BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037C08

Length=789
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616058.1|  PREDICTED: probable glutathione S-transferase      302   1e-99   Nicotiana tomentosiformis
ref|XP_009759844.1|  PREDICTED: probable glutathione S-transferas...    298   4e-98   Nicotiana sylvestris
sp|P49332.1|GSTXC_TOBAC  RecName: Full=Probable glutathione S-tra...    298   7e-98   Nicotiana tabacum [American tobacco]
ref|NP_001234157.1|  glutathione S-transferase-like protein             293   3e-96   
ref|XP_004243196.1|  PREDICTED: probable glutathione S-transferase      294   4e-96   Solanum lycopersicum
ref|XP_006364367.1|  PREDICTED: probable glutathione S-transferas...    292   9e-96   Solanum tuberosum [potatoes]
ref|XP_010103478.1|  putative glutathione S-transferase                 292   2e-95   
ref|XP_004243195.1|  PREDICTED: probable glutathione S-transferase      291   2e-95   Solanum lycopersicum
ref|XP_002264437.1|  PREDICTED: probable glutathione S-transferase      290   7e-95   Vitis vinifera
ref|XP_006366776.1|  PREDICTED: probable glutathione S-transferas...    288   4e-94   Solanum tuberosum [potatoes]
ref|XP_006366778.1|  PREDICTED: probable glutathione S-transferas...    287   5e-94   Solanum tuberosum [potatoes]
emb|CAI48072.1|  glutathione S-transferase/peroxidase                   288   5e-94   Capsicum chinense [bonnet pepper]
ref|XP_004294220.1|  PREDICTED: probable glutathione S-transferase      285   8e-93   Fragaria vesca subsp. vesca
ref|XP_009781253.1|  PREDICTED: probable glutathione S-transferase      284   1e-92   Nicotiana sylvestris
ref|NP_001234379.1|  glutathione S-transferase/peroxidase               284   1e-92   
ref|XP_003634747.1|  PREDICTED: probable glutathione S-transferas...    284   2e-92   Vitis vinifera
ref|XP_002264825.1|  PREDICTED: probable glutathione S-transferas...    283   4e-92   Vitis vinifera
emb|CAN83043.1|  hypothetical protein VITISV_027913                     283   6e-92   Vitis vinifera
ref|XP_003634746.1|  PREDICTED: probable glutathione S-transferase      282   7e-92   Vitis vinifera
ref|XP_006442220.1|  hypothetical protein CICLE_v10022164mg             282   8e-92   Citrus clementina [clementine]
ref|XP_003634751.1|  PREDICTED: probable glutathione S-transferase      282   8e-92   Vitis vinifera
ref|XP_002262767.1|  PREDICTED: probable glutathione S-transferase      282   8e-92   Vitis vinifera
ref|XP_006442222.1|  hypothetical protein CICLE_v10022154mg             282   1e-91   Citrus clementina [clementine]
ref|XP_002265110.1|  PREDICTED: probable glutathione S-transferase      281   1e-91   Vitis vinifera
ref|XP_004243194.1|  PREDICTED: probable glutathione S-transferase      281   2e-91   Solanum lycopersicum
ref|XP_006366779.1|  PREDICTED: probable glutathione S-transferas...    281   2e-91   Solanum tuberosum [potatoes]
ref|XP_003634752.1|  PREDICTED: probable glutathione S-transferas...    281   3e-91   
gb|ABL84692.1|  glutathione S-transferase                               281   3e-91   Vitis vinifera
ref|XP_006366777.1|  PREDICTED: probable glutathione S-transferas...    281   3e-91   
gb|AHI54570.1|  glutathione S-transferase                               280   5e-91   Camellia japonica [common camellia]
gb|AEF79856.1|  glutathione-S-transferase tau 1                         280   6e-91   Hevea brasiliensis [jebe]
ref|XP_006477979.1|  PREDICTED: probable glutathione S-transferas...    278   2e-90   Citrus sinensis [apfelsine]
ref|XP_009778021.1|  PREDICTED: probable glutathione S-transferase      278   3e-90   Nicotiana sylvestris
emb|CDP11579.1|  unnamed protein product                                278   3e-90   Coffea canephora [robusta coffee]
emb|CAN66702.1|  hypothetical protein VITISV_005451                     278   3e-90   Vitis vinifera
ref|XP_010062724.1|  PREDICTED: probable glutathione S-transferase      279   8e-90   Eucalyptus grandis [rose gum]
gb|KDO38596.1|  hypothetical protein CISIN_1g027727mg                   277   8e-90   Citrus sinensis [apfelsine]
ref|XP_007212030.1|  hypothetical protein PRUPE_ppa011202mg             277   9e-90   Prunus persica
ref|XP_006478015.1|  PREDICTED: probable glutathione S-transferas...    276   2e-89   Citrus sinensis [apfelsine]
dbj|BAC21261.1|  glutathione S-transferase                              276   2e-89   Cucurbita maxima [Boston marrow]
gb|ADB11314.1|  tau class glutathione transferase GSTU9                 276   3e-89   Populus trichocarpa [western balsam poplar]
ref|XP_006364366.1|  PREDICTED: probable glutathione S-transferas...    275   4e-89   Solanum tuberosum [potatoes]
gb|KDP43662.1|  hypothetical protein JCGZ_24120                         275   5e-89   Jatropha curcas
gb|ACU13552.1|  unknown                                                 275   6e-89   Glycine max [soybeans]
ref|XP_010103480.1|  putative glutathione S-transferase                 275   6e-89   Morus notabilis
ref|XP_002263395.1|  PREDICTED: probable glutathione S-transferase      275   6e-89   Vitis vinifera
ref|XP_002300483.2|  hypothetical protein POPTR_0001s42760g             275   7e-89   
emb|CDP20885.1|  unnamed protein product                                275   7e-89   Coffea canephora [robusta coffee]
gb|KDP24710.1|  hypothetical protein JCGZ_25701                         275   7e-89   Jatropha curcas
gb|KHN27770.1|  Putative glutathione S-transferase                      274   8e-89   Glycine soja [wild soybean]
ref|XP_003634749.1|  PREDICTED: probable glutathione S-transferas...    274   1e-88   Vitis vinifera
ref|XP_007213037.1|  hypothetical protein PRUPE_ppa020220mg             274   1e-88   Prunus persica
ref|XP_004243192.1|  PREDICTED: probable glutathione S-transferase      274   2e-88   Solanum lycopersicum
emb|CBI32905.3|  unnamed protein product                                272   2e-88   Vitis vinifera
ref|XP_002263638.1|  PREDICTED: probable glutathione S-transferase      274   2e-88   Vitis vinifera
ref|XP_011013656.1|  PREDICTED: probable glutathione S-transferase      274   2e-88   Populus euphratica
ref|XP_002300487.1|  hypothetical protein POPTR_0001s42820g             273   2e-88   Populus trichocarpa [western balsam poplar]
gb|AJE59679.1|  tau class glutathione S-transferase                     273   3e-88   Glycine max [soybeans]
ref|XP_007212347.1|  hypothetical protein PRUPE_ppa014555mg             272   7e-88   Prunus persica
ref|XP_011036235.1|  PREDICTED: probable glutathione S-transferase      272   7e-88   Populus euphratica
ref|XP_010060812.1|  PREDICTED: probable glutathione S-transferase      272   7e-88   Eucalyptus grandis [rose gum]
ref|XP_009783951.1|  PREDICTED: probable glutathione S-transferas...    272   1e-87   Nicotiana sylvestris
pdb|2VO4|A  Chain A, Glutathione Transferase From Glycine Max           271   1e-87   Glycine max [soybeans]
ref|NP_001237713.1|  2,4-D inducible glutathione S-transferase          271   1e-87   
ref|XP_009347994.1|  PREDICTED: probable glutathione S-transferase      271   1e-87   
ref|XP_010245128.1|  PREDICTED: probable glutathione S-transferase      271   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_009591608.1|  PREDICTED: probable glutathione S-transferas...    271   2e-87   Nicotiana tomentosiformis
ref|XP_002532823.1|  glutathione s-transferase, putative                271   2e-87   Ricinus communis
ref|XP_003634776.1|  PREDICTED: probable glutathione S-transferas...    271   2e-87   Vitis vinifera
emb|CDP06113.1|  unnamed protein product                                270   3e-87   Coffea canephora [robusta coffee]
ref|XP_008226272.1|  PREDICTED: probable glutathione S-transferas...    270   3e-87   Prunus mume [ume]
ref|XP_010245130.1|  PREDICTED: probable glutathione S-transferas...    270   3e-87   Nelumbo nucifera [Indian lotus]
ref|XP_006360016.1|  PREDICTED: probable glutathione S-transferas...    270   4e-87   Solanum tuberosum [potatoes]
emb|CAN81905.1|  hypothetical protein VITISV_006049                     270   4e-87   Vitis vinifera
ref|XP_010644726.1|  PREDICTED: probable glutathione S-transferas...    270   5e-87   Vitis vinifera
gb|ADC95628.1|  glutathione S-transferase                               270   6e-87   Bruguiera gymnorhiza [Burma mangrove]
emb|CAA04391.1|  glutathione transferase                                270   6e-87   Carica papaya [mamon]
ref|XP_010537670.1|  PREDICTED: glutathione S-transferase U19-like      270   7e-87   Tarenaya hassleriana [spider flower]
ref|XP_009344316.1|  PREDICTED: probable glutathione S-transferase      270   8e-87   Pyrus x bretschneideri [bai li]
ref|XP_008226270.1|  PREDICTED: probable glutathione S-transferas...    270   8e-87   Prunus mume [ume]
gb|AEB77867.1|  glutathione S-transferase protein                       269   1e-86   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_004243197.1|  PREDICTED: probable glutathione S-transferas...    267   1e-86   Solanum lycopersicum
ref|XP_007214172.1|  hypothetical protein PRUPE_ppa019045mg             269   1e-86   Prunus persica
gb|ADB11349.1|  tau class glutathione transferase GSTU8                 269   2e-86   Populus trichocarpa [western balsam poplar]
ref|XP_008226267.1|  PREDICTED: probable glutathione S-transferase      268   2e-86   Prunus mume [ume]
gb|KJB82120.1|  hypothetical protein B456_013G177300                    268   2e-86   Gossypium raimondii
ref|XP_009757658.1|  PREDICTED: probable glutathione S-transferase      268   2e-86   Nicotiana sylvestris
ref|XP_010087165.1|  putative glutathione S-transferase                 268   3e-86   Morus notabilis
ref|XP_007022199.1|  Glutathione S-transferase TAU 19                   268   3e-86   
ref|XP_004488707.1|  PREDICTED: probable glutathione S-transferas...    268   4e-86   Cicer arietinum [garbanzo]
ref|XP_006389991.1|  hypothetical protein EUTSA_v10019118mg             268   5e-86   Eutrema salsugineum [saltwater cress]
ref|XP_009759836.1|  PREDICTED: probable glutathione S-transferase      267   5e-86   Nicotiana sylvestris
gb|AEI01103.1|  glutathione transferase                                 268   5e-86   Nicotiana benthamiana
ref|XP_002317608.1|  glutathione transferase family protein             267   5e-86   Populus trichocarpa [western balsam poplar]
emb|CAA45741.1|  C-7                                                    267   6e-86   Nicotiana tabacum [American tobacco]
ref|XP_002300485.1|  hypothetical protein POPTR_0001s42800g             267   6e-86   Populus trichocarpa [western balsam poplar]
gb|ABG90381.2|  glutathione S-transferase                               267   6e-86   Caragana korshinskii
ref|XP_002298935.2|  hypothetical protein POPTR_0001s42770g             269   6e-86   
ref|XP_009616059.1|  PREDICTED: probable glutathione S-transferase      267   6e-86   Nicotiana tomentosiformis
ref|XP_011030768.1|  PREDICTED: probable glutathione S-transferase      267   7e-86   Populus euphratica
gb|ADB11346.1|  tau class glutathione transferase GSTU4                 267   7e-86   Populus trichocarpa [western balsam poplar]
emb|CBI39919.3|  unnamed protein product                                265   7e-86   Vitis vinifera
gb|KDP43660.1|  hypothetical protein JCGZ_24118                         267   7e-86   Jatropha curcas
ref|XP_002298938.2|  hypothetical protein POPTR_0001s42790g             267   7e-86   
dbj|BAB32446.2|  glutathione S-transferase                              267   8e-86   Matricaria chamomilla
emb|CBI39935.3|  unnamed protein product                                265   8e-86   Vitis vinifera
ref|XP_011098135.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    267   8e-86   Sesamum indicum [beniseed]
emb|CBI39920.3|  unnamed protein product                                265   1e-85   Vitis vinifera
ref|XP_009591607.1|  PREDICTED: probable glutathione S-transferase      266   1e-85   Nicotiana tomentosiformis
ref|XP_008382602.1|  PREDICTED: probable glutathione S-transferase      266   1e-85   Malus domestica [apple tree]
ref|XP_008451810.1|  PREDICTED: probable glutathione S-transferas...    266   1e-85   Cucumis melo [Oriental melon]
emb|CBI32899.3|  unnamed protein product                                265   1e-85   Vitis vinifera
gb|ADB11312.1|  tau class glutathione transferase GSTU3                 266   1e-85   Populus trichocarpa [western balsam poplar]
emb|CBI39927.3|  unnamed protein product                                265   1e-85   Vitis vinifera
