F16.2 [Oryza sativa Japonica Group]
 emb|CAE03554.2| OSJNBa0060D06.20 [Oryza sativa Japonica Group]
Length=695

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+TE+A+++W+++SQ
Sbjct  582  FFGCRNRNMDYIYEDELQNFIQEGALSELIVAFSREGPAKEYVQHKMTEKATEIWNIVSQ  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM+GRYLRDVW
Sbjct  642  GGYIYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKSLQMDGRYLRDVW  695



>ref|XP_002270732.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
Length=705

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  592  FFGCRNRKMDYIYEDELNGFVESGALSELIVAFSREGPTKEYVQHKMMEKASDIWNVISQ  651

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  652  GGYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMTGRYLRDVW  705



>ref|XP_011079296.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Sesamum indicum]
Length=705

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF   G+ISELIVAFSREGP K+YVQHK+T++AS +W++IS+
Sbjct  592  FFGCRNRQMDFIYEDELNNFVKAGVISELIVAFSREGPTKEYVQHKMTQKASDIWNIISE  651

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ    SS+AE +VK LQM GRYLRDVW
Sbjct  652  GGYVYVCGDAKGMARDVHRTLHTIVQEQGSRSSSEAEGMVKNLQMTGRYLRDVW  705



>ref|XP_010525727.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Tarenaya hassleriana]
Length=713

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL+ F ++G +SEL+VAFSREGP K+YVQHK+ ++AS++W  ISQ
Sbjct  600  FFGCRNRRMDFIYEDELQRFVERGALSELVVAFSREGPTKEYVQHKMMDKASEMWKTISQ  659

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM+GRYLRDVW
Sbjct  660  GGYLYVCGDAKGMARDVHRALHTIVQEQGSMDSSKAESFVKNLQMSGRYLRDVW  713



>ref|XP_006381796.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|AAK15260.1|AF302497_1 NADPH-cytochrome P450 oxydoreductase isoform 2 [Populus trichocarpa 
x Populus deltoides]
 gb|ERP59593.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  599  FFGCRNRQMDFIYEDELNNFVESGALSELSVAFSREGPTKEYVQHKMMQKASDIWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTLHTIVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  659  GGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTESFVKGLQMNGRYLRDVW  712



>ref|XP_006661531.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=642

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF D G +S+L +AFSREGP K+YVQHK+TE+A ++WS+ISQ
Sbjct  529  FFGCRNRKMDFIYEDELNNFVDAGALSKLSIAFSREGPTKEYVQHKMTEKAPEIWSIISQ  588

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRDVW
Sbjct  589  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRDVW  642



>ref|XP_004148333.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
 gb|KGN61141.1| hypothetical protein Csa_2G059720 [Cucumis sativus]
Length=708

 Score =   192 bits (488),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF + G +SELI+AFSREGP K+YVQHK+ E+AS +W+L+SQ
Sbjct  595  FFGCRNRKMDYIYEDELNNFVETGALSELILAFSREGPSKEYVQHKMVEKASDIWNLLSQ  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLH IVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  655  GAYIYVCGDAKGMARDVHRTLHNIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  708



>ref|XP_004168364.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Cucumis sativus]
Length=708

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF + G +SELI+AFSREGP K+YVQHK+ E+AS +W+L+SQ
Sbjct  595  FFGCRNRKMDYIYEDELNNFVETGALSELILAFSREGPSKEYVQHKMVEKASDIWNLLSQ  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLH IVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  655  GAYIYVCGDAKGMARDVHRTLHNIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  708



>gb|EMT14573.1| NADPH--cytochrome P450 reductase [Aegilops tauschii]
Length=696

 Score =   192 bits (488),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+++WS++SQ
Sbjct  583  FFGCRNRQMDFIYEDELNNFAESGALSELVVAFSREGPTKEYVQHKMAEKAAELWSIVSQ  642

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E  VK LQM GRYLRDVW
Sbjct  643  GGYVYVCGDAKGMARDVHRMLHTIVQEQGSLDSSKTEGYVKNLQMEGRYLRDVW  696



>dbj|BAG68945.1| cytochrome P450 reductase [Lotus japonicus]
Length=706

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL +F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  593  FFGCRNRQMDYIYEDELNHFVNSGALSELIVAFSREGPTKEYVQHKMMEKASDIWNMISQ  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE +VK LQ+NGRYLRDVW
Sbjct  653  GAYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAEGMVKNLQLNGRYLRDVW  706



>ref|XP_002324469.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
 gb|EEF03034.1| putative NADPH-cytochrome P450 reductase family protein [Populus 
trichocarpa]
Length=712

 Score =   192 bits (488),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  599  FFGCRNRKMDFIYEDELNNFVESGALSELVVAFSREGPTKEYVQHKMMQKASDIWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHR LHTIVQEQ   D+S+ E+ VK LQMNGRYLRDVW
Sbjct  659  GGYLYVCGDAKGMAKDVHRALHTIVQEQGSFDNSRTESFVKSLQMNGRYLRDVW  712



>ref|XP_011010331.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Populus euphratica]
Length=712

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SEL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  599  FFGCRNRQMDFIYEDELNNFVESGALSELFVAFSREGPTKEYVQHKMMQKASDIWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTLH IVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  659  GGYLYVCGDAKGMAKDVHRTLHAIVQEQGSLDNSKTESFVKGLQMNGRYLRDVW  712



>ref|XP_007014268.1| P450 reductase 2 [Theobroma cacao]
 gb|EOY31887.1| P450 reductase 2 [Theobroma cacao]
Length=710

 Score =   192 bits (487),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF + G +SE++VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  597  FFGCRNRKMDYIYEDELNNFVNGGALSEIVVAFSREGPTKEYVQHKMMQKASDIWNMISQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTLHTI+QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  657  GGYLYVCGDAKGMAKDVHRTLHTILQEQGCLDSSKAESMVKNLQMTGRYLRDVW  710



>emb|CCO62220.1| putative cytochrome P450 reductase [Actaea racemosa]
Length=699

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL  F + G ++EL+VAFSREGP K YVQHK+TERAS +W++ISQ
Sbjct  586  FFGCRNRNMDYIYEDELNGFVEAGALTELVVAFSREGPNKQYVQHKMTERASDIWNMISQ  645

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTLHTIVQEQ  +D+SK E +VK +QM+GRYLRDVW
Sbjct  646  GGYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDNSKTEMMVKNMQMDGRYLRDVW  699



>gb|EMS66177.1| NADPH--cytochrome P450 reductase [Triticum urartu]
Length=676

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 3/122 (2%)
 Frame = -3

Query  712  VQLCC---FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERAS  542
            V+L C   FFGCRNR+MDFIYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A+
Sbjct  525  VELGCAILFFGCRNRQMDFIYEDELNNFAESGALSELVVAFSREGPTKEYVQHKMAEKAA  584

Query  541  QVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
            ++WS++SQ GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQ  GRYLRD
Sbjct  585  ELWSIVSQGGYVYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKNLQTEGRYLRD  644

Query  361  VW  356
            VW
Sbjct  645  VW  646



>gb|EAZ10065.1| hypothetical protein OsI_32371 [Oryza sativa Indica Group]
Length=717

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A ++WS+IS 
Sbjct  604  FFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREGPSKEYVQHKMAEKAPEIWSIISP  663

