BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037C09

Length=682
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009614932.1|  PREDICTED: polyribonucleotide nucleotidyltra...    107   1e-22   Nicotiana tomentosiformis
ref|XP_009768206.1|  PREDICTED: polyribonucleotide nucleotidyltra...    107   2e-22   Nicotiana sylvestris
ref|XP_010316293.1|  PREDICTED: polyribonucleotide nucleotidyltra...  98.6    1e-19   Solanum lycopersicum
ref|XP_006338583.1|  PREDICTED: polyribonucleotide nucleotidyltra...  95.9    7e-19   Solanum tuberosum [potatoes]
ref|XP_002300042.2|  hypothetical protein POPTR_0001s35070g           94.7    2e-18   
ref|XP_011047330.1|  PREDICTED: polyribonucleotide nucleotidyltra...  94.7    2e-18   Populus euphratica
ref|XP_002524669.1|  polyribonucleotide nucleotidyltransferase, p...  88.2    3e-16   Ricinus communis
gb|EYU44773.1|  hypothetical protein MIMGU_mgv1a001063mg              87.8    3e-16   Erythranthe guttata [common monkey flower]
gb|KDP45314.1|  hypothetical protein JCGZ_09563                       87.4    5e-16   Jatropha curcas
ref|XP_011098446.1|  PREDICTED: polyribonucleotide nucleotidyltra...  86.3    1e-15   Sesamum indicum [beniseed]
emb|CBI34890.3|  unnamed protein product                              84.7    4e-15   Vitis vinifera
ref|XP_010660886.1|  PREDICTED: polyribonucleotide nucleotidyltra...  84.7    4e-15   Vitis vinifera
gb|KJB33814.1|  hypothetical protein B456_006G032100                  82.8    2e-14   Gossypium raimondii
ref|XP_007031538.1|  Polyribonucleotide nucleotidyltransferase, p...  82.4    2e-14   
emb|CDP02087.1|  unnamed protein product                              81.6    5e-14   Coffea canephora [robusta coffee]
ref|XP_010940149.1|  PREDICTED: polyribonucleotide nucleotidyltra...  81.3    6e-14   Elaeis guineensis
gb|KDO55206.1|  hypothetical protein CISIN_1g002054mg                 80.9    7e-14   Citrus sinensis [apfelsine]
ref|XP_006446552.1|  hypothetical protein CICLE_v10014159mg           80.9    7e-14   Citrus clementina [clementine]
ref|XP_006470281.1|  PREDICTED: polyribonucleotide nucleotidyltra...  79.3    2e-13   Citrus sinensis [apfelsine]
ref|XP_004304642.1|  PREDICTED: polyribonucleotide nucleotidyltra...  78.6    4e-13   Fragaria vesca subsp. vesca
ref|XP_008796014.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...  77.8    8e-13   
ref|XP_009121656.1|  PREDICTED: polyribonucleotide nucleotidyltra...  77.8    8e-13   Brassica rapa
gb|KHG09808.1|  Polyribonucleotide nucleotidyltransferase             77.0    1e-12   Gossypium arboreum [tree cotton]
ref|XP_007031537.1|  Polyribonucleotide nucleotidyltransferase, p...  77.4    1e-12   
ref|XP_008341437.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...  77.0    1e-12   
ref|XP_008230570.1|  PREDICTED: polyribonucleotide nucleotidyltra...  76.6    2e-12   Prunus mume [ume]
emb|CDX69573.1|  BnaA10g19220D                                        76.3    2e-12   
ref|XP_003554809.1|  PREDICTED: polyribonucleotide nucleotidyltra...  75.5    4e-12   Glycine max [soybeans]
ref|XP_009131416.1|  PREDICTED: polyribonucleotide nucleotidyltra...  75.5    4e-12   Brassica rapa
emb|CDX78584.1|  BnaA03g04960D                                        75.5    4e-12   
gb|KHN23516.1|  Polyribonucleotide nucleotidyltransferase             75.1    4e-12   Glycine soja [wild soybean]
ref|XP_004489245.1|  PREDICTED: polyribonucleotide nucleotidyltra...  75.1    5e-12   Cicer arietinum [garbanzo]
ref|XP_009380405.1|  PREDICTED: polyribonucleotide nucleotidyltra...  75.1    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY09870.1|  BnaC09g42910D                                        74.3    9e-12   Brassica napus [oilseed rape]
ref|XP_007217697.1|  hypothetical protein PRUPE_ppa000918mg           74.3    1e-11   Prunus persica
ref|XP_006579768.1|  PREDICTED: polyribonucleotide nucleotidyltra...  72.8    1e-11   
ref|XP_010033299.1|  PREDICTED: polyribonucleotide nucleotidyltra...  73.6    2e-11   Eucalyptus grandis [rose gum]
ref|XP_009377194.1|  PREDICTED: polyribonucleotide nucleotidyltra...  73.2    2e-11   
ref|XP_006399970.1|  hypothetical protein EUTSA_v10012572mg           71.2    9e-11   Eutrema salsugineum [saltwater cress]
ref|XP_008443548.1|  PREDICTED: polyribonucleotide nucleotidyltra...  69.3    3e-10   Cucumis melo [Oriental melon]
ref|XP_010665719.1|  PREDICTED: polyribonucleotide nucleotidyltra...  69.3    4e-10   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007151009.1|  hypothetical protein PHAVU_004G011100g           67.4    1e-09   Phaseolus vulgaris [French bean]
ref|XP_002454178.1|  hypothetical protein SORBIDRAFT_04g026110        67.4    2e-09   Sorghum bicolor [broomcorn]
ref|XP_004164730.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...  67.4    2e-09   
ref|XP_004141096.1|  PREDICTED: polyribonucleotide nucleotidyltra...  67.0    2e-09   Cucumis sativus [cucumbers]
ref|NP_001047444.1|  Os02g0617700                                     65.9    2e-09   
gb|EEC73607.1|  hypothetical protein OsI_08089                        65.9    4e-09   Oryza sativa Indica Group [Indian rice]
sp|Q6KAI0.1|PNP2_ORYSJ  RecName: Full=Polyribonucleotide nucleoti...  65.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
gb|EPS73358.1|  hypothetical protein M569_01398                       65.9    5e-09   Genlisea aurea
gb|EEE57382.1|  hypothetical protein OsJ_07542                        65.9    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001146202.1|  uncharacterized protein LOC100279772             65.1    9e-09   
ref|XP_006648841.1|  PREDICTED: polyribonucleotide nucleotidyltra...  65.1    1e-08   Oryza brachyantha
ref|XP_008643478.1|  PREDICTED: uncharacterized protein LOC100279...  64.7    1e-08   
ref|XP_010248545.1|  PREDICTED: polyribonucleotide nucleotidyltra...  63.9    2e-08   Nelumbo nucifera [Indian lotus]
dbj|BAJ93434.1|  predicted protein                                    63.9    2e-08   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010235710.1|  PREDICTED: polyribonucleotide nucleotidyltra...  63.9    2e-08   Brachypodium distachyon [annual false brome]
ref|XP_010108801.1|  Polyribonucleotide nucleotidyltransferase        63.5    3e-08   
ref|XP_004953116.1|  PREDICTED: polyribonucleotide nucleotidyltra...  63.2    4e-08   
gb|KFK25698.1|  hypothetical protein AALP_AA8G147400                  62.4    6e-08   Arabis alpina [alpine rockcress]
emb|CDX70572.1|  BnaC03g06560D                                        62.4    7e-08   
ref|XP_010550151.1|  PREDICTED: polyribonucleotide nucleotidyltra...  61.6    1e-07   Tarenaya hassleriana [spider flower]
gb|EMS68952.1|  Polyribonucleotide nucleotidyltransferase             61.6    1e-07   Triticum urartu
dbj|BAC42539.1|  putative polynucleotide phosphorylase                57.0    2e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492266.1|  PREDICTED: polyribonucleotide nucleotidyltra...  59.7    5e-07   Camelina sativa [gold-of-pleasure]
gb|AES74396.2|  polyribonucleotide nucleotidyltransferase             58.5    1e-06   Medicago truncatula
ref|XP_003618178.1|  Polyribonucleotide nucleotidyltransferase        58.5    1e-06   
ref|XP_006289585.1|  hypothetical protein CARUB_v10003135mg           56.6    5e-06   Capsella rubella
ref|NP_196962.1|  polyribonucleotide nucleotidyltransferase           56.6    5e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002873678.1|  hypothetical protein ARALYDRAFT_488299           55.5    1e-05   
ref|XP_010453582.1|  PREDICTED: polyribonucleotide nucleotidyltra...  54.3    3e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010420100.1|  PREDICTED: polyribonucleotide nucleotidyltra...  54.3    4e-05   Camelina sativa [gold-of-pleasure]