ref|XP_008226264.1|  PREDICTED: probable glutathione S-transferase      266   2e-85   Prunus mume [ume]
ref|XP_002269705.1|  PREDICTED: probable glutathione S-transferase      266   2e-85   Vitis vinifera
ref|XP_009104572.1|  PREDICTED: glutathione S-transferase U19           266   3e-85   Brassica rapa
ref|XP_009354819.1|  PREDICTED: probable glutathione S-transferas...    265   3e-85   Pyrus x bretschneideri [bai li]
emb|CBI39926.3|  unnamed protein product                                264   3e-85   Vitis vinifera
ref|XP_010644811.1|  PREDICTED: probable glutathione S-transferase      265   3e-85   Vitis vinifera
gb|ADB11350.1|  putative tau class glutathione transferase GSTU10       265   3e-85   Populus trichocarpa [western balsam poplar]
gb|KHG29593.1|  putative glutathione S-transferase                      265   4e-85   Gossypium arboreum [tree cotton]
ref|XP_006305593.1|  hypothetical protein CARUB_v10010257mg             265   4e-85   Capsella rubella
ref|XP_010103479.1|  putative glutathione S-transferase                 265   4e-85   Morus notabilis
emb|CDX68016.1|  BnaA07g20560D                                          265   4e-85   
ref|XP_007212649.1|  hypothetical protein PRUPE_ppa018201mg             265   4e-85   
gb|KHG06513.1|  putative glutathione S-transferase                      265   5e-85   Gossypium arboreum [tree cotton]
ref|XP_004248222.1|  PREDICTED: probable glutathione S-transferase      265   5e-85   Solanum lycopersicum
ref|XP_008372264.1|  PREDICTED: probable glutathione S-transferase      265   5e-85   Malus domestica [apple tree]
emb|CDX79261.1|  BnaC06g20420D                                          264   9e-85   
ref|XP_002262644.1|  PREDICTED: probable glutathione S-transferase      264   9e-85   Vitis vinifera
gb|KJB82123.1|  hypothetical protein B456_013G177600                    264   9e-85   Gossypium raimondii
gb|KFK42224.1|  hypothetical protein AALP_AA2G227300                    264   9e-85   Arabis alpina [alpine rockcress]
ref|XP_010087160.1|  putative glutathione S-transferase                 264   1e-84   Morus notabilis
emb|CBI39936.3|  unnamed protein product                                262   1e-84   Vitis vinifera
ref|XP_008383009.1|  PREDICTED: probable glutathione S-transferase      264   1e-84   Malus domestica [apple tree]
ref|XP_002266007.2|  PREDICTED: probable glutathione S-transferase      264   1e-84   Vitis vinifera
ref|XP_004294219.1|  PREDICTED: probable glutathione S-transferase      263   2e-84   Fragaria vesca subsp. vesca
ref|XP_007212046.1|  hypothetical protein PRUPE_ppa011371mg             263   2e-84   Prunus persica
ref|XP_011030763.1|  PREDICTED: probable glutathione S-transferas...    263   2e-84   Populus euphratica
ref|XP_002298937.1|  hypothetical protein POPTR_0001s42780g             263   3e-84   Populus trichocarpa [western balsam poplar]
ref|XP_009344314.1|  PREDICTED: probable glutathione S-transferase      263   4e-84   Pyrus x bretschneideri [bai li]
ref|NP_001238691.1|  glutathione S-transferase                          263   4e-84   Glycine max [soybeans]
ref|XP_004294221.1|  PREDICTED: probable glutathione S-transferase      262   5e-84   Fragaria vesca subsp. vesca
ref|XP_008226260.1|  PREDICTED: probable glutathione S-transferase      262   5e-84   Prunus mume [ume]
ref|XP_004147764.1|  PREDICTED: probable glutathione S-transferas...    262   5e-84   Cucumis sativus [cucumbers]
ref|XP_008226269.1|  PREDICTED: probable glutathione S-transferas...    262   5e-84   Prunus mume [ume]
ref|XP_010472053.1|  PREDICTED: glutathione S-transferase U19-like      262   5e-84   Camelina sativa [gold-of-pleasure]
ref|NP_173161.1|  glutathione S-transferase TAU 25                      262   6e-84   Arabidopsis thaliana [mouse-ear cress]
gb|AFK34240.1|  unknown                                                 262   6e-84   Lotus japonicus
ref|XP_010428964.1|  PREDICTED: glutathione S-transferase U19-like      262   6e-84   Camelina sativa [gold-of-pleasure]
ref|XP_011082829.1|  PREDICTED: probable glutathione S-transferase      262   7e-84   Sesamum indicum [beniseed]
gb|ADB11329.1|  tau class glutathione transferase GSTU54                261   1e-83   Populus trichocarpa [western balsam poplar]
emb|CDP11584.1|  unnamed protein product                                259   1e-83   Coffea canephora [robusta coffee]
ref|XP_002270159.1|  PREDICTED: probable glutathione S-transferase      261   1e-83   Vitis vinifera
ref|XP_011012342.1|  PREDICTED: probable glutathione S-transferase      261   1e-83   Populus euphratica
ref|XP_006302801.1|  hypothetical protein CARUB_v10020928mg             261   1e-83   Capsella rubella
ref|XP_006301003.1|  hypothetical protein CARUB_v10021393mg             261   1e-83   Capsella rubella
ref|XP_004251827.1|  PREDICTED: probable glutathione S-transferase      261   2e-83   Solanum lycopersicum
ref|XP_009614585.1|  PREDICTED: probable glutathione S-transferase      260   3e-83   Nicotiana tomentosiformis
ref|XP_007149245.1|  hypothetical protein PHAVU_005G054000g             259   4e-83   Phaseolus vulgaris [French bean]
ref|XP_011013655.1|  PREDICTED: probable glutathione S-transferase      260   5e-83   Populus euphratica
ref|XP_007149248.1|  hypothetical protein PHAVU_005G054200g             259   6e-83   Phaseolus vulgaris [French bean]
gb|KHF99304.1|  putative glutathione S-transferase                      259   6e-83   Gossypium arboreum [tree cotton]
ref|XP_010476862.1|  PREDICTED: glutathione S-transferase U25           259   6e-83   Camelina sativa [gold-of-pleasure]
ref|XP_006389993.1|  hypothetical protein EUTSA_v10019490mg             259   6e-83   
gb|ACI42271.1|  glutathione S-transferase Tau2                          259   7e-83   Citrus sinensis [apfelsine]
gb|ADB11313.1|  tau class glutathione transferase GSTU6                 259   7e-83   Populus trichocarpa [western balsam poplar]
gb|KFK42223.1|  hypothetical protein AALP_AA2G227200                    259   8e-83   Arabis alpina [alpine rockcress]
ref|XP_002515772.1|  glutathione s-transferase, putative                259   9e-83   
ref|XP_010498064.1|  PREDICTED: glutathione S-transferase U25-like      259   9e-83   Camelina sativa [gold-of-pleasure]
gb|ADB11348.1|  tau class glutathione transferase GSTU7                 259   1e-82   Populus trichocarpa [western balsam poplar]
ref|XP_008226263.1|  PREDICTED: probable glutathione S-transferase      259   1e-82   Prunus mume [ume]
gb|AFK49533.1|  unknown                                                 259   1e-82   Medicago truncatula
ref|XP_007149246.1|  hypothetical protein PHAVU_005G054000g             259   1e-82   Phaseolus vulgaris [French bean]
ref|XP_008360297.1|  PREDICTED: probable glutathione S-transferase      259   1e-82   
ref|XP_007149247.1|  hypothetical protein PHAVU_005G054100g             259   1e-82   Phaseolus vulgaris [French bean]
ref|XP_007212678.1|  hypothetical protein PRUPE_ppa018428mg             259   1e-82   Prunus persica
ref|XP_010531898.1|  PREDICTED: glutathione S-transferase U25           258   1e-82   Tarenaya hassleriana [spider flower]
ref|XP_008360299.1|  PREDICTED: probable glutathione S-transferase      258   2e-82   
ref|XP_008226265.1|  PREDICTED: probable glutathione S-transferase      258   2e-82   Prunus mume [ume]
emb|CDP06112.1|  unnamed protein product                                258   2e-82   Coffea canephora [robusta coffee]
ref|XP_004251828.1|  PREDICTED: probable glutathione S-transferas...    258   2e-82   Solanum lycopersicum
ref|XP_011036234.1|  PREDICTED: probable glutathione S-transferase      258   2e-82   Populus euphratica
ref|XP_007213483.1|  hypothetical protein PRUPE_ppa023395mg             258   2e-82   Prunus persica
gb|ADB11366.1|  tau class glutathione transferase GSTU39                258   2e-82   Populus trichocarpa [western balsam poplar]
ref|XP_010459291.1|  PREDICTED: glutathione S-transferase U25-like      258   3e-82   Camelina sativa [gold-of-pleasure]
emb|CBI32895.3|  unnamed protein product                                256   3e-82   Vitis vinifera
gb|AAM64593.1|  glutathione transferase, putative                       258   4e-82   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117719.1|  PREDICTED: glutathione S-transferase U25           258   4e-82   Brassica rapa
ref|NP_001236312.1|  glutathione transferase                            257   4e-82   
gb|ADB11352.1|  tau class glutathione transferase GSTU15                257   4e-82   Populus trichocarpa [western balsam poplar]
ref|XP_006584638.1|  PREDICTED: glutathione S-transferase GST 9 i...    257   4e-82   
ref|NP_565178.1|  glutathione S-transferase TAU 19                      257   5e-82   Arabidopsis thaliana [mouse-ear cress]
emb|CDY14615.1|  BnaC02g24980D                                          257   5e-82   Brassica napus [oilseed rape]
ref|XP_008451814.1|  PREDICTED: probable glutathione S-transferase      257   5e-82   Cucumis melo [Oriental melon]
gb|ADB11347.1|  tau class glutathione transferase GSTU5                 257   7e-82   Populus trichocarpa [western balsam poplar]
gb|KHN27773.1|  Putative glutathione S-transferase                      256   7e-82   Glycine soja [wild soybean]
gb|ACL80571.1|  glutathione S-transferase                               256   8e-82   Glycine max [soybeans]
ref|XP_004147761.1|  PREDICTED: probable glutathione S-transferas...    256   8e-82   Cucumis sativus [cucumbers]
ref|XP_010428961.1|  PREDICTED: glutathione S-transferase U21-like      256   9e-82   Camelina sativa [gold-of-pleasure]
ref|XP_011030762.1|  PREDICTED: probable glutathione S-transferas...    256   9e-82   Populus euphratica
gb|KEH38382.1|  glutathione S-transferase, amino-terminal domain ...    256   1e-81   Medicago truncatula
gb|ACJ85907.1|  unknown                                                 256   1e-81   Medicago truncatula
ref|XP_004295706.1|  PREDICTED: probable glutathione S-transferas...    256   1e-81   Fragaria vesca subsp. vesca
emb|CDY26861.1|  BnaA02g18860D                                          256   1e-81   Brassica napus [oilseed rape]
ref|NP_001234094.1|  uncharacterized protein LOC543817                  256   1e-81   Solanum lycopersicum
gb|AAR26529.1|  glutathione S-transferase 2                             256   2e-81   Glycine max [soybeans]
ref|XP_008226266.1|  PREDICTED: probable glutathione S-transferas...    256   2e-81   Prunus mume [ume]
ref|XP_009354818.1|  PREDICTED: probable glutathione S-transferas...    256   2e-81   Pyrus x bretschneideri [bai li]
ref|XP_007212042.1|  hypothetical protein PRUPE_ppa011334mg             255   2e-81   Prunus persica
gb|KHN27766.1|  Glutathione S-transferase 3                             256   2e-81   Glycine soja [wild soybean]
ref|XP_007133435.1|  hypothetical protein PHAVU_011G178400g             256   2e-81   Phaseolus vulgaris [French bean]
gb|ADB11324.1|  tau class glutathione transferase GSTU33                256   2e-81   Populus trichocarpa [western balsam poplar]
gb|KJB82121.1|  hypothetical protein B456_013G177400                    255   2e-81   Gossypium raimondii
ref|XP_008390701.1|  PREDICTED: probable glutathione S-transferase      255   2e-81   
gb|ACU15945.1|  unknown                                                 255   3e-81   Glycine max [soybeans]
ref|XP_009117717.1|  PREDICTED: glutathione S-transferase U25-like      255   3e-81   Brassica rapa
ref|XP_004243193.1|  PREDICTED: probable glutathione S-transferas...    255   4e-81   Solanum lycopersicum
ref|NP_001275790.1|  glutathione S-transferase                          255   4e-81   Citrus sinensis [apfelsine]
ref|XP_006442221.1|  hypothetical protein CICLE_v10022193mg             254   4e-81   Citrus clementina [clementine]
gb|EYU26249.1|  hypothetical protein MIMGU_mgv1a013392mg                255   5e-81   Erythranthe guttata [common monkey flower]
gb|EYU26251.1|  hypothetical protein MIMGU_mgv1a013400mg                255   5e-81   Erythranthe guttata [common monkey flower]
ref|XP_009106545.1|  PREDICTED: glutathione S-transferase U21           254   5e-81   Brassica rapa
ref|XP_010087162.1|  putative glutathione S-transferase parC            254   6e-81   
ref|XP_008360298.1|  PREDICTED: probable glutathione S-transferase      254   6e-81   
ref|XP_010694823.1|  PREDICTED: probable glutathione S-transferase      254   8e-81   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK94892.1|  unknown                                                 254   1e-80   Populus trichocarpa [western balsam poplar]