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRDVW
Sbjct  664  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRDVW  717



>emb|CAA89837.3| NADPH-cytochrome P450 reductase [Pseudotsuga menziesii]
Length=719

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+ELK++ + G+++EL++AFSREG  K+YVQHKITE+ S +W+LI+Q
Sbjct  606  FFGCRNRQMDYIYEDELKSYVENGVLTELVLAFSREGATKEYVQHKITEKGSYIWNLIAQ  665

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTLH+IVQEQE VDS+ AEA VKKLQ  GRYLRDVW
Sbjct  666  GGYLYVCGDAKGMARDVHRTLHSIVQEQESVDSTSAEATVKKLQTEGRYLRDVW  719



>gb|AAS00459.1| NADPH:cytochrome P450-reductase [Hypericum androsaemum]
Length=685

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYEEEL NF +QG +SELIVAFSREGPQKDYVQHK+ ++A+ +W ++SQ
Sbjct  572  FFGCRNRQMDYIYEEELNNFVEQGALSELIVAFSREGPQKDYVQHKMMDKAAYIWEVLSQ  631

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              ++YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E  VKKLQM+GRYLR+VW
Sbjct  632  GAHIYVCGDAKGMARDVHRTLHTIVQEQGNLDSSKTELFVKKLQMDGRYLRNVW  685



>gb|KDO43876.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=509

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+
Sbjct  396  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSE  455

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  456  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  509



>ref|XP_008391625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Malus domestica]
Length=712

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IYE+EL NF   G +SEL+VAFSR+GP K+YVQHK+ ++AS VW++ISQ
Sbjct  599  FFGCRNSQMDYIYEDELNNFLATGALSELVVAFSRQGPTKEYVQHKMMQKASDVWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE +VK LQMNGRYLRDVW
Sbjct  659  GGYIYVCGDAKGMARDVHRTLHTIVQEQGCMDSSKAEGLVKNLQMNGRYLRDVW  712



>ref|XP_008653023.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Zea mays]
 tpg|DAA62574.1| TPA: hypothetical protein ZEAMMB73_030302 [Zea mays]
Length=709

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/115 (76%), Positives = 102/115 (89%), Gaps = 1/115 (1%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF D G +SELIVAFSREGP K+YVQHK+ ++A+++WS+ISQ
Sbjct  595  FFGCRNRKMDFIYEDELNNFVDAGALSELIVAFSREGPTKEYVQHKMAQKAAELWSIISQ  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVD-SSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D +SKAE+ VK LQM GRYLRDVW
Sbjct  655  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSMDNNSKAESYVKSLQMEGRYLRDVW  709



>ref|XP_009382841.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+ELKNF + G +SELI+AFSREGP K+YVQHK+ E+A  +W++I Q
Sbjct  581  FFGCRNRKMDFIYEDELKNFVETGALSELILAFSREGPTKEYVQHKMAEKALDIWNIIEQ  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSK E++VK LQM+GRYLRDVW
Sbjct  641  GGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESMVKSLQMDGRYLRDVW  694



>ref|XP_006653834.1| PREDICTED: NADPH--cytochrome P450 reductase-like, partial [Oryza 
brachyantha]
Length=628

 Score =   190 bits (483),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+ ++A+++W+++SQ
Sbjct  515  FFGCRNRNMDYIYEDELENFLQEGALSELIVAFSREGPTKEYVQHKMVDKATEIWNILSQ  574

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM+GRYLRDVW
Sbjct  575  GGYLYVCGDAKGMARDVHRALHTIVQEQGSLDSSKTESYVKSLQMDGRYLRDVW  628



>ref|XP_004507858.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=705

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 103/115 (90%), Gaps = 1/115 (1%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++D+IYE+EL  F + G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  591  FFGCRNRQVDYIYEDELNQFVNGGALSELIVAFSREGPTKEYVQHKMMEKASDIWNMISQ  650

Query  517  EG-YLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            EG Y+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSKAE++VK LQMNGRYLRDVW
Sbjct  651  EGAYIYVCGDAKGMARDVHRTLHTILQEQGSLDSSKAESMVKNLQMNGRYLRDVW  705



>gb|AHA50098.1| CYP450 reductase [Panax ginseng]
Length=709

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            +FGCRNR++DFIYE+EL NF + G ISE++VAFSREGP K+YVQHK++++AS++W++IS+
Sbjct  596  YFGCRNRKLDFIYEDELNNFVESGAISEMVVAFSREGPTKEYVQHKMSQKASEIWNMISE  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTI QEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  656  GAYIYVCGDAKGMARDVHRTLHTIAQEQGALDSSKAESLVKNLQMTGRYLRDVW  709



>ref|XP_010914150.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=701

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF   G +SELIVAFSREGP K+YVQHK+ E+A  +W +IS+
Sbjct  588  FFGCRNRKMDFIYEDELNNFVKAGALSELIVAFSREGPAKEYVQHKMAEKAVDIWDIISK  647

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  648  GGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESMVKNLQMEGRYLRDVW  701



>gb|KJB22140.1| hypothetical protein B456_004G0316002, partial [Gossypium raimondii]
Length=398

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+AS +W++IS+
Sbjct  285  FFGCRNRKMDYIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKASDIWNMISE  344

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHRTL TI+ EQ  +DSSKAE++VK L   GRYLRDVW
Sbjct  345  GGYLYVCGDAKGMARDVHRTLLTILHEQGCLDSSKAESMVKNLHTTGRYLRDVW  398



>gb|AGC92176.1| cytochrome P450 oxidoreductase [Ocimum basilicum]
Length=707

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIY +EL NF + G+ISELIVAFSREGP K+YVQHK+T+RAS VW +IS 
Sbjct  594  FFGCRNRKMDFIYGDELNNFVEAGVISELIVAFSREGPTKEYVQHKMTQRASDVWKIISD  653

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI QEQ  + SS+AE +VK LQ  GRYLRDVW
Sbjct  654  GGYVYVCGDAKGMARDVHRTLHTIAQEQGSLSSSEAEGMVKNLQTTGRYLRDVW  707



>ref|XP_006453369.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66609.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=763

 Score =   191 bits (485),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+
Sbjct  650  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSE  709

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  710  GAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  763



>ref|XP_009795589.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=713

 Score =   191 bits (484),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IY+EEL NF + G +SEL+VAFSREGP K+YVQHK++E+A+ +W++ISQ
Sbjct  600  FFGCRNRQMDYIYQEELDNFLEAGALSELVVAFSREGPNKEYVQHKMSEKAADIWNMISQ  659

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTI Q+Q  +DSSKAEA+VK LQ+ GRYLRDVW
Sbjct  660  GGYVYVCGDAKGMARDVHRALHTIAQDQGSLDSSKAEALVKNLQITGRYLRDVW  713



>ref|XP_006453370.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
 gb|ESR66610.1| hypothetical protein CICLE_v10007535mg [Citrus clementina]
Length=764

 Score =   191 bits (484),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+
Sbjct  651  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSE  710

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  711  GAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  764



>gb|AFW59699.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=509

 Score =   187 bits (476),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+++W++IS 
Sbjct  396  FFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISH  455

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHT+VQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  456  GGYLYVCGDAKGMARDVHRMLHTVVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  509