>ref|XP_009614932.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana tomentosiformis]
Length=981

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 78/87 (90%), Gaps = 1/87 (1%)
 Frame = -2

Query  666  KSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  487
            K+ SD N D+T ET + ANKLKLGMK+ AKVHQIR LGLVLDLGGG+RGMYRFEPGAKRD
Sbjct  895  KTGSDKN-DATTETPMTANKLKLGMKVTAKVHQIRTLGLVLDLGGGIRGMYRFEPGAKRD  953

Query  486  FEVGDQVLVKCTSFSSKGVPVMSLVED  406
            FEVGD++ VKC+SFS+KGVPV+SLV++
Sbjct  954  FEVGDELRVKCSSFSTKGVPVLSLVKE  980



>ref|XP_009768206.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana sylvestris]
Length=981

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 76/84 (90%), Gaps = 1/84 (1%)
 Frame = -2

Query  657  SDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEV  478
            SD N D+T ET + ANKLKLGMK+ AKVHQIRALGLVLDLGG +RGMYRFEPGAKRDFEV
Sbjct  898  SDKN-DATTETPMTANKLKLGMKVTAKVHQIRALGLVLDLGGAIRGMYRFEPGAKRDFEV  956

Query  477  GDQVLVKCTSFSSKGVPVMSLVED  406
            GD++ VKC+SFS+KGVPV+SLV++
Sbjct  957  GDELRVKCSSFSTKGVPVLSLVKE  980



>ref|XP_010316293.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Solanum lycopersicum]
Length=983

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = -2

Query  642  DSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVL  463
            D+T ET + ANKLKLGMK+ AKVHQIRALGLVLDLGGG+RGMYRFE G K+DFEVGD++ 
Sbjct  904  DATSETPMSANKLKLGMKVTAKVHQIRALGLVLDLGGGIRGMYRFESGMKKDFEVGDELR  963

Query  462  VKCTSFSSKGVPVMSLVED  406
            VKC+SFS+KG+PV+SLV++
Sbjct  964  VKCSSFSTKGIPVLSLVKE  982



>ref|XP_006338583.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Solanum tuberosum]
Length=977

 Score = 95.9 bits (237),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 56/72 (78%), Positives = 68/72 (94%), Gaps = 0/72 (0%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            + ANKLKLGM++ AKVHQIRALGLVLDLGGG+RGMYRFEPG KRDFEVGD++ VKC+SFS
Sbjct  905  MSANKLKLGMRVTAKVHQIRALGLVLDLGGGIRGMYRFEPGMKRDFEVGDELRVKCSSFS  964

Query  441  SKGVPVMSLVED  406
            +KG+PV+SLV++
Sbjct  965  TKGIPVLSLVKE  976



>ref|XP_002300042.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
 gb|EEE84847.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
Length=961

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            ++D+ V + + A  LKLGMK+ AKV+QIRALGLVLDLG G+RGMYRFE   KRDFE+GD+
Sbjct  880  DEDAKVVSPLSAKSLKLGMKIAAKVYQIRALGLVLDLGNGVRGMYRFETNGKRDFEIGDE  939

Query  468  VLVKCTSFSSKGVPVMSLVED  406
            +LVKCTSFSSKG+PVMSLV+D
Sbjct  940  LLVKCTSFSSKGLPVMSLVDD  960



>ref|XP_011047330.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Populus euphratica]
Length=965

 Score = 94.7 bits (234),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            ++D+ V + + A  LKLGMK+ AKV+QIRALGLVLDLG G+RGMYRFE   KRDFE+GD+
Sbjct  884  DEDAKVVSPLSAKSLKLGMKIAAKVYQIRALGLVLDLGNGVRGMYRFETNGKRDFEIGDE  943

Query  468  VLVKCTSFSSKGVPVMSLVED  406
            +LVKCTSFSSKG+PVMSLV+D
Sbjct  944  LLVKCTSFSSKGLPVMSLVDD  964



>ref|XP_002524669.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
 gb|EEF37688.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
Length=958

 Score = 88.2 bits (217),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            N ++ VE+ I A  LKLG K+ AKV+QIR  GLVLDLGG +RGM+RFE   KRDFEVGD+
Sbjct  877  NVENEVESPINARNLKLGTKVAAKVYQIRKHGLVLDLGGEVRGMFRFEENGKRDFEVGDE  936