gb|ABZ80407.1|  tau glutathione S-transferase                           254   1e-80   Casuarina glauca
ref|XP_009783953.1|  PREDICTED: probable glutathione S-transferase      253   1e-80   Nicotiana sylvestris
ref|NP_177958.1|  glutathione S-transferase TAU 20                      254   1e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010416819.1|  PREDICTED: glutathione S-transferase U21-lik...    254   1e-80   Camelina sativa [gold-of-pleasure]
gb|ADB11318.1|  tau class glutathione transferase GSTU16                254   1e-80   Populus trichocarpa [western balsam poplar]
ref|XP_009117716.1|  PREDICTED: glutathione S-transferase U25-like      254   1e-80   Brassica rapa
emb|CDX88441.1|  BnaC06g38850D                                          253   1e-80   
ref|XP_009757657.1|  PREDICTED: probable glutathione S-transferas...    253   2e-80   Nicotiana sylvestris
ref|XP_008390703.1|  PREDICTED: probable glutathione S-transferase      253   2e-80   
ref|XP_009591606.1|  PREDICTED: probable glutathione S-transferase      253   2e-80   
emb|CAC24549.1|  glutathione S-transferase                              253   2e-80   Cichorium intybus x Cichorium endivia
ref|XP_006349999.1|  PREDICTED: probable glutathione S-transferas...    253   3e-80   Solanum tuberosum [potatoes]
emb|CBI32903.3|  unnamed protein product                                257   3e-80   Vitis vinifera
gb|KEH38383.1|  glutathione S-transferase, amino-terminal domain ...    252   4e-80   Medicago truncatula
ref|XP_006302800.1|  hypothetical protein CARUB_v10020927mg             253   4e-80   Capsella rubella
ref|XP_009354820.1|  PREDICTED: probable glutathione S-transferase      252   4e-80   Pyrus x bretschneideri [bai li]
ref|XP_008390702.1|  PREDICTED: probable glutathione S-transferase      252   4e-80   
gb|KEH38377.1|  glutathione S-transferase, amino-terminal domain ...    252   4e-80   Medicago truncatula
gb|AAM64587.1|  2,4-D inducible glutathione S-transferase, putative     252   4e-80   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002264813.1|  PREDICTED: probable glutathione S-transferas...    252   5e-80   Vitis vinifera
gb|ABD36807.1|  glutathione S-transferase                               252   5e-80   Brassica napus [oilseed rape]
ref|XP_009104573.1|  PREDICTED: glutathione S-transferase U20           252   6e-80   Brassica rapa
ref|XP_010060816.1|  PREDICTED: glutathione S-transferase U25-like      252   6e-80   Eucalyptus grandis [rose gum]
ref|XP_004510706.1|  PREDICTED: probable glutathione S-transferas...    252   6e-80   Cicer arietinum [garbanzo]
emb|CDX68017.1|  BnaA07g20570D                                          251   8e-80   
emb|CDP06114.1|  unnamed protein product                                251   9e-80   Coffea canephora [robusta coffee]
emb|CDX88440.1|  BnaC06g38840D                                          251   9e-80   
gb|KFK42221.1|  hypothetical protein AALP_AA2G227000                    251   1e-79   Arabis alpina [alpine rockcress]
ref|XP_010060808.1|  PREDICTED: probable glutathione S-transferase      251   1e-79   Eucalyptus grandis [rose gum]
ref|XP_009776045.1|  PREDICTED: probable glutathione S-transferas...    251   1e-79   Nicotiana sylvestris
gb|ADB11353.1|  tau class glutathione transferase GSTU17                251   1e-79   Populus trichocarpa [western balsam poplar]
ref|NP_173160.1|  glutathione S-transferase TAU 24                      251   1e-79   Arabidopsis thaliana [mouse-ear cress]
emb|CDX81808.1|  BnaC08g37930D                                          251   2e-79   
ref|XP_002326070.2|  hypothetical protein POPTR_0019s15100g             251   2e-79   
gb|EYU26248.1|  hypothetical protein MIMGU_mgv1a023011mg                251   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_008390704.1|  PREDICTED: probable glutathione S-transferase      250   2e-79   
gb|EYU38214.1|  hypothetical protein MIMGU_mgv1a013218mg                251   2e-79   Erythranthe guttata [common monkey flower]
ref|XP_009612277.1|  PREDICTED: probable glutathione S-transferas...    250   2e-79   Nicotiana tomentosiformis
ref|XP_006387538.1|  hypothetical protein POPTR_0878s00210g             250   3e-79   
gb|KEH38385.1|  glutathione S-transferase, amino-terminal domain ...    250   3e-79   Medicago truncatula
ref|XP_010472051.1|  PREDICTED: glutathione S-transferase U21-like      250   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_009354821.1|  PREDICTED: probable glutathione S-transferase      250   3e-79   Pyrus x bretschneideri [bai li]
ref|XP_002300482.1|  hypothetical protein POPTR_0001s42750g             250   3e-79   Populus trichocarpa [western balsam poplar]
gb|AFK35601.1|  unknown                                                 250   4e-79   Medicago truncatula
gb|KEH38387.1|  glutathione S-transferase, amino-terminal domain ...    250   4e-79   Medicago truncatula
emb|CDY21757.1|  BnaA09g45080D                                          249   5e-79   Brassica napus [oilseed rape]
ref|XP_010472052.1|  PREDICTED: glutathione S-transferase U20           249   6e-79   Camelina sativa [gold-of-pleasure]
gb|EYU26250.1|  hypothetical protein MIMGU_mgv1a022085mg                249   6e-79   Erythranthe guttata [common monkey flower]
ref|XP_008240792.1|  PREDICTED: probable glutathione S-transferas...    249   7e-79   Prunus mume [ume]
ref|NP_177957.1|  glutathione S-transferase TAU 21                      249   8e-79   
ref|XP_007149244.1|  hypothetical protein PHAVU_005G053900g             249   8e-79   Phaseolus vulgaris [French bean]
ref|NP_001236486.1|  glutathione S-transferase GST 9                    248   9e-79   
ref|XP_010428962.1|  PREDICTED: glutathione S-transferase U20-like      249   9e-79   
gb|AFK42157.1|  unknown                                                 249   9e-79   
ref|XP_002276792.1|  PREDICTED: probable glutathione S-transferas...    249   1e-78   
ref|XP_002890207.1|  hypothetical protein ARALYDRAFT_471920             249   1e-78   
ref|XP_010694833.1|  PREDICTED: probable glutathione S-transferase      248   1e-78   
gb|ACJ84004.1|  unknown                                                 248   1e-78   
gb|ABG73420.1|  glutathione S-transferase isoform 2                     248   1e-78   
gb|ACH87175.1|  glutathione S-transferase                               248   1e-78   
gb|KFK42219.1|  hypothetical protein AALP_AA2G226800                    248   1e-78   
ref|XP_004147763.1|  PREDICTED: probable glutathione S-transferas...    248   2e-78   
ref|XP_009418988.1|  PREDICTED: probable glutathione S-transferas...    248   2e-78   
ref|XP_006389992.1|  hypothetical protein EUTSA_v10019114mg             248   2e-78   
gb|KJB82119.1|  hypothetical protein B456_013G177200                    248   2e-78   
ref|XP_006432070.1|  hypothetical protein CICLE_v10002423mg             248   2e-78   
ref|XP_011041780.1|  PREDICTED: probable glutathione S-transferas...    248   3e-78   
gb|AFK35485.1|  unknown                                                 247   4e-78   
ref|XP_010245129.1|  PREDICTED: probable glutathione S-transferas...    247   4e-78   
ref|XP_006303293.1|  hypothetical protein CARUB_v10010098mg             248   4e-78   
gb|ACJ84159.1|  unknown                                                 247   5e-78   
emb|CAN75492.1|  hypothetical protein VITISV_040292                     247   5e-78   
ref|XP_010044071.1|  PREDICTED: glutathione S-transferase U19-like      246   7e-78   
ref|XP_010416820.1|  PREDICTED: glutathione S-transferase U20-like      246   8e-78   
emb|CDX81809.1|  BnaC08g37920D                                          246   1e-77   
gb|KJB61418.1|  hypothetical protein B456_009G357800                    246   1e-77   
ref|XP_009418987.1|  PREDICTED: probable glutathione S-transferas...    246   1e-77   
ref|XP_010923803.1|  PREDICTED: probable glutathione S-transferas...    246   1e-77   
ref|XP_007214387.1|  hypothetical protein PRUPE_ppb009345mg             246   1e-77   
ref|XP_010041120.1|  PREDICTED: glutathione S-transferase U25-like      246   1e-77   
ref|XP_007205876.1|  hypothetical protein PRUPE_ppa011242mg             246   2e-77   
ref|XP_002326068.2|  hypothetical protein POPTR_0019s15100g             246   2e-77   
emb|CDP14180.1|  unnamed protein product                                246   2e-77   
gb|AFK35203.1|  unknown                                                 245   2e-77   
emb|CDX81807.1|  BnaC08g37940D                                          245   2e-77   
emb|CDY48476.1|  BnaC05g13360D                                          245   4e-77   
ref|XP_008351205.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...    244   4e-77   
ref|XP_008226262.1|  PREDICTED: probable glutathione S-transferase      244   5e-77   
ref|XP_009149163.1|  PREDICTED: glutathione S-transferase U25-like      244   6e-77   
gb|ABG73419.1|  glutathione S-transferase isoform 1                     244   6e-77   
emb|CDP06109.1|  unnamed protein product                                246   6e-77   
ref|XP_010923799.1|  PREDICTED: probable glutathione S-transferas...    244   6e-77   
gb|KFK43910.1|  hypothetical protein AALP_AA1G190000                    244   7e-77   
ref|XP_010923805.1|  PREDICTED: probable glutathione S-transferase      244   1e-76   
ref|XP_008226256.1|  PREDICTED: probable glutathione S-transferas...    244   1e-76   
ref|XP_008775487.1|  PREDICTED: glutathione S-transferase 3-like        243   2e-76   
ref|XP_011030764.1|  PREDICTED: probable glutathione S-transferase      243   2e-76   
ref|XP_004500374.1|  PREDICTED: probable glutathione S-transferas...    243   2e-76   
ref|XP_009354827.1|  PREDICTED: probable glutathione S-transferase      243   3e-76   
ref|XP_007214499.1|  hypothetical protein PRUPE_ppa018063mg             243   3e-76   
gb|AFK45916.1|  unknown                                                 242   3e-76   
ref|XP_008775490.1|  PREDICTED: probable glutathione S-transferas...    242   4e-76   
ref|XP_010044074.1|  PREDICTED: probable glutathione S-transferas...    242   4e-76   
ref|XP_010040784.1|  PREDICTED: probable glutathione S-transferase      242   5e-76   
gb|EYU26247.1|  hypothetical protein MIMGU_mgv1a013356mg                242   5e-76   
ref|XP_010060817.1|  PREDICTED: glutathione S-transferase U19-like      242   6e-76   
ref|XP_010416818.1|  PREDICTED: glutathione S-transferase U21-lik...    242   6e-76   
gb|AAO61854.1|  glutathione S-transferase U1                            241   7e-76   
ref|NP_001237686.1|  glutathione S-transferase GST 16                   241   7e-76   
gb|AFK44154.1|  unknown                                                 241   8e-76   
ref|XP_007022193.1|  Glutathione S-transferase TAU 25                   241   8e-76   
ref|XP_006305598.1|  hypothetical protein CARUB_v10010264mg             241   8e-76   
emb|CDP04041.1|  unnamed protein product                                241   9e-76   
emb|CDX81810.1|  BnaC08g37910D                                          241   1e-75   
ref|XP_011098133.1|  PREDICTED: probable glutathione S-transferase      241   1e-75   
gb|KDP37218.1|  hypothetical protein JCGZ_06274                         241   1e-75   
ref|NP_177956.1|  glutathione S-transferase TAU 22                      241   1e-75   
ref|XP_007149238.1|  hypothetical protein PHAVU_005G053300g             241   1e-75   
ref|XP_011030766.1|  PREDICTED: probable glutathione S-transferase      241   1e-75   
ref|XP_011098134.1|  PREDICTED: probable glutathione S-transferas...    240   2e-75   
ref|XP_003596129.1|  Glutathione S-transferase                          240   2e-75   
ref|NP_173162.1|  glutathione S-transferase tau 26                      240   2e-75   
ref|XP_010044072.1|  PREDICTED: probable glutathione S-transferase      240   2e-75   
ref|XP_006836372.1|  hypothetical protein AMTR_s00092p00118580          240   2e-75   
gb|AAC28101.1|  glutathione S-transferase                               240   3e-75   
ref|XP_008809358.1|  PREDICTED: probable glutathione S-transferas...    240   3e-75   
ref|XP_006377853.1|  hypothetical protein POPTR_0011s14380g             239   3e-75   
gb|AAB38965.1|  auxin-induced protein                                   239   4e-75   
gb|KFK25183.1|  hypothetical protein AALP_AA8G077600                    239   4e-75   