>emb|CDP02981.1| unnamed protein product [Coffea canephora]
Length=662

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL +F   G +SELIVAFSREGP K YVQHK+ E+AS +WS++S+
Sbjct  549  FFGCRNRQMDYIYEDELNHFAKSGALSELIVAFSREGPTKQYVQHKMAEKASDIWSMLSE  608

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE+ VK LQM+GRYLRDVW
Sbjct  609  GAYVYVCGDAKGMARDVHRTLHTIVQEQGSMDSSKAESFVKNLQMSGRYLRDVW  662



>ref|XP_010265447.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nelumbo nucifera]
Length=704

 Score =   190 bits (483),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYEEEL  F   G +SEL++AFSREGP K+YVQHK+ E+AS VW++IS 
Sbjct  591  FFGCRNRKMDYIYEEELNGFVASGAMSELVIAFSREGPTKEYVQHKMMEKASDVWNMISN  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQ+Q  +DSSKAE++VK LQM GRYLRDVW
Sbjct  651  GGYIYVCGDAKGMARDVHRTLHTIVQQQGSLDSSKAESMVKNLQMEGRYLRDVW  704



>ref|XP_009384791.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=694

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -3

Query  721  LNLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERAS  542
            + L     FFGCRNR+MDFIYE+ELKNF   G +SELI+AFSREGP K+YVQHK+ E+AS
Sbjct  573  MQLGHATLFFGCRNRKMDFIYEDELKNFVGTGALSELILAFSREGPTKEYVQHKMAEKAS  632

Query  541  QVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
             +W++ISQ GY+YVCGD+KGMA+DVHR LHTI+Q Q  +DSSK E++VK LQM+GRYLRD
Sbjct  633  DIWNIISQGGYIYVCGDSKGMAKDVHRALHTIIQGQGSLDSSKTESMVKGLQMDGRYLRD  692

Query  361  VW  356
            VW
Sbjct  693  VW  694



>ref|XP_004957625.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=705

 Score =   190 bits (482),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF D G +SELIVAFSREGP K+YVQHK+ ++A  +WS+ISQ
Sbjct  592  FFGCRNRKMDFIYEDELSNFVDTGALSELIVAFSREGPTKEYVQHKMAQKAGVLWSIISQ  651

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI+QEQ  +D+SK E+ VK LQ  GRYLRDVW
Sbjct  652  GGYIYVCGDAKGMARDVHRTLHTIIQEQGSLDNSKTESYVKSLQTEGRYLRDVW  705



>ref|XP_009607226.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=713

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IY+EEL NF + G +SEL+VAFSREGP K+YVQHK++E+A+ +W++ISQ
Sbjct  600  FFGCRNRQMDYIYQEELDNFLEAGALSELVVAFSREGPNKEYVQHKMSEKAADIWNMISQ  659

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI Q+Q  +DSSKAE +VK LQ  GRYLRDVW
Sbjct  660  GGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSKAEGLVKNLQTTGRYLRDVW  713



>dbj|BAJ41269.1| NADPH-P450 reductase 2 [Zingiber officinale]
Length=701

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            +FGCRNR+MDFIYE+EL NF + G +SELIVAFSREGP K YVQHK+TE+A+++W++ISQ
Sbjct  588  YFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREGPTKQYVQHKMTEKATELWNIISQ  647

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTI QEQ  +DSSK E+ +K LQM GRYLRDVW
Sbjct  648  GGYVYVCGDAKGMARDVHRVLHTIAQEQGGMDSSKTESFIKSLQMEGRYLRDVW  701



>emb|CDY14183.1| BnaA08g13140D [Brassica napus]
Length=696

 Score =   190 bits (482),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++A  +WS+ISQ
Sbjct  583  FFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKACDIWSMISQ  642

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  643  GGYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  696



>gb|EEE70211.1| hypothetical protein OsJ_30318 [Oryza sativa Japonica Group]
Length=795

 Score =   190 bits (483),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A ++WS+ISQ
Sbjct  626  FFGCRNRKMDFIYEDELNNFVETGALSELIVAFSREGPSKEYVQHKMAEKAPEIWSIISQ  685

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+S  E+ VK LQM GRYLRD
Sbjct  686  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSNTESYVKSLQMEGRYLRD  737



>emb|CDY28169.1| BnaA01g06800D [Brassica napus]
Length=696

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +WS+ISQ
Sbjct  583  FFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWSMISQ  642

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  643  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  696



>gb|KDO43875.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=554

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+
Sbjct  441  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSE  500

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  501  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  554



>ref|XP_009108997.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Brassica rapa]
Length=707

 Score =   189 bits (481),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++A  +WS+ISQ
Sbjct  594  FFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKACDIWSMISQ  653

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  654  GGYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  707



>gb|KDO43874.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=555

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+
Sbjct  442  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSE  501

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  502  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  555



>ref|XP_007227446.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
 gb|EMJ28645.1| hypothetical protein PRUPE_ppa002142mg [Prunus persica]
Length=710

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN + D+IYE+EL NF + G +SEL+VAFSR+GP K+YVQHK+T++AS +W+++SQ
Sbjct  597  FFGCRNSKTDYIYEDELNNFLETGALSELVVAFSRQGPTKEYVQHKMTQKASDIWNMLSQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  657  GAYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>ref|XP_004296434.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Fragaria vesca 
subsp. vesca]
Length=709

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IYE+EL NF ++G +SEL+VAFSR+GP K+YVQHK+ ++AS +W++ISQ
Sbjct  596  FFGCRNSQMDYIYEDELNNFVEKGALSELVVAFSRQGPTKEYVQHKMMQKASDIWNMISQ  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMA+DVHRTLHTI+QEQ  +DSSKAE++VK LQ NGRYLRDVW
Sbjct  656  GGYIYVCGDAKGMAKDVHRTLHTILQEQGSLDSSKAESMVKNLQTNGRYLRDVW  709



>emb|CAA81210.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus]
Length=506

 Score =   187 bits (474),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+AS +W L+S+
Sbjct  393  FFGCRNRKVDFIYEDELNNFVETGALSELIVAFSREGPTKEYVQHKMNEKASDLWKLLSE  452

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQ  GRYLRDVW
Sbjct  453  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELFVKNLQCRGRYLRDVW  506



>ref|XP_002444097.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
 gb|EES13592.1| hypothetical protein SORBIDRAFT_07g007640 [Sorghum bicolor]
Length=706

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE+EL NF +QG +SEL++AFSR+GP K+YVQHK+ ++AS++W +ISQ
Sbjct  593  FFGCRNSKMDFIYEDELNNFLEQGALSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQ  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  653  GAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  706



>ref|XP_008223694.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Prunus mume]
Length=710

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN + D+IYE+EL NF + G +SEL+VAFSR+GP K+YVQHK+T++AS +W+++SQ
Sbjct  597  FFGCRNSKTDYIYEDELNNFLETGALSELVVAFSRQGPTKEYVQHKMTQKASDIWNMLSQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM+GRYLRDVW
Sbjct  657  GAYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMSGRYLRDVW  710



>ref|XP_010438203.1| PREDICTED: NADPH--cytochrome P450 reductase 2 [Camelina sativa]
Length=709

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  596  FFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISQ  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  656  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  709



>ref|XP_010447751.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=710

 Score =   189 bits (481),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  597  FFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  657  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  710



>ref|XP_003578634.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=697

 Score =   189 bits (480),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 83/126 (66%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = -3