Query  468  VLVKCTSFSSKGVPVMSLVED  406
            + VKCT+FSSKG+PVMSLV+D
Sbjct  937  LRVKCTNFSSKGIPVMSLVDD  957



>gb|EYU44773.1| hypothetical protein MIMGU_mgv1a001063mg [Erythranthe guttata]
Length=899

 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 65/81 (80%), Gaps = 0/81 (0%)
 Frame = -2

Query  651  LNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGD  472
            L K    ++ I A  LK+GM+L  KVHQIRA GLVLDLGG LRGMYRFE G+KRDFEVGD
Sbjct  818  LRKIPKAKSCIDAKTLKIGMELTGKVHQIRAHGLVLDLGGDLRGMYRFENGSKRDFEVGD  877

Query  471  QVLVKCTSFSSKGVPVMSLVE  409
            ++ VKC SFS+KGVPVMSLV+
Sbjct  878  EMRVKCCSFSTKGVPVMSLVQ  898



>gb|KDP45314.1| hypothetical protein JCGZ_09563 [Jatropha curcas]
Length=938

 Score = 87.4 bits (215),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = -2

Query  681  SKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEP  502
            SK  +K +++  K++ VE  + AN LKLG K+ AKV QIR  GLVL+LGGG+RGMYRFE 
Sbjct  846  SKRDQKPKTNPPKEAKVEAPMSANNLKLGTKVTAKVFQIRKHGLVLELGGGVRGMYRFET  905

Query  501  GAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             +K +FEVGD++ VKCTSFSSKG+PVM LV+D
Sbjct  906  NSKTNFEVGDELQVKCTSFSSKGIPVMCLVDD  937



>ref|XP_011098446.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Sesamum indicum]
Length=901

 Score = 86.3 bits (212),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -2

Query  651  LNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGD  472
            LN+    E  + A KLKLG ++ AKVHQIRA GLVLDLGGG+RGM+RFE G++RDFEVG+
Sbjct  820  LNRSCKGEVPMDAKKLKLGTEVTAKVHQIRAHGLVLDLGGGIRGMFRFETGSRRDFEVGE  879

Query  471  QVLVKCTSFSSKGVPVMSLV  412
            ++ VKC+SFSSKG+PVM+LV
Sbjct  880  EMRVKCSSFSSKGIPVMTLV  899



>emb|CBI34890.3| unnamed protein product [Vitis vinifera]
Length=905

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = -2

Query  666  KSQSDLNKDSTV-ETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFE-PGAK  493
             SQ+DLN    V ET   A  LKLGMKL AKV+QIR  GLVLDLGGG+RGMYRFE    K
Sbjct  816  NSQNDLNDTKEVPETCTGAKNLKLGMKLNAKVYQIRTHGLVLDLGGGIRGMYRFEGDNDK  875

Query  492  RDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            RDF+VGD++ V C+SFS+KG+PVMSLVED
Sbjct  876  RDFKVGDELHVMCSSFSTKGIPVMSLVED  904



>ref|XP_010660886.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Vitis vinifera]
Length=997

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 69/89 (78%), Gaps = 2/89 (2%)
 Frame = -2

Query  666  KSQSDLNKDSTV-ETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFE-PGAK  493
             SQ+DLN    V ET   A  LKLGMKL AKV+QIR  GLVLDLGGG+RGMYRFE    K
Sbjct  908  NSQNDLNDTKEVPETCTGAKNLKLGMKLNAKVYQIRTHGLVLDLGGGIRGMYRFEGDNDK  967

Query  492  RDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            RDF+VGD++ V C+SFS+KG+PVMSLVED
Sbjct  968  RDFKVGDELHVMCSSFSTKGIPVMSLVED  996



>gb|KJB33814.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=980

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 71/85 (84%), Gaps = 1/85 (1%)
 Frame = -2

Query  657  SDLN-KDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFE  481
            SD N K++  +T +   KLKLG K+ AK++QIRA GLVLDLGGG+RGMY+FEP  +R+F 
Sbjct  895  SDQNDKETGGKTPVTPQKLKLGTKVTAKIYQIRARGLVLDLGGGIRGMYKFEPNGEREFT  954

Query  480  VGDQVLVKCTSFSSKGVPVMSLVED  406
            VGD++LV+C+SF+SKG+PVMS+V++
Sbjct  955  VGDELLVQCSSFTSKGIPVMSMVDE  979



>ref|XP_007031538.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
 gb|EOY02464.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
Length=896

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 68/81 (84%), Gaps = 0/81 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            +K++  +T +   KLKLG K+ AKV+QIRA GLVLDLGGG+RGMYRFEP  ++DF VGD+
Sbjct  815  DKETDDKTPMTPQKLKLGTKVTAKVYQIRARGLVLDLGGGIRGMYRFEPNGEKDFNVGDE  874

Query  468  VLVKCTSFSSKGVPVMSLVED  406
            + V+C+SF+SKG+PVMSLV++
Sbjct  875  LPVQCSSFTSKGIPVMSLVDE  895



>emb|CDP02087.1| unnamed protein product [Coffea canephora]
Length=972

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = -2

Query  669  RKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKR  490
            + + +D+  D+     I A +LK+GM L AKVHQIRA GLVLDLGGG+RGMYRFE G KR
Sbjct  887  QNNPNDMETDNV--ANISARRLKIGMVLTAKVHQIRARGLVLDLGGGIRGMYRFETGVKR  944

Query  489  DFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             F VG+++ VKC+SFS KG+PVMSL E+
Sbjct  945  YFGVGEELRVKCSSFSGKGIPVMSLFEE  972



>ref|XP_010940149.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Elaeis guineensis]
Length=989

 Score = 81.3 bits (199),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = -2

Query  666  KSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  487
            ++ +D+   S   T ++A  LKLG ++IAKV+QIR  GLVL+LGGGLRGMY+FE   +RD
Sbjct  902  QNDADVKPKSLGSTSVRAGSLKLGDRVIAKVYQIRTHGLVLELGGGLRGMYKFEINGRRD  961

Query  486  FEVGDQVLVKCTSFSSKGVPVMSLVED  406
            FEVG ++ V+C+SFSSKG+PV SL+ED
Sbjct  962  FEVGKELHVQCSSFSSKGIPVFSLLED  988



>gb|KDO55206.1| hypothetical protein CISIN_1g002054mg [Citrus sinensis]
Length=974

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            NK + VE  + A  LKLG K+ AKV+Q+RA GLVLDLGGG+RGMYRFE   K+DF VGD+
Sbjct  894  NKGTRVEAIVSAKNLKLGTKVAAKVYQVRARGLVLDLGGGIRGMYRFENNEKKDFVVGDE  953