ref|XP_010060804.1|  PREDICTED: glutathione S-transferase U25-like      239   5e-75   
ref|XP_008775488.1|  PREDICTED: probable glutathione S-transferas...    239   6e-75   
emb|CDP06116.1|  unnamed protein product                                239   7e-75   
ref|NP_001236181.1|  glutathione S-transferase 3                        239   7e-75   
ref|XP_011098132.1|  PREDICTED: probable glutathione S-transferase      239   7e-75   
gb|ADB11361.1|  tau class glutathione transferase GSTU32                239   8e-75   
sp|P50471.1|GSTX1_NICPL  RecName: Full=Probable glutathione S-tra...    239   8e-75   
ref|XP_002889189.1|  F3F9.11                                            251   8e-75   
ref|XP_006387667.1|  hypothetical protein POPTR_0700s00200g             239   9e-75   
ref|XP_002889188.1|  hypothetical protein ARALYDRAFT_477001             239   9e-75   
ref|XP_010911024.1|  PREDICTED: probable glutathione S-transferas...    239   1e-74   
gb|KCW67677.1|  hypothetical protein EUGRSUZ_F01416                     238   1e-74   
ref|XP_003609894.1|  Glutathione S-transferase                          238   1e-74   
ref|XP_002890209.1|  hypothetical protein ARALYDRAFT_471922             238   1e-74   
ref|XP_004500375.1|  PREDICTED: probable glutathione S-transferas...    238   1e-74   
gb|KEH38386.1|  glutathione S-transferase, amino-terminal domain ...    238   1e-74   
ref|XP_010060810.1|  PREDICTED: probable glutathione S-transferas...    238   1e-74   
gb|AFK39936.1|  unknown                                                 238   1e-74   
ref|XP_010428956.1|  PREDICTED: glutathione S-transferase U22-like      238   1e-74   
emb|CBI32907.3|  unnamed protein product                                236   1e-74   
gb|KCW67676.1|  hypothetical protein EUGRSUZ_F01416                     237   2e-74   
ref|XP_003628404.1|  Glutathione S-transferase                          238   2e-74   
ref|XP_006370194.1|  hypothetical protein POPTR_0001s40510g             238   2e-74   
ref|XP_010060803.1|  PREDICTED: glutathione S-transferase U25-like      238   2e-74   
ref|XP_008451812.1|  PREDICTED: glutathione S-transferase U25-like      238   2e-74   
ref|XP_008222668.1|  PREDICTED: probable glutathione S-transferas...    238   2e-74   
ref|XP_009149162.1|  PREDICTED: glutathione S-transferase U24           238   2e-74   
gb|ADB11323.1|  tau class glutathione transferase GSTU31                238   3e-74   
ref|XP_010472050.1|  PREDICTED: glutathione S-transferase U22           238   3e-74   
ref|XP_008356177.1|  PREDICTED: probable glutathione S-transferase      238   3e-74   
ref|XP_002262607.1|  PREDICTED: probable glutathione S-transferas...    237   3e-74   
gb|ACU15760.1|  unknown                                                 238   3e-74   
emb|CDP22188.1|  unnamed protein product                                235   4e-74   
gb|KHN26783.1|  Glutathione S-transferase 3                             237   4e-74   
gb|ACH63238.1|  glutathione-S-transferase 2                             237   4e-74   
ref|XP_006389995.1|  hypothetical protein EUTSA_v10019479mg             235   5e-74   
ref|XP_009104574.1|  PREDICTED: glutathione S-transferase U22           236   6e-74   
gb|AAM63471.1|  glutathione transferase, putative                       236   7e-74   
ref|XP_010459292.1|  PREDICTED: glutathione S-transferase U26-like      236   7e-74   
ref|XP_009418994.1|  PREDICTED: probable glutathione S-transferas...    236   8e-74   
ref|XP_010476863.1|  PREDICTED: glutathione S-transferase U26           236   8e-74   
gb|KDP37215.1|  hypothetical protein JCGZ_06271                         236   9e-74   
emb|CBI32911.3|  unnamed protein product                                234   9e-74   
ref|XP_010941008.1|  PREDICTED: glutathione S-transferase 3-like        236   1e-73   
ref|XP_006416731.1|  hypothetical protein EUTSA_v10008734mg             236   1e-73   
ref|XP_009110423.1|  PREDICTED: glutathione S-transferase U26           236   1e-73   
emb|CDX68018.1|  BnaA07g20580D                                          236   1e-73   
gb|AJF98577.1|  tau class glutathione S-transferase                     236   1e-73   
ref|XP_010476861.1|  PREDICTED: glutathione S-transferase U24-like      235   2e-73   
ref|XP_006389996.1|  hypothetical protein EUTSA_v10019120mg             235   2e-73   
ref|XP_010923804.1|  PREDICTED: probable glutathione S-transferas...    235   2e-73   
gb|AAF71799.1|AC013430_8  F3F9.13                                       242   2e-73   
emb|CDY21756.1|  BnaA09g45070D                                          235   2e-73   
ref|XP_004488706.1|  PREDICTED: probable glutathione S-transferas...    235   2e-73   
gb|KCW67678.1|  hypothetical protein EUGRSUZ_F01418                     234   3e-73   
ref|XP_010060811.1|  PREDICTED: probable glutathione S-transferas...    235   3e-73   
ref|XP_011048926.1|  PREDICTED: probable glutathione S-transferase      234   4e-73   
ref|XP_006302806.1|  hypothetical protein CARUB_v10020933mg             234   5e-73   
ref|XP_009418995.1|  PREDICTED: probable glutathione S-transferas...    234   5e-73   
gb|EYU26253.1|  hypothetical protein MIMGU_mgv1a013454mg                234   5e-73   
gb|AAO61855.1|  glutathione S-transferase U2                            234   5e-73   
ref|XP_006829366.1|  hypothetical protein AMTR_s00384p00012000          234   6e-73   
ref|XP_007149237.1|  hypothetical protein PHAVU_005G053200g             234   7e-73   
ref|XP_010060805.1|  PREDICTED: probable glutathione S-transferase      234   7e-73   
emb|CBI32906.3|  unnamed protein product                                233   7e-73   
emb|CAN78389.1|  hypothetical protein VITISV_031129                     234   7e-73   
emb|CDP06108.1|  unnamed protein product                                234   7e-73   
gb|AAF71798.1|AC013430_7  F3F9.11                                       246   8e-73   
ref|XP_010459288.1|  PREDICTED: glutathione S-transferase U24 iso...    233   1e-72   
ref|XP_004295708.1|  PREDICTED: probable glutathione S-transferase      233   1e-72   
ref|XP_011460877.1|  PREDICTED: glutathione S-transferase U19-like      233   1e-72   
ref|XP_006389994.1|  hypothetical protein EUTSA_v10019480mg             233   1e-72   
ref|XP_008451811.1|  PREDICTED: probable glutathione S-transferase      233   1e-72   
ref|XP_004981530.1|  PREDICTED: probable glutathione S-transferas...    233   1e-72   
ref|XP_008451813.1|  PREDICTED: probable glutathione S-transferase      236   1e-72   
emb|CDY26267.1|  BnaA06g11500D                                          233   2e-72   
emb|CDX79259.1|  BnaC06g20440D                                          233   2e-72   
ref|NP_001268177.1|  glutathione S-transferase                          233   2e-72   
ref|XP_010535759.1|  PREDICTED: glutathione S-transferase U27           233   2e-72   
gb|AJE59672.1|  tau class glutathione S-transferase                     233   2e-72   
ref|XP_006416732.1|  hypothetical protein EUTSA_v10008735mg             232   2e-72   
gb|AFF18821.1|  glutathione S-transferase parA                          230   3e-72   
ref|XP_006360017.1|  PREDICTED: probable glutathione S-transferas...    232   3e-72   
ref|XP_003550998.1|  PREDICTED: glutathione S-transferase U25-like      232   3e-72   
ref|XP_011082832.1|  PREDICTED: glutathione S-transferase U25-like      232   3e-72   
ref|XP_010416816.1|  PREDICTED: glutathione S-transferase U22-like      232   4e-72   
gb|ABG77522.1|  glutathione S-transferase                               232   4e-72   
ref|XP_010694580.1|  PREDICTED: probable glutathione S-transferas...    232   4e-72   
ref|XP_009783954.1|  PREDICTED: probable glutathione S-transferase      232   5e-72   
ref|XP_007226335.1|  hypothetical protein PRUPE_ppa022301mg             231   7e-72   
ref|XP_010694944.1|  PREDICTED: probable glutathione S-transferas...    231   8e-72   
ref|XP_011036748.1|  PREDICTED: probable glutathione S-transferase      231   1e-71   
gb|KFK42217.1|  hypothetical protein AALP_AA2G226600                    231   1e-71   
gb|KHN22772.1|  Putative glutathione S-transferase parA                 231   1e-71   
ref|XP_008794506.1|  PREDICTED: probable glutathione S-transferas...    231   1e-71   
ref|XP_010534998.1|  PREDICTED: glutathione S-transferase U28           231   1e-71   
gb|ADB11381.1|  tau class glutathione transferase GSTU58                231   2e-71   
ref|NP_001236587.1|  uncharacterized protein LOC100527221               230   2e-71   
ref|NP_001146786.1|  GST6 protein                                       230   2e-71   
gb|ADB11373.1|  tau class glutathione transferase GSTU49                230   2e-71   
ref|XP_006387668.1|  hypothetical protein POPTR_0700s00210g             229   2e-71   
gb|ACG33497.1|  glutathione S-transferase                               230   3e-71   
ref|XP_006388266.1|  hypothetical protein POPTR_0256s00210g             229   3e-71   
emb|CDP06115.1|  unnamed protein product                                228   3e-71   
ref|NP_001105112.1|  glutathione transferase6                           229   4e-71   
ref|XP_002890208.1|  predicted protein                                  229   4e-71   
gb|ADB11321.1|  tau class glutathione transferase GSTU29                229   4e-71   
ref|XP_004147762.1|  PREDICTED: glutathione S-transferase U19-like      229   4e-71   
ref|XP_009418993.1|  PREDICTED: probable glutathione S-transferas...    229   5e-71   
gb|ACA83740.1|  auxin-induced glutathione S transferase                 229   6e-71   
ref|XP_010060809.1|  PREDICTED: glutathione S-transferase U19-like      229   6e-71   
ref|XP_010094424.1|  putative glutathione S-transferase parA            229   6e-71   
ref|XP_004508074.1|  PREDICTED: glutathione S-transferase 3-like        229   7e-71   
ref|XP_010498063.1|  PREDICTED: glutathione S-transferase U24-like      229   7e-71   
dbj|BAK22528.1|  tau glutathione S-transferase                          229   8e-71   
gb|AIP98335.1|  putative glutathione S-transferase                      229   8e-71   
ref|XP_009418992.1|  PREDICTED: probable glutathione S-transferase      228   1e-70   
gb|KFK42222.1|  hypothetical protein AALP_AA2G227100                    228   1e-70   
gb|KEH38379.1|  glutathione S-transferase, amino-terminal domain ...    228   1e-70   
ref|XP_007146897.1|  hypothetical protein PHAVU_006G079600g             228   1e-70   
ref|XP_009420693.1|  PREDICTED: probable glutathione S-transferas...    228   2e-70   
gb|EMS47855.1|  putative glutathione S-transferase                      228   2e-70   
ref|NP_001238712.1|  uncharacterized protein LOC100500477               228   2e-70   
ref|XP_007154491.1|  hypothetical protein PHAVU_003G123300g             228   2e-70   
ref|XP_009149164.1|  PREDICTED: glutathione S-transferase U26           228   2e-70   
ref|XP_010923806.1|  PREDICTED: glutathione S-transferase U19-like      228   2e-70   
ref|XP_002516074.1|  glutathione s-transferase, putative                227   2e-70   
emb|CAN68934.1|  hypothetical protein VITISV_002763                     228   3e-70   
ref|XP_010087154.1|  putative glutathione S-transferase parA            227   3e-70   
emb|CDP01696.1|  unnamed protein product                                227   4e-70   
ref|XP_002316873.1|  hypothetical protein POPTR_0011s11420g             226   6e-70   
gb|ACJ86071.1|  unknown                                                 225   7e-70   
ref|XP_002516073.1|  glutathione s-transferase, putative                232   8e-70   
gb|KCW44929.1|  hypothetical protein EUGRSUZ_L01482                     226   8e-70   
ref|XP_011029535.1|  PREDICTED: probable glutathione S-transferas...    226   9e-70   
ref|NP_177955.1|  glutathione S-transferase TAU 23                      226   1e-69   
gb|KJB82171.1|  hypothetical protein B456_013G179300                    225   1e-69   
ref|XP_009117715.1|  PREDICTED: glutathione S-transferase U25-like      225   1e-69   
ref|XP_008775489.1|  PREDICTED: probable glutathione S-transferas...    225   2e-69   
ref|XP_010044069.1|  PREDICTED: glutathione S-transferase U19-like      224   4e-69   
ref|XP_004248223.1|  PREDICTED: probable glutathione S-transferase      224   4e-69   
emb|CDY48475.1|  BnaC05g13350D                                          222   6e-69   
ref|XP_010060806.1|  PREDICTED: glutathione S-transferase U19-lik...    224   6e-69   