Query  733  RKMVLNLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKIT  554
            +++ + L +   FFGCRNR+MDFIYE+EL NF D G +SELIVAFSR+GP K+YVQHK+ 
Sbjct  572  KEIGVELGRAILFFGCRNRKMDFIYEDELNNFADAGALSELIVAFSRDGPTKEYVQHKMA  631

Query  553  ERASQVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGR  374
             +A ++WS+ISQ GY+YVCGDAKGMARDVHR LHTIVQ Q  +D+SK E+ +K LQM GR
Sbjct  632  AKAPELWSIISQGGYIYVCGDAKGMARDVHRVLHTIVQGQGSLDNSKTESYMKNLQMEGR  691

Query  373  YLRDVW  356
            YLRDVW
Sbjct  692  YLRDVW  697



>gb|AAZ39649.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=715

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IY+EEL NF + G +SEL+VAFSREGP K YVQHK+TE+A+ +W++ISQ
Sbjct  602  FFGCRNSKMDYIYQEELNNFLEAGALSELVVAFSREGPNKQYVQHKMTEKAADIWNMISQ  661

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI Q+Q  +DS+KAE +VK LQ  GRYLRDVW
Sbjct  662  GGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSTKAEGMVKNLQTTGRYLRDVW  715



>ref|XP_010688489.1| PREDICTED: NADPH--cytochrome P450 reductase [Beta vulgaris subsp. 
vulgaris]
Length=705

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -3

Query  721  LNLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERAS  542
            ++L Q   FFGCRNR++DFIYE+EL+NF + G++SEL+VAFSREGP K+YVQHK+ ERAS
Sbjct  584  VDLGQAILFFGCRNRKVDFIYEDELQNFVETGVLSELVVAFSREGPTKEYVQHKMMERAS  643

Query  541  QVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
             VW++I+Q GY+YVCGDAKGMARDVHR LHTI+QEQ  + SS+AE +VK LQ  GRYLRD
Sbjct  644  DVWNVINQGGYVYVCGDAKGMARDVHRVLHTILQEQGGMGSSQAEGMVKNLQTTGRYLRD  703

Query  361  VW  356
            VW
Sbjct  704  VW  705



>gb|AGX85599.1| NADPH:cytochrome P450 reductase [Scoparia dulcis]
Length=713

 Score =   189 bits (480),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN+ MD+IYE+EL  F + G+ISEL++AFSR+GP K+YVQHK+ E+AS +W++IS+
Sbjct  600  FFGCRNKEMDYIYEDELNGFVEAGVISELVLAFSRQGPTKEYVQHKMAEKASDLWNMISE  659

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+SKAE +VK LQM+GRYLRDVW
Sbjct  660  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDNSKAELMVKNLQMSGRYLRDVW  713



>ref|XP_009130253.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Brassica 
rapa]
Length=681

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +WS+ISQ
Sbjct  568  FFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWSMISQ  627

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRY+RDVW
Sbjct  628  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYIRDVW  681



>ref|XP_008789667.1| PREDICTED: NADPH--cytochrome P450 reductase [Phoenix dactylifera]
Length=706

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+ELK F + G +SELIVAFSREG  K+YVQHK+ E+AS +W++ISQ
Sbjct  593  FFGCRNRKLDFIYEDELKFFVETGGLSELIVAFSREGTTKEYVQHKMAEKASDIWNIISQ  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  653  GGYIYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESMVKSLQMEGRYLRDVW  706



>ref|XP_008383105.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Malus 
domestica]
Length=709

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IYE+EL NF +   +SEL+VAFSR+GP K+YVQHK+ ++AS VW++ISQ
Sbjct  596  FFGCRNSKMDYIYEDELNNFLETSALSELVVAFSRQGPTKEYVQHKMIQKASDVWNMISQ  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  + SSKAE++VK LQMNGRYLRDVW
Sbjct  656  GGYIYVCGDAKGMARDVHRTLHTIVQEQGCMGSSKAESLVKNLQMNGRYLRDVW  709



>ref|XP_008383106.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Malus 
domestica]
Length=708

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IYE+EL NF +   +SEL+VAFSR+GP K+YVQHK+ ++AS VW++ISQ
Sbjct  595  FFGCRNSKMDYIYEDELNNFLETSALSELVVAFSRQGPTKEYVQHKMIQKASDVWNMISQ  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  + SSKAE++VK LQMNGRYLRDVW
Sbjct  655  GGYIYVCGDAKGMARDVHRTLHTIVQEQGCMGSSKAESLVKNLQMNGRYLRDVW  708



>gb|ADC94831.1| cytochrome P450 reductase [Perilla frutescens]
Length=709

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE+EL +F   G++SEL++AFSREGP K+YVQHK+ ++A  +W++IS+
Sbjct  596  FFGCRNSKMDFIYEDELNHFVKAGVVSELVLAFSREGPTKEYVQHKMAQKALDLWNMISE  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ VK LQMNGRYLRDVW
Sbjct  656  GGYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESFVKNLQMNGRYLRDVW  709



>gb|KDO43868.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=715

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+
Sbjct  602  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSE  661

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  662  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  715



>gb|KDO43871.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=714

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+
Sbjct  601  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSE  660

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  661  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  714



>dbj|BAD05443.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
 dbj|BAD05639.1| putative cytochrome P450 reductase [Oryza sativa Japonica Group]
Length=568

 Score =   187 bits (474),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE+EL  F ++G +SEL++AFSREGP K+YVQHK++++AS++W +ISQ
Sbjct  455  FFGCRNSKMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQ  514

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  515  GGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  568



>gb|KDO43870.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=687

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+
Sbjct  574  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSE  633

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  634  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  687



>gb|KDO43869.1| hypothetical protein CISIN_1g005072mg [Citrus sinensis]
Length=710

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++S +W+++S+
Sbjct  597  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPTKEYVQHKMMEKSSDIWNMLSE  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAK MARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  657  GAYLYVCGDAKSMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  710



>emb|CDX68634.1| BnaC01g08190D [Brassica napus]
Length=712

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS++W++IS+
Sbjct  599  FFGCRNRRMDFIYEEELQGFLESGALSELSVAFSREGPTKEYVQHKMMDKASEIWNMISE  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  659  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  712



>ref|XP_006845640.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
 gb|ERN07315.1| hypothetical protein AMTR_s00019p00222550 [Amborella trichopoda]
Length=711

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 99/113 (88%), Gaps = 0/113 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN RMDFIYE+EL NF +QG++SELI+AFSREGP K+YVQHK+ ++AS +W +IS+
Sbjct  595  FFGCRNHRMDFIYEDELNNFVEQGVLSELIIAFSREGPTKEYVQHKMIDKASSLWEIISR  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDV  359
             GYLYVCGDAKGMARDVHRTLHTIVQEQ  ++SS AEA+VK LQ  GRYLRDV
Sbjct  655  GGYLYVCGDAKGMARDVHRTLHTIVQEQGSMESSPAEAMVKNLQTEGRYLRDV  707



>ref|XP_006283224.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
 gb|EOA16122.1| hypothetical protein CARUB_v10004254mg [Capsella rubella]
Length=710

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ +RAS +W++ISQ
Sbjct  597  FFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDRASDIWNMISQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  657  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  710