Query  468  VLVKCTSFSSKGVPVMSLVE  409
            +LVKC+SF+ KG+PV+SLV+
Sbjct  954  LLVKCSSFTGKGIPVVSLVD  973



>ref|XP_006446552.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
 gb|ESR59792.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
Length=973

 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            NK + VE  + A  LKLG K+ AKV+Q+RA GLVLDLGGG+RGMYRFE   K+DF VGD+
Sbjct  893  NKGTRVEAIVSAKNLKLGTKVAAKVYQVRARGLVLDLGGGIRGMYRFENNEKKDFVVGDE  952

Query  468  VLVKCTSFSSKGVPVMSLVE  409
            +LVKC+SF+ KG+PV+SLV+
Sbjct  953  LLVKCSSFTGKGIPVVSLVD  972



>ref|XP_006470281.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Citrus sinensis]
Length=974

 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            NK +  E  + A  LKLG K+ AKV+Q+RA GLVLDLGGG+RGMYRFE   K+DF VGD+
Sbjct  894  NKGTRAEAIVSAKNLKLGTKVAAKVYQVRAHGLVLDLGGGIRGMYRFENNEKKDFVVGDE  953

Query  468  VLVKCTSFSSKGVPVMSLVE  409
            +LVKC+SF+ KG+PV+SLV+
Sbjct  954  LLVKCSSFTGKGIPVVSLVD  973



>ref|XP_004304642.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=969

 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 63/81 (78%), Gaps = 0/81 (0%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQ  469
            N  S+ E  + A  LKLG K+ AKV+Q+R  GLVLDLGGGLRGMYRFE   K+DF+V D+
Sbjct  888  NDLSSKEDYVTARSLKLGTKVTAKVYQVRTGGLVLDLGGGLRGMYRFEADGKKDFDVNDE  947

Query  468  VLVKCTSFSSKGVPVMSLVED  406
            + V+C SFSSKG+PVMSLV+D
Sbjct  948  LQVECVSFSSKGIPVMSLVDD  968



>ref|XP_008796014.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Phoenix dactylifera]
Length=993

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 48/87 (55%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = -2

Query  666  KSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  487
            ++ +D    S   T ++A  LKLG ++ AK++QIRA GLVL+LGGG+RGMY+FE   +RD
Sbjct  906  QNDADEKPKSFGSTSVRAGSLKLGDRVTAKIYQIRAHGLVLELGGGVRGMYKFEVNGRRD  965

Query  486  FEVGDQVLVKCTSFSSKGVPVMSLVED  406
            FEVG ++ V+C+SFSSKG+PV SL+ED
Sbjct  966  FEVGKELPVQCSSFSSKGIPVFSLLED  992



>ref|XP_009121656.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Brassica rapa]
Length=975

 Score = 77.8 bits (190),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 67/91 (74%), Gaps = 0/91 (0%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K P + +   + ++     I A KLK+G ++ AKVHQIR  GLVLDLGGG+RGMY+FE  
Sbjct  882  KKPSRKEKQSDNEAGESPSISARKLKIGTEMTAKVHQIRTHGLVLDLGGGIRGMYKFEGD  941

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +FE+GD + VKCTSFSSKG+PVM+LV++
Sbjct  942  EETEFEIGDTLQVKCTSFSSKGIPVMALVDE  972



>gb|KHG09808.1| Polyribonucleotide nucleotidyltransferase [Gossypium arboreum]
Length=743

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = -2

Query  657  SDLN-KDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFE  481
            SD N K++   T +   KLKLG K+ AK++QIRA GLVLDLGGG+RGMY+FE   +R+F 
Sbjct  658  SDQNDKETGGNTPVTPQKLKLGTKVTAKIYQIRARGLVLDLGGGIRGMYKFESNGEREFT  717

Query  480  VGDQVLVKCTSFSSKGVPVMSLVED  406
            VGD++LV+C+SF+SKG+PV+S+V++
Sbjct  718  VGDELLVQCSSFTSKGIPVVSMVDE  742



>ref|XP_007031537.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
 gb|EOY02463.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
Length=980

 Score = 77.4 bits (189),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 68/83 (82%), Gaps = 2/83 (2%)
 Frame = -2

Query  648  NKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFE--PGAKRDFEVG  475
            +K++  +T +   KLKLG K+ AKV+QIRA GLVLDLGGG+RGMYRFE  P  ++DF VG
Sbjct  897  DKETDDKTPMTPQKLKLGTKVTAKVYQIRARGLVLDLGGGIRGMYRFEMQPNGEKDFNVG  956

Query  474  DQVLVKCTSFSSKGVPVMSLVED  406
            D++ V+C+SF+SKG+PVMSLV++
Sbjct  957  DELPVQCSSFTSKGIPVMSLVDE  979



>ref|XP_008341437.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Malus domestica]
Length=945

 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = -2

Query  663  SQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDF  484
            SQ   +K++ V   +    LK+G K+ AKV+QIR  GLVLDLGGGLRGMYRFE   + DF
Sbjct  858  SQKGGDKEAEVGGSVTEKSLKIGTKVTAKVYQIRTGGLVLDLGGGLRGMYRFETNGRTDF  917

Query  483  EVGDQVLVKCTSFSSKGVPVMSLVED  406
            EV D++ V+C SFS KG+PVMSLV+D
Sbjct  918  EVNDELXVECVSFSGKGIPVMSLVDD  943



>ref|XP_008230570.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Prunus mume]
Length=963

 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 64/88 (73%), Gaps = 1/88 (1%)
 Frame = -2

Query  666  KSQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKR  490
            KS S    D T V + + A  LK+G K+ AKV+QIR  GLVLDLGGG+RGMYRFE   K 
Sbjct  874  KSFSQKEGDKTEVRSPVTAKTLKIGTKVTAKVYQIRTGGLVLDLGGGIRGMYRFETNGKN  933

Query  489  DFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            DFEV D++ V C SFSSKG+PVMSLV+D
Sbjct  934  DFEVDDELRVVCVSFSSKGIPVMSLVDD  961



>emb|CDX69573.1| BnaA10g19220D [Brassica napus]
Length=975

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K P + +   + ++     I A KLK+G +  AKVHQIR  GLVLDLGGG+RGMY+FE  
Sbjct  882  KKPSRKEKQSDNEAGESPSISARKLKIGTETTAKVHQIRTHGLVLDLGGGIRGMYKFEGD  941

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +FE+GD + VKCTSFSSKG+PVM+LV++
Sbjct  942  EETEFEIGDTLQVKCTSFSSKGIPVMALVDE  972



>ref|XP_003554809.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Glycine max]
Length=959