>ref|XP_009616058.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
 sp|Q03666.1|GSTX4_TOBAC RecName: Full=Probable glutathione S-transferase; AltName: Full=Auxin-induced 
protein PCNT107 [Nicotiana tabacum]
 emb|CAA39707.1| auxin-induced protein [Nicotiana tabacum]
Length=221

 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 142/192 (74%), Positives = 165/192 (86%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES IAVEYI+EVWKDKAP LLP
Sbjct  31   YEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPNLLP  88

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPY+++QA+FWADYIDKKLYD GRK WTTKGEE EA  K+ I  LKVLEGALGDKPYFG
Sbjct  89   SDPYDRAQARFWADYIDKKLYDFGRKLWTTKGEEQEAAKKDFIECLKVLEGALGDKPYFG  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GESFGFVD++L+GY  WFY +E+FG+FS EAECPK VAWAKRCM++ESV+K+LPD  K+L
Sbjct  149  GESFGFVDIALIGYYSWFYAYETFGNFSTEAECPKFVAWAKRCMQRESVAKSLPDQPKVL  208

Query  250  EFTHVFREKLGF  215
            EF  V R+K G 
Sbjct  209  EFVKVLRQKFGL  220



>ref|XP_009759844.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
Length=221

 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 139/192 (72%), Positives = 164/192 (85%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES IAVEYI+EVWKDKAP LLP
Sbjct  31   YEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPSLLP  88

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPY+++QA+FWADYIDKKLYD GRK W TKGEE EA  K+ I  LKVLEGALGD+PYFG
Sbjct  89   SDPYDRAQARFWADYIDKKLYDFGRKLWATKGEEQEAAKKDFIECLKVLEGALGDRPYFG  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GESFGFVD++L+G+  WFY +E+FG+FS EAECPK VAWAKRCM++ESV+K+LPD  K+L
Sbjct  149  GESFGFVDIALIGFYSWFYAYETFGNFSAEAECPKFVAWAKRCMQRESVAKSLPDQPKVL  208

Query  250  EFTHVFREKLGF  215
            EF  V R+K G 
Sbjct  209  EFVKVLRQKFGL  220



>sp|P49332.1|GSTXC_TOBAC RecName: Full=Probable glutathione S-transferase parC; AltName: 
Full=Auxin-regulated protein parC [Nicotiana tabacum]
 emb|CAA45740.1| parC [Nicotiana tabacum]
Length=221

 Score =   298 bits (762),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 164/192 (85%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YEY++ED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES IAVEYI+EVWKDKAP LLP
Sbjct  31   YEYKQEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIAVEYIEEVWKDKAPSLLP  88

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPY+++QA+FWADYIDKKLYD GRK W TKGEE EA  K+ I  LKVLEGALGD+PYFG
Sbjct  89   SDPYDRAQARFWADYIDKKLYDFGRKLWATKGEEQEAAKKDFIECLKVLEGALGDRPYFG  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GESFGFVD++L+G+  WFY +E+FG+FS EAECPK VAWAKRCM++ESV+K+LPD  K+L
Sbjct  149  GESFGFVDIALIGFYSWFYAYETFGNFSTEAECPKFVAWAKRCMQRESVAKSLPDQPKVL  208

Query  250  EFTHVFREKLGF  215
            EF  V R+K G 
Sbjct  209  EFVKVLRQKFGL  220



>ref|NP_001234157.1| glutathione S-transferase-like protein [Solanum lycopersicum]
 gb|AAL92873.1| glutathione S-transferase-like protein [Solanum lycopersicum]
Length=220

 Score =   293 bits (751),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 163/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDKAPLLPS
Sbjct  31   YEYRDEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIGVEYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWADYIDKKLY  G K +T  G+E EAG K+ +  LKVLEGALG+KPY+GG
Sbjct  89   DPYERAQARFWADYIDKKLYATGSKIYTATGDEQEAGKKDFVEILKVLEGALGEKPYYGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGF D++L+G+ CWF+ +E +G+FS+EAECP LVAWAKRCM+++SV+KTLPD HKI+E
Sbjct  149  DNFGFGDIALIGFYCWFHAYEVYGNFSIEAECPNLVAWAKRCMQRDSVAKTLPDQHKIIE  208

Query  247  FTHVFREKLGF  215
            F  + REKLG 
Sbjct  209  FVKILREKLGL  219



>ref|XP_004243196.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=241

 Score =   294 bits (752),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 162/190 (85%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDKAPLLPS
Sbjct  52   YEYREEDLPN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIGVEYIDEVWKDKAPLLPS  109

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWADYIDKK Y   RK WTTKGEEL+A  +E I  LKVLEGALGDKPYFGG
Sbjct  110  DPYERAQARFWADYIDKKFYWASRKLWTTKGEELDAAKEEFIVCLKVLEGALGDKPYFGG  169

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD++L+G+ CWF  +E++G+FS EAE PK VAWAKRCM+++SV+K+ PD HK+LE
Sbjct  170  DNFGFVDIALIGFYCWFSAYETYGNFSTEAESPKFVAWAKRCMQRDSVAKSSPDQHKVLE  229

Query  247  FTHVFREKLG  218
            F  V R++LG
Sbjct  230  FVKVVRQRLG  239



>ref|XP_006364367.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   292 bits (748),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDKAP LPS
Sbjct  31   YEYKDEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIGVEYIDEVWKDKAPFLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWADY+DKKL+D GRK WTTKGEE EA  K+ I  LKVLEGALG+KPYFGG
Sbjct  89   DPYERAQARFWADYVDKKLFDSGRKLWTTKGEEQEAAKKDFIECLKVLEGALGEKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD++L+G+  WF+++E++G+FS EAECPK VAWAKRCM+++SV+K+LPD HK+L+
Sbjct  149  DNFGFVDIALIGFYSWFHSYETYGNFSTEAECPKFVAWAKRCMQRDSVAKSLPDQHKVLD  208

Query  247  FTHVFREKLG  218
            F    R K G
Sbjct  209  FVKTLRHKFG  218



>ref|XP_010103478.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96020.1| putative glutathione S-transferase [Morus notabilis]
Length=241

 Score =   292 bits (748),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGKP+ ES I V+Y+DEVW +KAPLLPS
Sbjct  52   YEYKEEDLRN--KSVLLLQMNPIHKKIPVLIHNGKPISESLIIVQYVDEVWNEKAPLLPS  109

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD GR  WTTKGEE EA  KE +G LK+LE  LG+KPYFGG
Sbjct  110  DPYQRAQARFWADFIDKKMYDAGRNVWTTKGEEQEAAKKEFLGNLKLLETELGNKPYFGG  169

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFGFVD++L+G+ CWF+ +E+FG+FS+EAECPKL+AWAKRCMEKESVSK+L D  K+ E
Sbjct  170  DSFGFVDIALIGFSCWFHAYETFGNFSIEAECPKLIAWAKRCMEKESVSKSLADEKKVYE  229

Query  247  FTHVFREKLGF  215
            F    R KLG 
Sbjct  230  FVSRMRNKLGI  240



>ref|XP_004243195.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=222

 Score =   291 bits (746),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 130/190 (68%), Positives = 161/190 (85%), Gaps = 0/190 (0%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+ L + KS LLL+MNP+HKK+PVL+HNGKP+CES I VEYI+EVWKDKAPLLPS
Sbjct  31   YEYKEEEGLISNKSALLLEMNPIHKKVPVLIHNGKPICESIIGVEYIEEVWKDKAPLLPS  90

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FW DYIDKKLY   RK W TKGEE EAG K+ I  LKVLEG LG+KPYFGG
Sbjct  91   DPYERAQARFWVDYIDKKLYVSARKIWGTKGEEQEAGKKDFIEVLKVLEGELGEKPYFGG  150

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD++L+G+  WFY +E++G+FS EAECPK VAWAKRCM+++SV+K+LPD HK+LE
Sbjct  151  DNFGFVDIALIGFYSWFYAYETYGNFSAEAECPKFVAWAKRCMQRDSVAKSLPDQHKVLE  210