>emb|CDY03543.1| BnaC03g68020D [Brassica napus]
Length=710

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/114 (74%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++A  +WS+ISQ
Sbjct  597  FFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKACDIWSMISQ  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  657  GGYVYVCGDAKGMARDVHRYLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  710



>ref|XP_010548619.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Tarenaya 
hassleriana]
Length=714

 Score =   188 bits (478),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYE+EL+ F + G +SEL+VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  601  FFGCRNRRMDFIYEDELQRFVESGALSELVVAFSREGPTKEYVQHKMIDKASDIWNMISQ  660

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHR LHTIVQEQ  +D SKAE+ VK LQ +GRYLRDVW
Sbjct  661  GAYLYVCGDAKGMARDVHRALHTIVQEQGSMDGSKAESFVKNLQTSGRYLRDVW  714



>ref|NP_001159331.1| uncharacterized protein LOC100304425 [Zea mays]
 gb|ACN25819.1| unknown [Zea mays]
 gb|ACN28051.1| unknown [Zea mays]
 gb|AFW59698.1| hypothetical protein ZEAMMB73_961001 [Zea mays]
Length=694

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+++W++IS 
Sbjct  581  FFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISH  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHT+VQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  641  GGYLYVCGDAKGMARDVHRMLHTVVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  694



>ref|XP_002447240.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
 gb|EES11568.1| hypothetical protein SORBIDRAFT_06g031110 [Sorghum bicolor]
Length=694

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+ F ++G +SELI+AFSREGP K+YVQHK+ E+A+++W++IS 
Sbjct  581  FFGCRNRNMDYIYEDELQTFLEEGALSELIIAFSREGPTKEYVQHKMVEKATEIWNIISH  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  641  GGYLYVCGDAKGMARDVHRMLHTIVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  694



>ref|XP_010259920.1| PREDICTED: NADPH--cytochrome P450 reductase [Nelumbo nucifera]
Length=705

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL  + + G++SE +VAFSREGP K+YVQHK+ E+AS VW++IS+
Sbjct  592  FFGCRNRKMDYIYEDELNGYVNSGVLSEFVVAFSREGPTKEYVQHKMMEKASNVWNIISK  651

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLH IVQEQ  +DSS+AE+++K LQM GRYLRDVW
Sbjct  652  GGYIYVCGDAKGMARDVHRTLHAIVQEQGSLDSSQAESMIKNLQMEGRYLRDVW  705



>ref|XP_010433014.1| PREDICTED: NADPH--cytochrome P450 reductase 2-like [Camelina 
sativa]
Length=709

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++ELIVAFSREGP K+YVQHK+ ++AS +W++IS+
Sbjct  596  FFGCRNRRMDFIYEEELQRFVESGALAELIVAFSREGPTKEYVQHKMMDKASDIWNMISR  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQM+GRYLRDVW
Sbjct  656  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQMSGRYLRDVW  709



>ref|XP_003579401.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Brachypodium 
distachyon]
Length=692

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+NF  +G +SEL+VA+SREGP K+YVQHK+ E+A+++W++ISQ
Sbjct  579  FFGCRNRNMDYIYEDELQNFLQEGALSELVVAYSREGPTKEYVQHKMVEKATEIWNIISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  639  GGYVYVCGDAKGMARDVHRVLHTIVQEQGSLDNSKTESYVKSLQMEGRYLRDVW  692



>ref|XP_003541616.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL +F + G +SELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ
Sbjct  594  FFGCRNRQMDYIYEDELNHFVNTGALSELILAFSREGPTKEYVQHKMMEKASEIWSMISQ  653

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  654  GAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQTTGRYLRDVW  707



>ref|NP_001061346.1| Os08g0243500, partial [Oryza sativa Japonica Group]
 dbj|BAF23260.1| Os08g0243500, partial [Oryza sativa Japonica Group]
Length=651

 Score =   187 bits (475),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE+EL  F ++G +SEL++AFSREGP K+YVQHK++++AS++W +ISQ
Sbjct  538  FFGCRNSKMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQ  597

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  598  GGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  651



>gb|KHN22700.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=707

 Score =   187 bits (476),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL +F + G +SELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ
Sbjct  594  FFGCRNRQMDYIYEDELNHFVNTGALSELILAFSREGPTKEYVQHKMMEKASEIWSMISQ  653

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  654  GAYIYVCGDAKGMARDVHRALHTILQEQGALDSSKAESMVKNLQTTGRYLRDVW  707



>gb|EEE68301.1| hypothetical protein OsJ_26563 [Oryza sativa Japonica Group]
Length=711

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE+EL  F ++G +SEL++AFSREGP K+YVQHK++++AS++W +ISQ
Sbjct  598  FFGCRNSKMDFIYEDELNTFLEEGALSELVLAFSREGPTKEYVQHKMSQKASEIWDMISQ  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  658  GGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  711



>emb|CDY51656.1| BnaAnng10960D [Brassica napus]
Length=706

 Score =   187 bits (474),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +W++IS+
Sbjct  593  FFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWNMISE  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  653  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  706



>gb|AHB33950.1| cytochrome P450 reductase [Santalum album]
Length=704

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL +F + G +SELIVAFSREGP K YVQHK+ E+AS++W++IS 
Sbjct  591  FFGCRNRKMDYIYEDELAHFVEAGALSELIVAFSREGPAKQYVQHKMMEKASEIWNMISD  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMA+DVHR LHTIV EQ  +D+SK E++VK LQMNGRYLRDVW
Sbjct  651  GGYVYVCGDAKGMAKDVHRALHTIVHEQGSLDNSKTESMVKNLQMNGRYLRDVW  704



>ref|XP_006659239.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Oryza brachyantha]
Length=568

 Score =   185 bits (470),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE EL  F ++G +SEL++AFSREGP K+YVQHK+ ++AS++W +ISQ
Sbjct  455  FFGCRNSKMDFIYENELNTFLEEGALSELVLAFSREGPTKEYVQHKMAQKASEIWDVISQ  514

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQ  GRYLRDVW
Sbjct  515  GGYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKSLQTEGRYLRDVW  568



>ref|XP_006474186.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Citrus 
sinensis]
Length=714

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+
Sbjct  601  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSE  660

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  661  GAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  714



>ref|XP_006412733.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
 gb|ESQ54186.1| hypothetical protein EUTSA_v10024546mg [Eutrema salsugineum]
Length=711

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL +AFSREGP K+YVQHK+ ++AS +WS+IS+
Sbjct  598  FFGCRNRRMDFIYEEELQRFLESGALSELSLAFSREGPTKEYVQHKMMDKASDIWSMISE  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  658  GAYVYVCGDAKGMARDVHRSLHTIAQEQGPMDSTKAESFVKNLQMSGRYLRDVW  711



>dbj|BAJ33878.1| unnamed protein product [Thellungiella halophila]
Length=711

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL +AFSREGP K+YVQHK+ ++AS +WS+IS+
Sbjct  598  FFGCRNRRMDFIYEEELQRFLESGALSELSLAFSREGPTKEYVQHKMMDKASDIWSMISE  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  658  GAYVYVCGDAKGMARDVHRSLHTIAQEQGPMDSTKAESFVKNLQMSGRYLRDVW  711



>ref|XP_006474185.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Citrus 
sinensis]
Length=715