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            + A  LKLG ++ AKV QIRA GLVLDLGGGLRGMYRFE   KRDF++GD++ V C+SFS
Sbjct  887  VTAEDLKLGTQVTAKVSQIRAHGLVLDLGGGLRGMYRFEENNKRDFKIGDEMRVVCSSFS  946

Query  441  SKGVPVMSLVED  406
            SKG+PV+S V D
Sbjct  947  SKGIPVLSFVND  958



>ref|XP_009131416.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brassica rapa]
Length=963

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K PRK +     ++     + A KLK+G ++ AKVHQ+R  GLVLDLGGG+RGMY+FE  
Sbjct  871  KPPRKKKQS-GDEAGESASVSARKLKIGTEMTAKVHQVRTHGLVLDLGGGIRGMYKFEGD  929

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +FE+GD + VKCTSF++KG+PVM+LV+D
Sbjct  930  EETEFEIGDALQVKCTSFTTKGIPVMALVDD  960



>emb|CDX78584.1| BnaA03g04960D [Brassica napus]
Length=964

 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K PRK +     ++     + A KLK+G ++ AKVHQ+R  GLVLDLGGG+RGMY+FE  
Sbjct  872  KPPRKKKQS-GDEAGESASVSARKLKIGTEMTAKVHQVRTHGLVLDLGGGIRGMYKFEGD  930

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +FE+GD + VKCTSF++KG+PVM+LV+D
Sbjct  931  EETEFEIGDALQVKCTSFTTKGIPVMALVDD  961



>gb|KHN23516.1| Polyribonucleotide nucleotidyltransferase [Glycine soja]
Length=853

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            + A  LKLG ++ AKV QIRA GLVLDLGGGLRGMYRFE   KRDF++GD++ V C+SFS
Sbjct  781  VTAEDLKLGTQVTAKVSQIRAHGLVLDLGGGLRGMYRFEENNKRDFKIGDEMRVVCSSFS  840

Query  441  SKGVPVMSLVED  406
            SKG+PV+S V D
Sbjct  841  SKGIPVLSFVND  852



>ref|XP_004489245.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Cicer arietinum]
Length=976

 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 69/88 (78%), Gaps = 1/88 (1%)
 Frame = -2

Query  669  RKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKR  490
            R+++ D  K+   +T + A  LKLG ++ AKV+QIRA GLVLDLGGG+RGMYR+E   K+
Sbjct  887  RRAEGD-EKEGKNKTPLTAKDLKLGTEVTAKVYQIRAHGLVLDLGGGVRGMYRYEEDGKK  945

Query  489  DFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            DF++GD++ V C+SFSSKG+PV+S V+D
Sbjct  946  DFKIGDEMRVVCSSFSSKGIPVLSAVDD  973



>ref|XP_009380405.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=1048

 Score = 75.1 bits (183),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 61/72 (85%), Gaps = 0/72 (0%)
 Frame = -2

Query  621   IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
             I+A+ LKLG  + AKV+QIRA GLVL+L GG+RGM++FE   +RDFEVG +++V+C+SFS
Sbjct  976   IRADSLKLGDTVTAKVYQIRAHGLVLELNGGIRGMFKFEVNGRRDFEVGKELVVRCSSFS  1035

Query  441   SKGVPVMSLVED  406
             SKG+PV SL++D
Sbjct  1036  SKGIPVFSLLKD  1047



>emb|CDY09870.1| BnaC09g42910D [Brassica napus]
Length=959

 Score = 74.3 bits (181),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/70 (66%), Positives = 59/70 (84%), Gaps = 0/70 (0%)
 Frame = -2

Query  615  ANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSK  436
            A KLK+G ++ AKVHQIR  GLVLDLGGG+RGMY+FE   + +FE+GD + VKCTSFSSK
Sbjct  887  ARKLKIGTEMTAKVHQIRTHGLVLDLGGGIRGMYKFEGDEETEFEIGDTLQVKCTSFSSK  946

Query  435  GVPVMSLVED  406
            G+PVM+LV++
Sbjct  947  GIPVMALVDE  956



>ref|XP_007217697.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
 gb|EMJ18896.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
Length=962

 Score = 74.3 bits (181),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = -2

Query  666  KSQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKR  490
            KS S    D T V + + A  LK+G K+ AKV+QIR  GLVLDLGGG+RGMYRFE   K 
Sbjct  874  KSFSQKEGDKTEVRSPVTAKTLKIGTKVTAKVYQIRTGGLVLDLGGGIRGMYRFETNGKN  933

Query  489  DFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            DFEV D++ V C SFSSKG+PVMSL +D
Sbjct  934  DFEVDDELRVVCVSFSSKGIPVMSLEDD  961



>ref|XP_006579768.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Glycine max]
 gb|KHN27449.1| Polyribonucleotide nucleotidyltransferase [Glycine soja]
Length=348

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 67/92 (73%), Gaps = 4/92 (4%)
 Frame = -2

Query  669  RKSQSDLNKDSTVETG----IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEP  502
            ++S+SDL +    E G    + A  LKLG ++ AKV QI A GLVLDLGGGLRG+YRFE 
Sbjct  256  KESKSDLQRPKGDEQGPKDKVTAEDLKLGSEVTAKVSQIGAHGLVLDLGGGLRGIYRFEE  315

Query  501  GAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
              KR F++GD++ V C+SFSSKGVPV+S V+D
Sbjct  316  NNKRHFKIGDEMRVVCSSFSSKGVPVLSFVDD  347



>ref|XP_010033299.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Eucalyptus grandis]
 gb|KCW52909.1| hypothetical protein EUGRSUZ_J02224 [Eucalyptus grandis]
Length=946

 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/70 (67%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  615  ANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSK  436
            A  LKLGM++ AKVH++   GLVLDLG G+RGMYRFE   K D+EVGD + V CTSFSSK
Sbjct  876  AKNLKLGMRVTAKVHKVLGRGLVLDLGNGVRGMYRFEGEGKADYEVGDLLRVVCTSFSSK  935

Query  435  GVPVMSLVED  406
            GVPVMSL++D
Sbjct  936  GVPVMSLLKD  945



>ref|XP_009377194.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Pyrus x bretschneideri]
Length=944

 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -2

Query  663  SQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDF  484
            SQ   +K++ V   +    LK+G K+ AKV+QIR  GLVLDLGGGLRGMYRFE   + DF
Sbjct  857  SQKGGDKEAEVGGSVTEKSLKIGTKVTAKVYQIRTGGLVLDLGGGLRGMYRFETNGRTDF  916