Query  247  FTHVFREKLG  218
            F  + R K G
Sbjct  211  FIQMLRRKFG  220



>ref|XP_002264437.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   290 bits (742),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 134/190 (71%), Positives = 162/190 (85%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE+REED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEFREEDLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKK+++LGRK WTTKGE+ EA  KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKIFELGRKIWTTKGEDQEAAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGFVDV+LV + CWFY +E+FG+FS+EAECPKL+AW KRCME+ESVS +L D HK+  
Sbjct  148  ENFGFVDVALVTFSCWFYAYETFGNFSIEAECPKLIAWTKRCMERESVSSSLADPHKVHG  207

Query  247  FTHVFREKLG  218
            F  V R+K G
Sbjct  208  FVVVLRKKFG  217



>ref|XP_006366776.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   288 bits (737),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 162/191 (85%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDK+PLLPS
Sbjct  31   YEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESLIGVEYIDEVWKDKSPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FW DYIDKKLYD  RK ++  G+E EAG K+ I  LKVLEGALG+KPY+GG
Sbjct  89   DPYVRAQARFWGDYIDKKLYDTARKIYSATGDEHEAGKKDFIEILKVLEGALGEKPYYGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGF D++L+G+ CWF  +E +G+FS+EAECPKLVAWAKRCM+++SV+KTLPD HKILE
Sbjct  149  DNFGFGDIALIGFYCWFPAYEIYGNFSIEAECPKLVAWAKRCMKRDSVAKTLPDQHKILE  208

Query  247  FTHVFREKLGF  215
            F  + REKLG 
Sbjct  209  FAKILREKLGL  219



>ref|XP_006366778.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=206

 Score =   287 bits (735),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 163/190 (86%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYI+EVWKDK+PLLPS
Sbjct  17   YEYKEEDLWN--KSPLLLQMNPIHKKIPVLIHNGKPICESLIGVEYIEEVWKDKSPLLPS  74

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FW DYIDKKLYD  RK +TT G+E EAG K+ I  LKVLEGALG+KPYFGG
Sbjct  75   DPYERAQARFWGDYIDKKLYDTSRKIYTTTGDEQEAGKKDFIEILKVLEGALGEKPYFGG  134

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGF D++L+G+ C F+ +E +G+FS++AECPKLVAW KRCM+++SV+KTLPD HKILE
Sbjct  135  DNFGFGDIALIGFYCRFHAYEIYGNFSIKAECPKLVAWGKRCMQRDSVAKTLPDQHKILE  194

Query  247  FTHVFREKLG  218
            F  + R+KLG
Sbjct  195  FIQMLRQKLG  204



>emb|CAI48072.1| glutathione S-transferase/peroxidase [Capsicum chinense]
Length=220

 Score =   288 bits (736),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 132/190 (69%), Positives = 160/190 (84%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAVEYIDEVWKDKAPLLP+
Sbjct  31   YESKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESIIAVEYIDEVWKDKAPLLPT  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWADYIDKK +D  RK WTTKGEE EA  K+ I  LKVLEGALG+KP+FGG
Sbjct  89   DPYERAQARFWADYIDKKFFDSSRKIWTTKGEEQEAAKKDFIECLKVLEGALGEKPFFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVDV+L+G+  WF+ +E+ G+FS EAECPK V WAKRCM+++SV+K+LPD HK+LE
Sbjct  149  DNFGFVDVALIGFYSWFFAYETCGNFSTEAECPKFVTWAKRCMQRDSVAKSLPDQHKVLE  208

Query  247  FTHVFREKLG  218
            F    R+K G
Sbjct  209  FVQTLRKKYG  218



>ref|XP_004294220.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=219

 Score =   285 bits (729),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/190 (70%), Positives = 158/190 (83%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KSELLLKMNPVHKKIPVL+HNGKPVCES I V+YIDEVWKDKAPLLPS
Sbjct  30   YEYSEQDLRN--KSELLLKMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKKLYD GRK WTTKGEE EA  KE I  LKVLEG LGDKPYF G
Sbjct  88   DPYQRAQARFWADFIDKKLYDAGRKIWTTKGEEQEAAKKEFIDILKVLEGELGDKPYFMG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+D++L+ +  WF+ +E+ G FS+EAECPKL++WAKRCM+KESVSK+L D  K+ E
Sbjct  148  ERFGFLDIALITFYSWFHAYETLGSFSIEAECPKLISWAKRCMQKESVSKSLADPKKVCE  207

Query  247  FTHVFREKLG  218
            F    +++LG
Sbjct  208  FLVEMKKRLG  217



>ref|XP_009781253.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D LN  K+ LLL+MNP+HKKIPVL+HNGKP+CES + V+YIDEVWKD +PL+PS
Sbjct  30   YEYKEQDLLN--KTPLLLQMNPIHKKIPVLIHNGKPICESLVIVQYIDEVWKDNSPLMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++ A+FWADY+DKK+YD GRK WT+K E+ EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYERAHARFWADYVDKKIYDTGRKIWTSKKEDQEAANKEFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGFVDV+L+ Y  WF T+E FG+FS+EAECPK+VAWAKRCM+KESVSK+L D  K+ +
Sbjct  148  ESFGFVDVALIPYYTWFPTYEKFGNFSIEAECPKIVAWAKRCMQKESVSKSLADPDKVYD  207

Query  247  FTHVFREKLGFA  212
            F  + R++LG A
Sbjct  208  FIVMLRKRLGIA  219



>ref|NP_001234379.1| glutathione S-transferase/peroxidase [Solanum lycopersicum]
 gb|AAF22647.1|AF193439_1 glutathione S-transferase/peroxidase [Solanum lycopersicum]
Length=220

 Score =   284 bits (727),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDKAP LPS
Sbjct  31   YEYRDEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIGVEYIDEVWKDKAPFLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWADYIDKKLYD GRK WTTKG E E   K+ I  LKVLEGALG+KPYFGG
Sbjct  89   DPYERAQARFWADYIDKKLYDSGRKLWTTKGGEQETAKKDFIECLKVLEGALGEKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
             +FG VD++L+GY  WFY +ES+ + S+EAECPK VAWAK CM ++SV+K+LPD HK+ E
Sbjct  149  GNFGCVDIALIGYYSWFYAYESYANISVEAECPKFVAWAKNCMLRDSVAKSLPDQHKVCE  208

Query  247  FTHVFREKLGF  215
            F  V R+K G 
Sbjct  209  FVKVLRQKFGI  219



>ref|XP_003634747.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   284 bits (726),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEYRQEDLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY+LG K W+TKGEE E G KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQETGKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +E+FG+FS+EAECPKLVAW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYETFGNFSIEAECPKLVAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FIMGMRKRFGI  218



>ref|XP_002264825.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   283 bits (724),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEYRQEDLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY+LG K W+TKGEE E G KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQETGKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +E+FG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYETFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FIMGMRKRFGI  218



>emb|CAN83043.1| hypothetical protein VITISV_027913 [Vitis vinifera]
Length=219

 Score =   283 bits (723),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWHDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLYELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWF  +ESFG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFQAYESFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FVMGMRKKLGI  218



>ref|XP_003634746.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   282 bits (722),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPS
Sbjct  30   YEYREEDLWN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWCDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLY+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKLYELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +E+FG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYETFGNFSMEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FIMGMRKRFGI  218



>ref|XP_006442220.1| hypothetical protein CICLE_v10022164mg [Citrus clementina]
 gb|ESR55460.1| hypothetical protein CICLE_v10022164mg [Citrus clementina]
Length=219

 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNG+PVCES I V+YIDEVWKDKAPLLPS
Sbjct  30   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGRPVCESPIIVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD  RKTWTTKGEE EA  KE    LK LEG LGDKP+FGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDSSRKTWTTKGEEQEAAKKEFFEVLKTLEGQLGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG+VD+SL+ + CWFYT+E+ G FS+EAECPK +AW KRC+++E+V+K LPD  K+ E
Sbjct  148  DNFGYVDLSLIPFYCWFYTYETCGKFSVEAECPKFIAWVKRCLQRETVAKALPDGKKVFE  207

Query  247  FTHVFREKLGF  215
            F  V R  LG 
Sbjct  208  FVSVMRTNLGL  218



>ref|XP_003634751.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPS
Sbjct  30   YEYREEDLWN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWCDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLY+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKLYELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +E+FG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYETFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FIMGMRKRFGI  218



>ref|XP_002262767.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   282 bits (722),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES + V+YIDEVW DK+PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLLIVQYIDEVWHDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLYELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWF+ +ESFG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFHAYESFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FVMGMRKKLGI  218



>ref|XP_006442222.1| hypothetical protein CICLE_v10022154mg [Citrus clementina]
 gb|ESR55462.1| hypothetical protein CICLE_v10022154mg [Citrus clementina]
Length=219

 Score =   282 bits (721),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 126/189 (67%), Positives = 156/189 (83%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D  N  KS LLL+MNPVHKKIPVL+HNGK VCES+I V+YIDEVWKDKAPLLP 
Sbjct  30   YEYKEQDLFN--KSPLLLRMNPVHKKIPVLIHNGKSVCESSIIVQYIDEVWKDKAPLLPY  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD  RKTW TKGEE EA  KE I  LK LEG LGDKP+FGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDTSRKTWATKGEEQEAAKKEFIEVLKTLEGELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG+VD+ L+ Y CWFY++E+FG FS+EAECPK +AW KRC+++E+V+K LPD  K+ E
Sbjct  148  DNFGYVDLCLIPYYCWFYSYETFGKFSVEAECPKFIAWVKRCLQRETVAKALPDEKKVFE  207

Query  247  FTHVFREKL  221
            F  V REK+
Sbjct  208  FVSVLREKI  216



>ref|XP_002265110.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   281 bits (720),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 157/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWHDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW DY+DKKLY+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWVDYVDKKLYELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWF+ +ESFG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFHAYESFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FVMGMRKKLGI  218



>ref|XP_004243194.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=220

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 158/190 (83%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+H+KIPVL+HNGKP+CES I VEYI+EVWKDKAPLLPS
Sbjct  31   FEYREEDLKN--KSPLLLQMNPIHRKIPVLIHNGKPICESIIGVEYIEEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWADYIDKK Y   RK WTTKGEE E   K+ I  LKVLEG LGDKPYFGG
Sbjct  89   DPYERTQARFWADYIDKKFYWPARKLWTTKGEEQEIAKKDFIECLKVLEGVLGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD++L+G+ CWF  +E++G+FS EAE PK  AWAKRCM+++SV+K+ PD HK+LE
Sbjct  149  DNFGFVDIALIGFYCWFSAYETYGNFSTEAEFPKFFAWAKRCMQRDSVAKSSPDQHKVLE  208

Query  247  FTHVFREKLG  218
            F  V R++LG
Sbjct  209  FVKVVRQRLG  218



>ref|XP_006366779.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=222

 Score =   281 bits (720),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = -3

Query  763  LNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQA  584
            L   KS LLL+MNP+HKK+PVL+HNGKP+CES I VEYI+EVWKDKAPLLPSDPYE++QA
Sbjct  39   LITNKSSLLLEMNPIHKKVPVLIHNGKPICESIIGVEYIEEVWKDKAPLLPSDPYERAQA  98

Query  583  KFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDV  404
            +FWADYIDKKLY   RK W TKGEE EAG K+ I  LKVLEG LG+KPYFGG++FGFVD+
Sbjct  99   RFWADYIDKKLYVSSRKIWGTKGEEQEAGKKDFIEVLKVLEGELGEKPYFGGDNFGFVDI  158

Query  403  SLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREK  224
            +L+G+  WFY +E++G+FS EAECPK VAWAKRCM+++SV+K+LPD HK+ EF  + R+K
Sbjct  159  ALIGFYSWFYAYETYGNFSTEAECPKFVAWAKRCMQRDSVAKSLPDQHKVFEFIQMLRQK  218

Query  223  LG  218
             G
Sbjct  219  FG  220



>ref|XP_003634752.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEYRQEDLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY+LG K W+TKGEE E G KE    LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLYELGGKIWSTKGEEQETGKKEFTECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +E+FG+FS+EAECPKLVAW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYETFGNFSIEAECPKLVAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            +    R+KLG 
Sbjct  208  YVVGRRKKLGI  218