 Score =   187 bits (474),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF   G +S+LIVAFSREGP K+YVQHK+ E++  +W+++S+
Sbjct  602  FFGCRNRKMDYIYEDELNNFVQSGALSQLIVAFSREGPIKEYVQHKMMEKSWDIWNMLSE  661

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  662  GAYLYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKAESMVKNLQMTGRYLRDVW  715



>emb|CBX24555.1| NADPH:cytochrome P450 reductase [Salvia miltiorrhiza]
Length=705

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MDFIYE+EL +F   G ISELIVAFSREGP K+YVQHK+++RAS +W +IS 
Sbjct  592  FFGCRNRKMDFIYEDELNSFVKVGAISELIVAFSREGPAKEYVQHKMSQRASDIWKMISD  651

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTI QEQ  + SS+AE +VK LQ  GRYLRDVW
Sbjct  652  GGYMYVCGDAKGMARDVHRTLHTIAQEQGSLSSSEAEGMVKNLQTTGRYLRDVW  705



>emb|CDX72222.1| BnaC07g42440D [Brassica napus]
Length=708

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G +SEL VAFSREGP K+YVQHK+ ++AS +W++IS+
Sbjct  595  FFGCRNRRMDFIYEEELQRFLESGALSELSVAFSREGPTKEYVQHKMMDKASDIWNMISE  654

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE+ VK LQM+GRYLRDVW
Sbjct  655  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAESFVKNLQMSGRYLRDVW  708



>gb|AAC05022.1| NADPH:ferrihemoprotein oxidoreductase [Eschscholzia californica]
Length=705

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYEEEL NF  +G ISE++VAFSREG  K+YVQHK+ E+AS +W +ISQ
Sbjct  592  FFGCRNRQMDYIYEEELNNFVKEGAISEVVVAFSREGATKEYVQHKMAEKASYIWEMISQ  651

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHRTLHTI QEQ  +D+SK E++VK LQM+GRYLRDVW
Sbjct  652  GAYLYVCGDAKGMARDVHRTLHTIAQEQGSLDNSKTESLVKNLQMDGRYLRDVW  705



>gb|ABB88839.2| NADPH cytochrome P450 reductase [Stevia rebaudiana]
Length=710

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SELIVAFSREG  K+YVQHK++++AS +W L+S+
Sbjct  597  FFGCRNRKVDFIYEDELNNFVETGALSELIVAFSREGTAKEYVQHKMSQKASDIWKLLSE  656

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM+GRYLRDVW
Sbjct  657  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMSGRYLRDVW  710



>ref|XP_004960247.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Setaria 
italica]
Length=694

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN  +D+IYE+EL+NF  +G +SELIVAFSREGP K+YVQHK+ E+A+++W++ISQ
Sbjct  581  FFGCRNCNVDYIYEDELQNFLQEGALSELIVAFSREGPTKEYVQHKMVEKATEIWNIISQ  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVHR LHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  641  GGYLYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKTESYVKSLQMEGRYLRDVW  694



>gb|EYU42400.1| hypothetical protein MIMGU_mgv1a002170mg [Erythranthe guttata]
Length=705

 Score =   186 bits (473),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIY++EL NF + G+ISEL +AFSR+GP K+YVQHK+ ++A+ VW++IS+
Sbjct  592  FFGCRNSKMDFIYQDELSNFVEAGVISELDLAFSRDGPTKEYVQHKMAQKAADVWNMISE  651

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLH IVQEQ  +D+SK E+ VK LQMNGRYLRDVW
Sbjct  652  GGYVYVCGDAKGMARDVHRTLHAIVQEQGSLDNSKTESFVKNLQMNGRYLRDVW  705



>ref|XP_004242931.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=715

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = -3

Query  718  NLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQ  539
            +L     FFGCRNR+MD+IY++EL NF + G +S L+VAFSREGP K+YVQHK+T++A  
Sbjct  595  DLGPAVLFFGCRNRQMDYIYQDELDNFLEAGALSNLVVAFSREGPNKEYVQHKMTQKADD  654

Query  538  VWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDV  359
            +W++ISQ GY+YVCGDAKGMARDVHRTLHTI Q+Q  +DSSKAE+ VK LQ  GRYLRDV
Sbjct  655  IWNMISQGGYVYVCGDAKGMARDVHRTLHTIAQDQGSLDSSKAESFVKNLQTTGRYLRDV  714

Query  358  W  356
            W
Sbjct  715  W  715



>ref|XP_003610110.1| NADPH cytochrome P450 reductase [Medicago truncatula]
Length=490

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++D+IYE+EL +F   G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  377  FFGCRNRQVDYIYEDELNHFVHGGALSELIVAFSREGPTKEYVQHKMIEKASDIWNMISQ  436

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMA+DVHRTLHTI+QEQ  +D+SK E++VK LQM GRYLRDVW
Sbjct  437  GAYIYVCGDAKGMAKDVHRTLHTILQEQGSLDNSKTESMVKNLQMTGRYLRDVW  490



>gb|ABL09938.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+
Sbjct  591  FFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSE  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  651  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>gb|KHN17598.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=715

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL +F + G + ELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ
Sbjct  602  FFGCRNRQMDYIYEDELSHFVNTGALDELILAFSREGPTKEYVQHKMMEKASEIWSMISQ  661

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  662  GAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQTTGRYLRDVW  715



>ref|XP_008661364.1| PREDICTED: uncharacterized protein LOC100192720 isoform X1 [Zea 
mays]
 gb|AFW57103.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=699

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN  MDFIYE+EL NF +QG + EL++AFSR+GP K+YVQHK+ ++AS++W +ISQ
Sbjct  586  FFGCRNSNMDFIYEDELSNFLEQGALFELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQ  645

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  646  GAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  699



>ref|XP_003549436.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
Length=707

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL +F + G + ELI+AFSREGP K+YVQHK+ E+AS++WS+ISQ
Sbjct  594  FFGCRNRQMDYIYEDELSHFVNTGALDELILAFSREGPTKEYVQHKMMEKASEIWSMISQ  653

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTI+QEQ  +DSSKAE++VK LQ  GRYLRDVW
Sbjct  654  GAYIYVCGDAKGMARDVHRALHTILQEQGSLDSSKAESMVKNLQTTGRYLRDVW  707



>gb|AAC09468.2| putative NADPH-cytochrome P450 reductase [Pisum sativum]
Length=704

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++D+IYE+EL +F + G +SELIVAFSR+GP K+YVQHK+ E+AS +W++ISQ
Sbjct  591  FFGCRNRQVDYIYEDELNHFVNGGALSELIVAFSRDGPTKEYVQHKMMEKASDIWNMISQ  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTI+QEQ  +DSSK E++VK LQM GRYLRDVW
Sbjct  651  GAYVYVCGDAKGMARDVHRTLHTILQEQGSLDSSKTESMVKNLQMTGRYLRDVW  704



>gb|ABM88789.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+
Sbjct  591  FFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSE  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  651  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>gb|ABI98819.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+
Sbjct  591  FFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSE  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  651  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>gb|ABC47946.1| cytochrome P450 reductase [Artemisia annua]
 gb|AEQ63685.1| cytochrome P450 reductase [synthetic construct]
Length=704

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++AS +W+L+S+
Sbjct  591  FFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKASDIWNLLSE  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  651  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>emb|CAA46815.1| NADPH-ferrihemoprotein reductase [Arabidopsis thaliana]
Length=712