Query  483  EVGDQVLVKCTSFSSKGVPVMSLVED  406
            EV D++ V+C SFS KG+PVMS V+D
Sbjct  917  EVNDELRVECVSFSVKGIPVMSPVDD  942



>ref|XP_006399970.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
 gb|ESQ41423.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
Length=984

 Score = 71.2 bits (173),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 59/72 (82%), Gaps = 0/72 (0%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            I    LK+G +++AKVHQ+R  GLVLDLGGG+RGMY+FE   + +F++GD + VKCTSF+
Sbjct  910  ISPRTLKIGTEMMAKVHQVRTRGLVLDLGGGIRGMYKFEGDEETEFDIGDALKVKCTSFT  969

Query  441  SKGVPVMSLVED  406
            SKG+PVM+LV+D
Sbjct  970  SKGIPVMALVDD  981



>ref|XP_008443548.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Cucumis melo]
Length=1026

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/87 (53%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  663   SQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  487
             +Q+D+N +   V+  +  + L++G K+ AKV+QIR  GLVLDLGGGLRGMYRFE     +
Sbjct  940   TQNDVNNNEVEVKDPLTPSNLRIGTKVKAKVYQIRLHGLVLDLGGGLRGMYRFEGDDNSN  999

Query  486   FEVGDQVLVKCTSFSSKGVPVMSLVED  406
             F+VGD++ V+C+SFS +G+PVMSLV++
Sbjct  1000  FKVGDELHVQCSSFSGRGIPVMSLVDN  1026



>ref|XP_010665719.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=957

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = -2

Query  681  SKAPRKSQSDLNKDSTVETG--IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRF  508
            S+ P  +   + KD   E G  ++A  LKLG  + AKV QIRA GLVLDLGGGL+GMYRF
Sbjct  863  SRQPFSTVKSIRKDKKDEVGFGLRAKDLKLGTMVTAKVFQIRARGLVLDLGGGLKGMYRF  922

Query  507  EPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            E    ++  VGD++ V+C SF++KGVPVMS V+D
Sbjct  923  EMNDDKEINVGDELRVQCCSFTAKGVPVMSRVKD  956



>ref|XP_007151009.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
 gb|ESW23003.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
Length=982

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 64/91 (70%), Gaps = 6/91 (7%)
 Frame = -2

Query  669  RKSQSDLNKDSTVETGIK------ANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRF  508
            ++S+SDL K    E   K      A  L+LG K+ AKV+QIRA GLVLDLG GLRGMYRF
Sbjct  889  KQSKSDLLKQEGDEQESKDKASGTAKDLELGTKVTAKVYQIRAHGLVLDLGSGLRGMYRF  948

Query  507  EPGAKRDFEVGDQVLVKCTSFSSKGVPVMSL  415
            E    R+F++GD++ V C+SFSSKG+P++S 
Sbjct  949  EENNSRNFKIGDEMRVVCSSFSSKGIPILSF  979



>ref|XP_002454178.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
 gb|EES07154.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
Length=983

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 65/94 (69%), Gaps = 6/94 (6%)
 Frame = -2

Query  681  SKAPRKSQS---DLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYR  511
            S  P K+     DLN+  T     ++  +KLG  + AKV+QIRA GLVL+L  G RGM++
Sbjct  893  SDVPEKTADNTLDLNQSPT---NFQSGAMKLGDVVTAKVYQIRAFGLVLELSDGARGMHK  949

Query  510  FEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
            FE   +++FEVG ++LVKC+SF++KG+PV SL++
Sbjct  950  FEANGQKEFEVGQELLVKCSSFNAKGIPVFSLLD  983



>ref|XP_004164730.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial-like [Cucumis sativus]
Length=955

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  663  SQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  487
            +Q+D+N +   V+  +  + L++G K+ AK++QIR  GLVLDLGGG+RGMYRFE   + +
Sbjct  869  TQNDVNNNEVEVQDPLTPSNLRIGTKVKAKIYQIRLHGLVLDLGGGVRGMYRFEGDNQSN  928

Query  486  FEVGDQVLVKCTSFSSKGVPVMSLVED  406
            ++VGD++ V+C+SFS +G+PVMSLV +
Sbjct  929  YKVGDELHVQCSSFSGRGIPVMSLVNN  955



>ref|XP_004141096.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Cucumis sativus]
 gb|KGN59689.1| hypothetical protein Csa_3G838680 [Cucumis sativus]
Length=1032

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/87 (49%), Positives = 67/87 (77%), Gaps = 1/87 (1%)
 Frame = -2

Query  663   SQSDLNKDST-VETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRD  487
             +Q+D+N +   V+  +  + L++G K+ AK++QIR  GLVLDLGGG+RGMYRFE   + +
Sbjct  946   TQNDVNNNEVEVQDPLTPSNLRIGTKVKAKIYQIRLHGLVLDLGGGVRGMYRFEGDNQSN  1005

Query  486   FEVGDQVLVKCTSFSSKGVPVMSLVED  406
             ++VGD++ V+C+SFS +G+PVMSLV +
Sbjct  1006  YKVGDELHVQCSSFSGRGIPVMSLVNN  1032



>ref|NP_001047444.1| Os02g0617700 [Oryza sativa Japonica Group]
 dbj|BAF09358.1| Os02g0617700, partial [Oryza sativa Japonica Group]
Length=322

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  672  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  493
            P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  236  PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  294

Query  492  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
            +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  295  KDFEVGEELLVKCSSFNAKGIPVFSLLD  322



>gb|EEC73607.1| hypothetical protein OsI_08089 [Oryza sativa Indica Group]
Length=1030

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  672   PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  493
             P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  944   PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  1002

Query  492   RDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
             +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  1003  KDFEVGEELLVKCSSFNAKGIPVFSLLD  1030



>sp|Q6KAI0.1|PNP2_ORYSJ RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
AltName: Full=Polynucleotide phosphorylase 2; Short=PNPase 
2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD21450.1| putative polyribonucleotide nucleotidyltransferase [Oryza sativa 
Japonica Group]
Length=982

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  672  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  493
            P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  896  PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  954

Query  492  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
            +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  955  KDFEVGEELLVKCSSFNAKGIPVFSLLD  982



>gb|EPS73358.1| hypothetical protein M569_01398 [Genlisea aurea]
Length=882

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = -2

Query  609  KLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSSKGV  430
            KLK+G  + ++V Q+R  GLVLDLGGG+RGMYRFE G++R+F +G++V VKC SFS KG+
Sbjct  817  KLKIGTIVTSRVRQVRQHGLVLDLGGGIRGMYRFENGSRREFSIGEEVRVKCCSFSGKGI  876