>gb|ABL84692.1| glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNPVHKKIP L+HNGKP+CES I V+YIDEVW DK+PLLPS
Sbjct  30   YEYREEDLWN--KSPLLLEMNPVHKKIPALIHNGKPICESLIIVQYIDEVWCDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLY+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKLYELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +E+FG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYETFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FIMGMRKRFGI  218



>ref|XP_006366777.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   281 bits (718),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYI+EVWKDK+PLLPS
Sbjct  31   YEYKEEDLWN--KSPLLLQMNPIHKKIPVLIHNGKPICESIIGVEYIEEVWKDKSPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLY   RK W   GEE EAG KE I  LKVLEGALG+KPYFGG
Sbjct  89   DPYDRAQARFWADYIDKKLYYSARKIWGANGEEQEAGKKEFIECLKVLEGALGEKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD++L+G+  W ++ E++G+FS EAECPK V WAKRCM+++SV+K+LPD HK+LE
Sbjct  149  DNFGFVDIALIGFYSWIHSCETYGNFSTEAECPKFVVWAKRCMQRDSVAKSLPDQHKVLE  208

Query  247  FTHVFREKLGF  215
            F    R KLG 
Sbjct  209  FAKTLRHKLGL  219



>gb|AHI54570.1| glutathione S-transferase [Camellia japonica]
Length=220

 Score =   280 bits (717),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 158/192 (82%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YEYREED  N  KS LLLKMNPVHKKIPVL+HN KPVCES IA++YIDEVWKDK+P LLP
Sbjct  30   YEYREEDLRN--KSPLLLKMNPVHKKIPVLIHNDKPVCESLIALQYIDEVWKDKSPPLLP  87

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPY+++ A+FWADY+DKK+YD GRK WT+K EE EA  KE I  LKVLEG LGDKPYF 
Sbjct  88   SDPYQRAHARFWADYVDKKVYDGGRKVWTSKKEEQEAAKKEFIECLKVLEGELGDKPYFA  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GE+FG++D++LV +  WFY +E+ G+FS+EAECPKL+AW KRCM KESV+KTLPD HK+ 
Sbjct  148  GETFGYIDIALVPFYSWFYAYETCGNFSVEAECPKLIAWVKRCMNKESVAKTLPDQHKVY  207

Query  250  EFTHVFREKLGF  215
            EF  + R+K G 
Sbjct  208  EFVKIVRQKYGL  219



>gb|AEF79856.1| glutathione-S-transferase tau 1 [Hevea brasiliensis]
Length=219

 Score =   280 bits (716),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAV+Y+DEVWKDK+P LPS
Sbjct  30   YEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYVDEVWKDKSPFLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD+GRK WTTKG+E EA  KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADFIDKKIYDIGRKIWTTKGDEQEAAKKEFIEALKLLEGELGNKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES G+VDV+L+ +  WFY +E+ G+FS+E ECP L+AWAKRC++KESVS+++PD  K+ E
Sbjct  148  ESMGYVDVALIPFYSWFYAYETCGNFSIEPECPVLIAWAKRCLQKESVSESVPDPEKVYE  207

Query  247  FTHVFREKLGF  215
            F  V ++K G 
Sbjct  208  FVLVLKKKFGI  218



>ref|XP_006477979.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=219

 Score =   278 bits (712),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/189 (66%), Positives = 155/189 (82%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D  N  KS LLL+MNPVHKKIPVL+HNGK VCES+I V+YIDEVWKDKAPLLP 
Sbjct  30   YEYKEQDLFN--KSPLLLQMNPVHKKIPVLIHNGKSVCESSIIVQYIDEVWKDKAPLLPY  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD  RKTW TKGEE EA  KE I  LK L G LGDKP+FGG
Sbjct  88   DPYQRAQARFWADFIDKKMYDTSRKTWATKGEEQEAAKKEFIEVLKTLGGELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG+VD+ L+ Y CWFY++E+FG FS+EAECPK +AW  RC+++E+V+K LPD  K+ E
Sbjct  148  DNFGYVDLCLIPYYCWFYSYETFGKFSVEAECPKFIAWVTRCLQRETVAKALPDEKKVFE  207

Query  247  FTHVFREKL  221
            F  V REK+
Sbjct  208  FVSVLREKI  216



>ref|XP_009778021.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 159/192 (83%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D LN  K+ LLL+MNP+HKKIPVL+HNGKP+CE+ I V+YIDEVW DK+PL+PS
Sbjct  30   YEYKEQDLLN--KTPLLLQMNPIHKKIPVLIHNGKPICETLIIVQYIDEVWTDKSPLMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++ A+FWADYIDKKLYD+GRK WTTK E+ EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYERAHARFWADYIDKKLYDIGRKIWTTKKEDQEAVNKEFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
             SFGFVD++L+ Y CWF T+E FG+FS+EAECPK+VAWAKRCM+KESVSK+L D  K+ +
Sbjct  148  GSFGFVDMTLIPYYCWFPTYEKFGNFSIEAECPKIVAWAKRCMQKESVSKSLVDPDKVYD  207

Query  247  FTHVFREKLGFA  212
            F  + R+    A
Sbjct  208  FVVMLRQAWDIA  219



>emb|CDP11579.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   278 bits (712),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DK PLLPS
Sbjct  31   YENKEEDLAN--KSPLLLEMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWHDKNPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD GR+ W TKGEE EA  KE IG +K LEG LG+KPYFGG
Sbjct  89   DPYQRAQARFWADFIDKKVYDCGRRIWATKGEEKEAAKKEFIGIMKTLEGELGNKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FG+VDV+L+ + CWF+ +E+FG+F  E ECPKLV WAKRCM++ESVSK+L D HKI E
Sbjct  149  EDFGYVDVALIPFYCWFHAYENFGNFKTETECPKLVEWAKRCMQRESVSKSLADPHKIYE  208

Query  247  FTHVFREKLGF  215
            F    ++KLG 
Sbjct  209  FVVSLKKKLGI  219



>emb|CAN66702.1| hypothetical protein VITISV_005451 [Vitis vinifera]
Length=219

 Score =   278 bits (711),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHK+IPVL+HNGKP+CES I V+YIDEVW DK+PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLEMNPVHKQIPVLIHNGKPICESLIIVQYIDEVWHDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLYGLGRKVWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +ESFG+FS+EAECPKL+AW KRC EKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYESFGNFSIEAECPKLIAWTKRCKEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FVMGMRKRFGI  218



>ref|XP_010062724.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW69857.1| hypothetical protein EUGRSUZ_F03196 [Eucalyptus grandis]
Length=278

 Score =   279 bits (714),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 159/190 (84%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            Y+Y+EED  N  KS LLL MNPVHKKIPVL+HNGKPVCES IAV+YIDEVW DK+PLLPS
Sbjct  89   YDYKEEDLKN--KSPLLLAMNPVHKKIPVLIHNGKPVCESLIAVQYIDEVWHDKSPLLPS  146

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWADY+DKK+YDLGRK W+TKGEE EA  KE + +LK+LEG LGDKP+FGG
Sbjct  147  DPYERAQARFWADYVDKKIYDLGRKIWSTKGEEQEAAKKEFVESLKLLEGELGDKPFFGG  206

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVDV+LV +  WFY +E+ G FS+EAECPKLVAWAKRC+ +ESVSK+LPD  K+  
Sbjct  207  QAFGFVDVALVPFYSWFYAYETCGGFSIEAECPKLVAWAKRCLLRESVSKSLPDPEKVHG  266

Query  247  FTHVFREKLG  218
            F    ++K G
Sbjct  267  FVLELKKKYG  276



>gb|KDO38596.1| hypothetical protein CISIN_1g027727mg [Citrus sinensis]
Length=219

 Score =   277 bits (708),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 124/189 (66%), Positives = 154/189 (81%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D  N  KS LLL+MNPVHKKIPVL+HNGK VCES+I V+YIDEVWKDKAPLLP 
Sbjct  30   YEYKEQDLFN--KSPLLLRMNPVHKKIPVLIHNGKSVCESSIIVQYIDEVWKDKAPLLPY  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD  RKTW TKGEE EA  KE I  LK L G LGDKP+FGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDTSRKTWATKGEEQEAAKKEFIEVLKTLGGELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG+VD+ L+ Y CWFY++E+FG FS+EAECPK +AW  RC+++E+V+K LPD  K+ E
Sbjct  148  DNFGYVDLCLIPYYCWFYSYETFGKFSVEAECPKFIAWVTRCLQRETVAKALPDEKKVFE  207

Query  247  FTHVFREKL  221
            F  V REK+
Sbjct  208  FVSVLREKI  216



>ref|XP_007212030.1| hypothetical protein PRUPE_ppa011202mg [Prunus persica]
 gb|EMJ13229.1| hypothetical protein PRUPE_ppa011202mg [Prunus persica]
Length=219

 Score =   277 bits (708),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 131/190 (69%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+Y+DEVW+DKAPLLPS
Sbjct  30   YEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIIVQYVDEVWRDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY +++++FWAD+IDKKLYD GR  W TKGEE EAG KE I  LK LEG LG+KPYF G
Sbjct  88   DPYLRARSRFWADFIDKKLYDAGRIIWATKGEEQEAGKKEFIEVLKQLEGELGNKPYFEG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+ +  WFY +E+ G+FS EAECPKL+AWAKRCM+KESVSKTLPD+ KI E
Sbjct  148  ESFGFLDIALITFYSWFYAFETCGNFSTEAECPKLIAWAKRCMQKESVSKTLPDNKKIYE  207

Query  247  FTHVFREKLG  218
            F    ++  G
Sbjct  208  FVLGMKKMFG  217



>ref|XP_006478015.1| PREDICTED: probable glutathione S-transferase-like [Citrus sinensis]
Length=219

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNG+P CES I V+YIDEVWKDKAPLLPS
Sbjct  30   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGRPFCESPIIVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD  RKTWTTKGEE EA  KE    LK LEG LGDKP+FGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDSLRKTWTTKGEEQEAAKKEFFEVLKTLEGQLGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG+VD+SL+ + CWFYT+E+ G F++EAECPK +AW KRC+++E+V+K LPD  K+ E
Sbjct  148  DNFGYVDLSLIPFYCWFYTYETCGKFNVEAECPKFIAWVKRCLQRETVAKALPDGKKVFE  207

Query  247  FTHVFREKLGF  215
            F    R  LG 
Sbjct  208  FVSAMRTNLGL  218



>dbj|BAC21261.1| glutathione S-transferase [Cucurbita maxima]
Length=218

 Score =   276 bits (706),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 129/190 (68%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = -3

Query  784  EYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSD  605
            EY E+D  N  KS LLL+MNPVHKKIPVLVHNG+P+CES+I V+YIDEVWKDKAPLLPSD
Sbjct  31   EYMEQDLRN--KSPLLLQMNPVHKKIPVLVHNGRPICESSIIVQYIDEVWKDKAPLLPSD  88

Query  604  PYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGE  425
            PY+++QA+FW D+IDKKLYD GRK WT KGEE+EAG KELIG LK LE  LG+K +FGGE
Sbjct  89   PYQRAQARFWVDFIDKKLYDAGRKVWTGKGEEVEAG-KELIGVLKQLEEVLGEKGFFGGE  147

Query  424  SFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEF  245
              GFVD++L+G+  WFYT+E+FG  S+EAECPK++ WAKRC+EKESVSK+LPDS K+ +F
Sbjct  148  RLGFVDIALIGFHSWFYTYEAFGKLSIEAECPKIMGWAKRCLEKESVSKSLPDSKKVYDF  207

Query  244  THVFREKLGF  215
                ++ LG 
Sbjct  208  AVQMKKALGL  217



>gb|ADB11314.1| tau class glutathione transferase GSTU9 [Populus trichocarpa]
Length=220

 Score =   276 bits (705),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 161/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS LLL+MNPVHKKIPVLVH+GKP+CES I V+YID+VWKDKAPLLPS
Sbjct  31   YEYSEQDLRN--KSALLLQMNPVHKKIPVLVHDGKPICESLIIVQYIDDVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++FWAD++DKKLYDLGRK WTTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYQRAQSRFWADFVDKKLYDLGRKIWTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETVGNFNIEAVCPKLIAYCKRCLEKESVSKSLEDPQKVSD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FVVMRRKKLGL  219