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  599  FFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  659  GAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  712



>gb|AAC05021.1| NADPH:ferrihemoprotein oxidoreductase [Papaver somniferum]
 gb|AHF27398.1| NADPH:ferrihemoprotein oxidoreductase [synthetic construct]
Length=683

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 100/114 (88%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MDFIYE+EL NF ++G+ISEL++AFSREG +K+YVQHK+ E+A+ VW++IS 
Sbjct  570  FFGCRNRNMDFIYEDELNNFVERGVISELVIAFSREGEKKEYVQHKMMEKATDVWNVISG  629

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            +GYLYVCGDAKGMARDVHRTLHTI QEQ  ++SS AEA VKKLQ+  RYLRDVW
Sbjct  630  DGYLYVCGDAKGMARDVHRTLHTIAQEQGPMESSAAEAAVKKLQVEERYLRDVW  683



>ref|NP_849472.2| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 gb|AEE85737.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=712

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  599  FFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQ  658

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  659  GAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  712



>ref|NP_194750.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
 sp|Q9SUM3.1|NCPR2_ARATH RecName: Full=NADPH--cytochrome P450 reductase 2 [Arabidopsis 
thaliana]
 gb|AAK17169.1|AF325101_1 NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB52465.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 emb|CAB81014.1| NADPH-ferrihemoprotein reductase (ATR2) [Arabidopsis thaliana]
 gb|AEE85738.1| NADPH--cytochrome P450 reductase 2 [Arabidopsis thaliana]
Length=711

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  598  FFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQ  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ +GRYLRDVW
Sbjct  658  GAYLYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTSGRYLRDVW  711



>ref|XP_007154761.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
 gb|ESW26755.1| hypothetical protein PHAVU_003G145400g [Phaseolus vulgaris]
Length=707

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IYE+EL +F + G +SELIVAFSREGP K YVQH++ E+AS++WS+ISQ
Sbjct  594  FFGCRNSQMDYIYEDELNHFINSGALSELIVAFSREGPTKKYVQHEMLEKASEIWSMISQ  653

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTI+QEQ  +DS+KAE++VK LQ NGRYLRDVW
Sbjct  654  GAYIYVCGDAKGMARDVHRALHTILQEQGSMDSTKAESMVKSLQTNGRYLRDVW  707



>ref|XP_010929254.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Elaeis guineensis]
Length=704

 Score =   185 bits (470),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFG RNR+MDFIYE+EL NF + G +SELIVAFSREGP K+YVQHK+ E+A  +W +IS+
Sbjct  591  FFGSRNRKMDFIYEDELSNFVNTGALSELIVAFSREGPAKEYVQHKMAEKAVVIWDIISK  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             G++YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE++VK LQM GRYLRDVW
Sbjct  651  GGHIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESMVKNLQMEGRYLRDVW  704



>ref|XP_008667834.1| PREDICTED: uncharacterized protein LOC100279923 isoform X2 [Zea 
mays]
 tpg|DAA35632.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=694

 Score =   185 bits (469),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+ +W++IS 
Sbjct  581  FFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATDIWNIISN  640

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVH+ LHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  641  GGYLYVCGDAKGMARDVHKMLHTIVQEQGSLDNSKTESYVKSLQMEGRYLRDVW  694



>ref|XP_008667833.1| PREDICTED: uncharacterized protein LOC100279923 isoform X1 [Zea 
mays]
 tpg|DAA35631.1| TPA: hypothetical protein ZEAMMB73_666259 [Zea mays]
Length=695

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYE+EL+ F ++G +SELIVAFSREGP K+YVQHK+ E+A+ +W++IS 
Sbjct  582  FFGCRNRNMDYIYEDELQTFLEEGALSELIVAFSREGPTKEYVQHKMVEKATDIWNIISN  641

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMARDVH+ LHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  642  GGYLYVCGDAKGMARDVHKMLHTIVQEQGSLDNSKTESYVKSLQMEGRYLRDVW  695



>ref|XP_009408053.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Musa acuminata 
subsp. malaccensis]
Length=705

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = -3

Query  721  LNLVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERAS  542
            + L +   FFGCRN +MDFIY++EL NF + GI+SELIVA SREGP K+YVQHK+TE+AS
Sbjct  584  MQLGRAILFFGCRNSKMDFIYKDELNNFVETGILSELIVALSREGPIKEYVQHKMTEKAS  643

Query  541  QVWSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRD  362
             +W++ISQ GY+YVCGDAKGMARDVH+ LHTI QEQ  +D SK E++VK LQ  GRYLRD
Sbjct  644  DIWNIISQGGYVYVCGDAKGMARDVHKVLHTICQEQGSLDGSKTESLVKSLQTEGRYLRD  703

Query  361  VW  356
            VW
Sbjct  704  VW  705



>gb|EPS66345.1| hypothetical protein M569_08425 [Genlisea aurea]
Length=683

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IYE+EL+ F   G ISELIVAFSREGP K+YVQHK+ E A+ +W LIS+
Sbjct  570  FFGCRNSKMDYIYEDELQTFVKDGAISELIVAFSREGPSKEYVQHKMAEGAADLWKLISE  629

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTIVQEQ  +DSSK E+ VK LQM GRYLRDVW
Sbjct  630  GAYVYVCGDAKGMARDVHRTLHTIVQEQGSLDSSKTESFVKNLQMTGRYLRDVW  683



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score =   184 bits (467),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE+EL NF  QG+ISEL+VAFSREGPQK YVQHK+ ++A+++WS+ISQ
Sbjct  579  FFGCRNHQMDFIYEDELNNFAAQGVISELLVAFSREGPQKXYVQHKMVDKAAEIWSIISQ  638

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVC DAKGMARDVH TL  IVQEQ  +DSSK E++VKKLQ+ GRYLRDVW
Sbjct  639  GSYLYVCDDAKGMARDVHWTLRAIVQEQGGLDSSKTESMVKKLQIEGRYLRDVW  692



>ref|XP_002869386.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45645.1| hypothetical protein ARALYDRAFT_913457 [Arabidopsis lyrata subsp. 
lyrata]
Length=711

 Score =   184 bits (467),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++EL VAFSREGP K+YVQHK+ ++AS +W++ISQ
Sbjct  598  FFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKEYVQHKMMDKASDIWNMISQ  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ  GRYLRDVW
Sbjct  658  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTTGRYLRDVW  711



>gb|AFO64618.1| cytochrome P450 reductase [Artemisia annua]
Length=704

 Score =   184 bits (466),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SEL+ AFSREG  K+YVQHK+T++ S +W+L+S+
Sbjct  591  FFGCRNRKVDFIYEDELNNFVETGALSELVTAFSREGATKEYVQHKMTQKTSDIWNLLSE  650

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  651  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  704



>gb|KFK29577.1| nadph-ferrihemoprotein reductase [Arabis alpina]
Length=715

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNRRMDFIYEEEL+ F + G ++EL VAFSREGP K YVQHK+ ++AS++WS+IS+
Sbjct  602  FFGCRNRRMDFIYEEELQRFVESGALAELSVAFSREGPTKQYVQHKMMDKASEIWSMISE  661

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR+LHTI QEQ  +DS+KAE  VK LQ  GRYLRDVW
Sbjct  662  GAYVYVCGDAKGMARDVHRSLHTIAQEQGSMDSTKAEGFVKNLQTTGRYLRDVW  715