Query  429  PVMSL  415
            PVMSL
Sbjct  877  PVMSL  881



>gb|EEE57382.1| hypothetical protein OsJ_07542 [Oryza sativa Japonica Group]
Length=941

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 66/88 (75%), Gaps = 1/88 (1%)
 Frame = -2

Query  672  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  493
            P +++S++   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F     
Sbjct  855  PEQNKSNIMNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENGH  913

Query  492  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
            +DFEVG+++LVKC+SF++KG+PV SL++
Sbjct  914  KDFEVGEELLVKCSSFNAKGIPVFSLLD  941



>ref|NP_001146202.1| uncharacterized protein LOC100279772 [Zea mays]
 gb|ACL53457.1| unknown [Zea mays]
Length=733

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -2

Query  681  SKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEP  502
            S  P +S  + +  +   T  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++FE 
Sbjct  643  SDVPEQSADNTSDQNQSPTKFQSGAMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFEA  702

Query  501  GAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
               ++FEVG +++VKC+SF++KG+P+ SL++
Sbjct  703  NGLKEFEVGQELVVKCSSFNAKGIPLFSLLD  733



>ref|XP_006648841.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like, 
partial [Oryza brachyantha]
Length=947

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 63/88 (72%), Gaps = 1/88 (1%)
 Frame = -2

Query  672  PRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAK  493
            P +++S +   S+  +  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++FE   +
Sbjct  861  PEQNKSSVQNYSS-PSNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFEENGR  919

Query  492  RDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
              FEVG ++LVKC SF+SKG+PV SL++
Sbjct  920  NTFEVGQELLVKCASFNSKGIPVFSLLD  947



>ref|XP_008643478.1| PREDICTED: uncharacterized protein LOC100279772 isoform X1 [Zea 
mays]
 gb|AFW72337.1| hypothetical protein ZEAMMB73_632002 [Zea mays]
Length=980

 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -2

Query  681  SKAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEP  502
            S  P +S  + +  +   T  ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++FE 
Sbjct  890  SDVPEQSADNTSDQNQSPTKFQSGAMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFEA  949

Query  501  GAKRDFEVGDQVLVKCTSFSSKGVPVMSLVE  409
               ++FEVG +++VKC+SF++KG+P+ SL++
Sbjct  950  NGLKEFEVGQELVVKCSSFNAKGIPLFSLLD  980



>ref|XP_010248545.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=991

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = -2

Query  660  QSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFE  481
            Q +++K++       A  +KL  K  AKV+QIR  GLVLDLGGG+RGMY+FE   K++++
Sbjct  906  QKNVSKEAVDTARKTAKTIKLSDKFTAKVYQIRVHGLVLDLGGGIRGMYKFEENGKKNYK  965

Query  480  VGDQVLVKCTSFSSKGVPVMSLVED  406
            VG+++ V+C+SFS+KG+PVMSL+ D
Sbjct  966  VGEELRVQCSSFSTKGIPVMSLLVD  990



>dbj|BAJ93434.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=726

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 56/70 (80%), Gaps = 0/70 (0%)
 Frame = -2

Query  618  KANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFSS  439
            ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F   ++ +FEVG++VLVKC +FS+
Sbjct  657  RSGSIKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFAENSQTNFEVGEEVLVKCATFSA  716

Query  438  KGVPVMSLVE  409
            KGVPV SL++
Sbjct  717  KGVPVFSLLD  726



>ref|XP_010235710.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brachypodium distachyon]
Length=976

 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 60/77 (78%), Gaps = 0/77 (0%)
 Frame = -2

Query  639  STVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLV  460
            S+V    ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F   ++++FE+G+++LV
Sbjct  900  SSVLKNFRSGSMKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFVESSRKNFEIGEELLV  959

Query  459  KCTSFSSKGVPVMSLVE  409
            KC SF++KGVPV SL++
Sbjct  960  KCASFNAKGVPVFSLLD  976



>ref|XP_010108801.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
 gb|EXC20316.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
Length=827

 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 67/111 (60%), Gaps = 21/111 (19%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVET--GIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFE  505
            K+   ++S+L+ DS  ET   I A  LKLG K+ AKV Q+R  GL+LDLGG +RGMY FE
Sbjct  717  KSDTSNRSNLD-DSEAETRTTISAKSLKLGTKVTAKVFQVRTNGLILDLGGDIRGMYLFE  775

Query  504  PG------------------AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
                                 +RDFE GD++ V+CT F+ KGVPVMSLV+D
Sbjct  776  SNEILFNRVAKGPCVFMQTNGRRDFEEGDELRVQCTRFNRKGVPVMSLVDD  826



>ref|XP_004953116.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Setaria italica]
Length=899

 Score = 63.2 bits (152),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
             ++  +KLG  + AKV+QIRA GLVL+L  G RGM++FE   + +FEVG ++LVKC SF+
Sbjct  829  FRSGSMKLGDVVTAKVYQIRAFGLVLELSDGARGMHKFEANGQMEFEVGQELLVKCASFN  888

Query  441  SKGVPVMSLVE  409
            +KG+PV SL++
Sbjct  889  AKGIPVFSLLD  899



>gb|KFK25698.1| hypothetical protein AALP_AA8G147400 [Arabis alpina]
Length=998

 Score = 62.4 bits (150),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 47/96 (49%), Positives = 65/96 (68%), Gaps = 4/96 (4%)
 Frame = -2

Query  681  SKAPRKSQSDLNKDSTVETG--IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRF  508
            SKA + S+ +   ++  E    +    LK+G ++  KV QIR  GLVLDLGGG+RGMYRF
Sbjct  900  SKAKKPSRKEKQSENKAEDSAPVTFQNLKIGTEMTVKVQQIRTHGLVLDLGGGIRGMYRF  959

Query  507  EP--GAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            EP    K  FE+G+ + VKCTSF++KG+PVM LV++
Sbjct  960  EPRDDEKTKFEIGETLQVKCTSFTTKGIPVMVLVDE  995



>emb|CDX70572.1| BnaC03g06560D [Brassica napus]
Length=963

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 66/91 (73%), Gaps = 0/91 (0%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K P + +     ++     + A KLK+G ++ AKVHQ+R  GLVLDLGGG+RGMY+FE  
Sbjct  870  KKPSRKKKQSGDEAGESASVSARKLKIGTEMTAKVHQVRTHGLVLDLGGGIRGMYKFEGE  929

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +FE+GD + VKCTSF++KG+PVM+LV+D
Sbjct  930  EETEFEIGDALQVKCTSFTTKGIPVMALVDD  960



>ref|XP_010550151.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010550152.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
Length=960

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 3/95 (3%)
 Frame = -2

Query  681  SKAPRKSQSDLNKDSTVE---TGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYR  511
            +KA   SQ D   +S  E   T + A KLK+G ++ AKV Q+R  GLVLDLGGG+RGMY+
Sbjct  865  AKAKITSQKDKQSESEAEDRSTSMNAQKLKIGTEVTAKVSQVRTRGLVLDLGGGIRGMYK  924

Query  510  FEPGAKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
            FE   + DFE+GD + VKCTSF+ KG+PVMSLVE+
Sbjct  925  FEDEEETDFELGDTMRVKCTSFTGKGIPVMSLVEE  959



>gb|EMS68952.1| Polyribonucleotide nucleotidyltransferase [Triticum urartu]
Length=1374

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  621   IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
              ++  +KLG  + AKV+QIRA GLVL+L  G+RGM++F   ++ +FEVG++VLVKC +FS
Sbjct  1304  FRSGSIKLGDVVTAKVYQIRAYGLVLELSDGVRGMHKFVENSQNNFEVGEEVLVKCDTFS  1363

Query  441   SKGVPVMSLVE  409
             +KGVPV S+++
Sbjct  1364  AKGVPVFSVLD  1374



>dbj|BAC42539.1| putative polynucleotide phosphorylase [Arabidopsis thaliana]
Length=90

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            +   KLK+G ++ A V  +RALGLVLDLGG +RGMY F+ G K  F+ GD + VKCTSF+
Sbjct  16   VSTRKLKIGTEMTATVDHVRALGLVLDLGGEIRGMYIFQ-GDKDKFKKGDTLRVKCTSFN  74

Query  441  SKGVPVMSLVED  406
            +KGVPVM+LV++
Sbjct  75   TKGVPVMALVDE  86



>ref|XP_010492266.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010492267.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=996

 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 63/91 (69%), Gaps = 1/91 (1%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K+ RK     NK     T +    LK+G +++AKV ++R LGLVLDLGGG+RGMY+FE  
Sbjct  904  KSTRKEDQYENKAEENAT-VSTRNLKIGTEMMAKVQEVRPLGLVLDLGGGIRGMYKFEDN  962

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +F+ GD + VKCTSF++KGVP M LV++
Sbjct  963  EETEFKKGDTLQVKCTSFTTKGVPEMVLVDE  993



>gb|AES74396.2| polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=973

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            + A  L LG K  AKV QIRA GLVLDLGGG+RGMYRFE   K D +VGD++ V  +SFS
Sbjct  901  LTAKDLPLGTKFKAKVFQIRAHGLVLDLGGGVRGMYRFEGDGKTDLKVGDEMPVVLSSFS  960

Query  441  SKGVPVMSLVED  406
            SKG+PV+  V+D
Sbjct  961  SKGIPVVFPVDD  972



>ref|XP_003618178.1| Polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=1106

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  621   IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
             + A  L LG K  AKV QIRA GLVLDLGGG+RGMYRFE   K D +VGD++ V  +SFS
Sbjct  1034  LTAKDLPLGTKFKAKVFQIRAHGLVLDLGGGVRGMYRFEGDGKTDLKVGDEMPVVLSSFS  1093

Query  441   SKGVPVMSLVED  406
             SKG+PV+  V+D
Sbjct  1094  SKGIPVVFPVDD  1105



>ref|XP_006289585.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
 gb|EOA22483.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
Length=944

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 1/72 (1%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKR-DFEVGDQVLVKCTSF  445
            +   KLK+G +++AKV Q R LGLVLDLGGG+RGMY+FE G K   F++GD + VKCTSF
Sbjct  869  VSTRKLKIGTEMMAKVVQTRELGLVLDLGGGIRGMYKFEAGDKEAQFKIGDTLQVKCTSF  928

Query  444  SSKGVPVMSLVE  409
            ++KG+ VM+ V+
Sbjct  929  TTKGIAVMASVD  940



>ref|NP_196962.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
 sp|Q9S7G6.1|PNP2_ARATH RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
Short=AtmtPNPase; AltName: Full=Polynucleotide 
phosphorylase 2; Short=PNPase 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB43864.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB43865.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB87625.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 gb|AED92050.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
Length=991

 Score = 56.6 bits (135),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            +   KLK+G ++ A V  +RALGLVLDLGG +RGMY F+ G K  F+ GD + VKCTSF+
Sbjct  917  VSTRKLKIGTEMTATVDHVRALGLVLDLGGEIRGMYIFQ-GDKDKFKKGDTLRVKCTSFN  975

Query  441  SKGVPVMSLVED  406
            +KGVPVM+LV++
Sbjct  976  TKGVPVMALVDE  987



>ref|XP_002873678.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49937.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 57/72 (79%), Gaps = 0/72 (0%)
 Frame = -2

Query  621  IKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPGAKRDFEVGDQVLVKCTSFS  442
            +    LK+G ++ AKVH+IRA GLVLDLGG LRGMY+F+   + +FE GD + VKCTSFS
Sbjct  917  VSTRNLKIGTEMTAKVHEIRARGLVLDLGGELRGMYKFKEDEETEFEEGDTLQVKCTSFS  976

Query  441  SKGVPVMSLVED  406
            +KG+PVM+LV++
Sbjct  977  TKGIPVMALVDE  988



>ref|XP_010453582.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Camelina sativa]
Length=993

 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K+ RK     NK     T +   KLK+G +++AKV ++R LGLVLDLGGG+RGMY+FE  
Sbjct  901  KSTRKEDQYENKAEESAT-VSTRKLKIGTEMMAKVQEVRPLGLVLDLGGGIRGMYKFEDN  959

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +FE GD + VKCTSF++KGVP M LV++
Sbjct  960  EETEFEEGDTLQVKCTSFTTKGVPKMVLVDE  990



>ref|XP_010420100.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Camelina sativa]
Length=996

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 64/91 (70%), Gaps = 1/91 (1%)
 Frame = -2

Query  678  KAPRKSQSDLNKDSTVETGIKANKLKLGMKLIAKVHQIRAlglvldlggglrGMYRFEPG  499
            K+ RK     NK     T +   +LK+G +++AKV Q+R LGLVLDLGGG+RGMY+FE  
Sbjct  904  KSTRKEDQYENKAEESAT-VSTRELKIGTEMMAKVQQVRPLGLVLDLGGGIRGMYKFEDN  962

Query  498  AKRDFEVGDQVLVKCTSFSSKGVPVMSLVED  406
             + +FE GD + VKCTSF++KG+P M LV++
Sbjct  963  EETEFEEGDTLQVKCTSFTTKGIPEMVLVDE  993



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1117974212060