>gb|AAB97736.1| NADPH cytochrome P450 reductase [Petroselinum crispum]
Length=681

 Score =   183 bits (465),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/114 (72%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            +FGCRNR +DFIYE+EL  F + G ISELIVAFSREGP K+YVQHK+ ++AS++W+LIS+
Sbjct  568  YFGCRNRNLDFIYEDELNKFVESGSISELIVAFSREGPTKEYVQHKMLQKASEIWNLISE  627

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTI QEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  628  GAYIYVCGDAKGMARDVHRMLHTIAQEQGALDSSKAESWVKNLQMTGRYLRDVW  681



>gb|AAG17471.1|AF123610_10 NADPH-cytochrome P450 reductase [Triticum aestivum]
Length=656

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR MD+IYEEEL+NF  +G +SELIVA+SREGP K+YVQHK+ ++A+++W++ISQ
Sbjct  543  FFGCRNREMDYIYEEELQNFLQEGALSELIVAYSREGPTKEYVQHKMVDKATEIWNVISQ  602

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMA+DVHR LHTIVQ+Q  +D+SK E  VK LQM GRYLRDVW
Sbjct  603  GGYIYVCGDAKGMAKDVHRVLHTIVQKQGSLDNSKTELYVKNLQMEGRYLRDVW  656



>ref|XP_008676669.1| PREDICTED: uncharacterized protein LOC100216882 isoform X1 [Zea 
mays]
 gb|AFW62053.1| hypothetical protein ZEAMMB73_790468 [Zea mays]
Length=702

 Score =   183 bits (465),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE EL NF +QG +SEL++AFSR+G  K+YVQHK+ ++AS++W +ISQ
Sbjct  589  FFGCRNSKMDFIYEGELNNFVEQGALSELVLAFSRQGLAKEYVQHKMAQKASEIWDMISQ  648

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  649  GAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  702



>emb|CAA81209.1| NADPH-ferrihemoprotein reductase [Helianthus tuberosus]
Length=588

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = -3

Query  715  LVQLCCFFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQV  536
            L Q   FFGCRNR++DFIYE EL NF + G +SEL +AFSREG  K+YVQHK++++AS +
Sbjct  469  LGQSILFFGCRNRKVDFIYENELNNFVENGALSELDMAFSREGASKEYVQHKMSQKASDI  528

Query  535  WSLISQEGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
            W+++S+  YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM+GRYLRDVW
Sbjct  529  WNMLSEGAYLYVCGDAKGMAKDVHRTLHTIVQEQGNLDSSKAELYVKNLQMSGRYLRDVW  588



>gb|ACG27711.1| NADPH--cytochrome P450 reductase [Zea mays]
Length=703

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE EL NF +QG +SEL++AFSR+G  K+YVQHK+ ++AS++W +ISQ
Sbjct  590  FFGCRNSKMDFIYEGELNNFLEQGALSELVLAFSRQGLAKEYVQHKMAQKASEIWDMISQ  649

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHR LHTIVQEQ  +DSSKAE+ VK LQM GRYLRDVW
Sbjct  650  GAYIYVCGDAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW  703



>ref|XP_003610109.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES92306.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=701

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 99/114 (87%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++D+IYE+EL +F   G +SELIVAFSREGP K+YVQHK+ E+AS +W++ISQ
Sbjct  588  FFGCRNRQVDYIYEDELNHFVHGGALSELIVAFSREGPTKEYVQHKMIEKASDIWNMISQ  647

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMA+DVHRTLHTI+QEQ  +D+SK E++VK LQM GRYLRDVW
Sbjct  648  GAYIYVCGDAKGMAKDVHRTLHTILQEQGSLDNSKTESMVKNLQMTGRYLRDVW  701



>gb|AGO03799.1| cytochrome P450-like protein [Tanacetum cinerariifolium]
Length=709

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR++DFIYE+EL NF + G +SELI AFSRE   K+YVQHK++++AS++W+L+S+
Sbjct  596  FFGCRNRKVDFIYEDELNNFVETGALSELITAFSRESATKEYVQHKMSQKASEIWNLLSE  655

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              YLYVCGDAKGMA+DVHRTLHTIVQEQ  +DSSKAE  VK LQM GRYLRDVW
Sbjct  656  GAYLYVCGDAKGMAKDVHRTLHTIVQEQGSLDSSKAELYVKNLQMAGRYLRDVW  709



>gb|KDP36395.1| hypothetical protein JCGZ_08664 [Jatropha curcas]
Length=711

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IY++EL NF   G +SEL+VAFSREGP K+YVQHK+ E+AS +W+LISQ
Sbjct  598  FFGCRNSKMDYIYQDELSNFVGSGALSELVVAFSREGPTKEYVQHKMMEKASDIWNLISQ  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMARDVHRTLHTI QEQ  + +S+AE++VK LQ +GRYLRDVW
Sbjct  658  GAYIYVCGDAKGMARDVHRTLHTIAQEQGSLSNSRAESMVKNLQTSGRYLRDVW  711



>ref|XP_004973052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Setaria italica]
Length=702

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MDFIYE+EL NF +QG +SEL++AFSR+GP K+YVQHK+ ++AS++W +ISQ
Sbjct  589  FFGCRNSKMDFIYEDELNNFLEQGALSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQ  648

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
              Y+YVCGDAKGMA+DVH+ LHTIVQEQ  +DSSKAE+ VK L   GRYLRDVW
Sbjct  649  GAYIYVCGDAKGMAKDVHKVLHTIVQEQGSLDSSKAESFVKNLHTEGRYLRDVW  702



>gb|EPS73891.1| hypothetical protein M569_00858 [Genlisea aurea]
Length=706

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 95/114 (83%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRN +MD+IYE+EL+    +G  SEL+VAFSREGP K+YVQHK+ ERA+ +W LIS 
Sbjct  593  FFGCRNSKMDYIYEDELQQLVKEGAASELVVAFSREGPTKEYVQHKMGERAADLWKLISD  652

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GY+YVCGDAKGMARDVHRTLHTIVQEQ  +D+SK E+ VK LQM GRYLRDVW
Sbjct  653  GGYVYVCGDAKGMARDVHRTLHTIVQEQGSMDNSKTESFVKNLQMTGRYLRDVW  706



>gb|KHG21257.1| NADPH--cytochrome P450 reductase [Gossypium arboreum]
Length=711

 Score =   183 bits (464),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = -3

Query  697  FFGCRNRRMDFIYEEELKNFEDQGIISELIVAFSREGPQKDYVQHKITERASQVWSLISQ  518
            FFGCRNR+MD+IYE+EL NF + G +SEL+VAFSREGP K+YVQHK+ E+A  +W++IS+
Sbjct  598  FFGCRNRKMDYIYEDELNNFVNSGALSELVVAFSREGPTKEYVQHKMMEKALDIWNMISE  657

Query  517  EGYLYVCGDAKGMARDVHRTLHTIVQEQEKVDSSKAEAIVKKLQMNGRYLRDVW  356
             GYLYVCGDAKGMA+DVHRTL TI+QEQ  +DSSKAE++VK L   GRYLRDVW
Sbjct  658  GGYLYVCGDAKGMAKDVHRTLLTILQEQGCLDSSKAESMVKNLHTTGRYLRDVW  711



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1354032766515