>ref|XP_006364366.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=219

 Score =   275 bits (704),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 129/192 (67%), Positives = 157/192 (82%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+ +N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDK+PLLPS
Sbjct  30   YEYKEENLVN--KSPLLLQMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+K+QA+FWADY+DKK+YD G+K WTTK E+ EA  KE I +LKVLE  LGDKPYF G
Sbjct  88   DPYKKAQARFWADYVDKKIYDGGKKIWTTKVEDQEAANKEFIESLKVLEEELGDKPYFDG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGFVD++L+ Y  WF  +E FG FS+E ECPK VAWAKRCM+KE+VSK L D  KI +
Sbjct  148  ESFGFVDLALIPYYSWFPAYEKFGKFSIEPECPKFVAWAKRCMQKENVSKYLSDPDKIYD  207

Query  247  FTHVFREKLGFA  212
            F  + R+++G A
Sbjct  208  FVVMLRQRMGIA  219



>gb|KDP43662.1| hypothetical protein JCGZ_24120 [Jatropha curcas]
Length=221

 Score =   275 bits (704),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREE+  N  KS LLL+MNPVHKKIPVL+HNGKPV ES IAVEYIDEVWKDK PLLPS
Sbjct  32   HEYREENLRN--KSALLLQMNPVHKKIPVLIHNGKPVVESRIAVEYIDEVWKDKTPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFWAD++DKK+YDLGRKTW TKGEE EA  KE + +LK+LEG LGDKPYFGG
Sbjct  90   DPYQRAQAKFWADFVDKKIYDLGRKTWATKGEEQEAAKKEFMESLKILEGELGDKPYFGG  149

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FG+VDV+ + +  WFY +E  G+FS+EAECPKL+AW KRC+EKE+VS +LPD  KI  
Sbjct  150  ECFGYVDVAFIPFYSWFYAYEVSGNFSIEAECPKLIAWVKRCLEKETVSNSLPDQKKIYG  209

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  210  FVLELKKAYGI  220



>gb|ACU13552.1| unknown [Glycine max]
Length=207

 Score =   275 bits (702),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAV+YI+EVW D+ PLLPS
Sbjct  14   YEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPS  71

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+YDLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  72   DPYQRAQARFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  131

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVD++LV +  WF  +E+FG  ++E+ECPK +AWAKRC++KESV+K+LPD  KI E
Sbjct  132  DNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKIYE  191

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  192  FIMDLRKKLGI  202



>ref|XP_010103480.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96022.1| putative glutathione S-transferase [Morus notabilis]
Length=219

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+  N  KS LLL+MNP+HKKIPVL+HNGKP+ ES   V+YIDEVW DKAPLLPS
Sbjct  30   YEYKEENLSN--KSPLLLQMNPIHKKIPVLIHNGKPISESLTIVQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD   K WTTKGEE EA  KE +  LK+LE  LG+KPYFGG
Sbjct  88   DPYQRAQARFWADFIDKKVYDAAGKVWTTKGEEKEAAKKEFLNILKLLETELGNKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFGFVD++L+G+ CWF+ +E+FG+FS++AECPKL+AWAKRC EKESVSK+L D  K+ E
Sbjct  148  DSFGFVDIALIGFSCWFHAYETFGNFSIKAECPKLIAWAKRCNEKESVSKSLADEKKVYE  207

Query  247  FTHVFREKLGF  215
            F   +R+K+G 
Sbjct  208  FVAEWRKKIGI  218



>ref|XP_002263395.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   275 bits (703),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  K+ LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVW  K+PLLPS
Sbjct  30   YEYREEDPRN--KNPLLLEMNPVHKKIPVLIHNGKPICESMIIVQYIDEVWNKKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLY+LGR+ W+TKGEE E    E I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKLYELGRRIWSTKGEEQETAKNEFIEYLKILEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGFVDV+LV +   FY +ESFG+FS+E ECPKL+AW KRCMEKESVS +L D  K+  
Sbjct  148  EKFGFVDVALVTFSTLFYAYESFGNFSIEVECPKLIAWTKRCMEKESVSSSLKDPQKVHG  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FVMEMRKKLGI  218



>ref|XP_002300483.2| hypothetical protein POPTR_0001s42760g [Populus trichocarpa]
 gb|ADB11311.1| tau class glutathione transferase GSTU2 [Populus trichocarpa]
 gb|EEE85288.2| hypothetical protein POPTR_0001s42760g [Populus trichocarpa]
Length=220

 Score =   275 bits (703),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS+LLL+MNPVHKKIPVLVH+GKPVCES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYSEQDLRN--KSDLLLQMNPVHKKIPVLVHDGKPVCESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP+E++Q++FWAD++DKK+YD GRK WTTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPHERAQSRFWADFVDKKMYDFGRKIWTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC++KESVSK+L D  K+ +
Sbjct  149  ETLGFVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLQKESVSKSLKDPQKVYD  208

Query  247  FTHVFREKLGF  215
            F  + R+  G 
Sbjct  209  FVVMLRKMFGL  219



>emb|CDP20885.1| unnamed protein product [Coffea canephora]
Length=220

 Score =   275 bits (703),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLL++NPVHKKIPVL+HNGKPVCES I V+YIDEVW DK PLLPS
Sbjct  31   YENKEEDLAN--KSPLLLEVNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWHDKNPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++DKK+YD GR+ W TKGEE EA  KE IG +K LEG LG+KPYFGG
Sbjct  89   DPYQRAQARFWADFVDKKVYDCGRRIWATKGEEKEAAKKEFIGIMKTLEGELGNKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FG+VDV+L+ + CWF+ +E FG+F  E ECPKLV WAKRCM++ESVSK+L D HKI E
Sbjct  149  EDFGYVDVALIPFYCWFHAYEKFGNFKTETECPKLVEWAKRCMQRESVSKSLADPHKIYE  208

Query  247  FTHVFREKLGF  215
            F    ++KLG 
Sbjct  209  FVVSLKKKLGI  219



>gb|KDP24710.1| hypothetical protein JCGZ_25701 [Jatropha curcas]
Length=219

 Score =   275 bits (702),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNP+HKKIPVL+H+GKP+CES IAV+Y+DEVW DK+PLLPS
Sbjct  30   YEYREEDLRN--KSPLLLQMNPIHKKIPVLIHDGKPICESLIAVQYVDEVWSDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++DKK+YD+GRK WTTKGEE EA  K+ I  LK+LE  L DKPYFGG
Sbjct  88   DPYQRAQARFWADFVDKKIYDIGRKIWTTKGEEQEAAKKDFIECLKLLEAELEDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  G+VDVSLV +  WFY +E FG+FS E ECPKL+AW KRC+EKESVSK+LPD  K+ +
Sbjct  148  ERIGYVDVSLVPFYSWFYAYEQFGNFSTEVECPKLIAWVKRCLEKESVSKSLPDQQKVYD  207

Query  247  FTHVFREKLGF  215
            F    R+  G+
Sbjct  208  FVLHLRKVYGY  218



>gb|KHN27770.1| Putative glutathione S-transferase [Glycine soja]
Length=203

 Score =   274 bits (700),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAV+YI+EVW D+ PLLPS
Sbjct  14   YEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPS  71

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+YDLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  72   DPYQRAQARFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  131

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVD++LV +  WF  +E+FG  ++E+ECPK +AWAKRC++KESV+K+LPD  K+ E
Sbjct  132  DNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYE  191

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  192  FIMDLRKKLGI  202



>ref|XP_003634749.1| PREDICTED: probable glutathione S-transferase isoform X1 [Vitis 
vinifera]
Length=219

 Score =   274 bits (701),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I V+YIDEVW +K+PLLPS
Sbjct  30   YEYREEDTSN--KSPLLLEMNPIHKKIPVLIHNGKPICESMIIVQYIDEVWNEKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLY+LGR+ W+TKGEE E    E I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKLYELGRRIWSTKGEEQETAKNEFIEYLKILEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGFVDV+LV +   FY +ESFG+FS+E ECPKL+AW KRC EKESVS +L D  K+  
Sbjct  148  EKFGFVDVALVTFSTLFYAYESFGNFSIEVECPKLIAWTKRCKEKESVSSSLKDPQKVHG  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FVMEMRKKLGI  218



>ref|XP_007213037.1| hypothetical protein PRUPE_ppa020220mg [Prunus persica]
 gb|EMJ14236.1| hypothetical protein PRUPE_ppa020220mg [Prunus persica]
Length=220

 Score =   274 bits (700),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED LNN KS LLL+MNPVHKKIPVL+HNGKPVCES   V+YIDE WKDKAPLLPS
Sbjct  30   YEYREEDLLNN-KSPLLLQMNPVHKKIPVLIHNGKPVCESANIVQYIDEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW DYIDK LY++GR  W TKGEE +   K+LI  LK+LEG LGD  +FGG
Sbjct  89   DPYQRAQARFWVDYIDKNLYEVGRNIWATKGEEQDEAKKKLIEILKLLEGQLGDNSFFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+DV+LV   CWF+++E+ G+FS+EAECPKL+ WAKRCM+KESV+K+L D  K+ E
Sbjct  149  EIFGFLDVALVTVYCWFFSYETCGNFSIEAECPKLIEWAKRCMQKESVAKSLADPKKVYE  208

Query  247  FTHVFREKLG  218
            FT + +++ G
Sbjct  209  FTLLLKKRFG  218



>ref|XP_004243192.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=219

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 155/192 (81%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+ +N  KS LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVW DK+PLLPS
Sbjct  30   YEYKEENLVN--KSPLLLQMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWNDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+YD G+K WTTK EE EA  KE I  LKVLEG LGDKPYF G
Sbjct  88   DPYKRAQARFWADYVDKKIYDGGKKIWTTKVEEQEAANKEFIECLKVLEGELGDKPYFDG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGFVD++L+ Y  WF  +E FG FS+E ECPK VAWA RCM+KE+VSK L D  KI +
Sbjct  148  ESFGFVDLALIPYYSWFPAYEKFGKFSIEPECPKFVAWANRCMQKENVSKYLSDPDKIYD  207

Query  247  FTHVFREKLGFA  212
            F  + R+++G A
Sbjct  208  FVVMLRQRIGIA  219



>emb|CBI32905.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   272 bits (695),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 148/171 (87%), Gaps = 0/171 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPSDPY+++QA+FWADYIDKK+
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYIDKKI  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            ++LGRK WTTKGE+ EA  KE I  LK+LEG LG+KPYFGGE+FGFVDV+LV + CWFY 
Sbjct  61   FELGRKIWTTKGEDQEAAKKEFIECLKLLEGELGEKPYFGGENFGFVDVALVTFSCWFYA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLG  218
            +E+FG+FS+EAECPKL+AW KRCME+ESVS +L D HK+  F  V R+K G
Sbjct  121  YETFGNFSIEAECPKLIAWTKRCMERESVSSSLADPHKVHGFVVVLRKKFG  171



>ref|XP_002263638.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 128/191 (67%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHK+IPVL+HNGKP+CES I V+YIDEVW DK+PLL S
Sbjct  30   YEYKEEDLRN--KSPLLLEMNPVHKQIPVLIHNGKPICESLIIVQYIDEVWHDKSPLLRS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY LGRK W+TKGEE E   KE I  L++LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLYGLGRKVWSTKGEEQETAKKEFIECLQLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +ESFG+FS+EAECPKL+AW KRC EKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVTFSCWFYAYESFGNFSIEAECPKLIAWTKRCKEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FVMGMRKRFGI  218



>ref|XP_011013656.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   274 bits (700),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS+LLL+MNPVHKKIPVLVH+GKPVCES I V+YIDEVWK+KAPLLPS
Sbjct  31   YEYSEQDLRN--KSDLLLQMNPVHKKIPVLVHDGKPVCESLIIVQYIDEVWKEKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE+++++FWAD++DKK+YD GRK WTTKGE+ E   K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYERARSRFWADFVDKKMYDFGRKIWTTKGEDQEVAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+ + CWFY +E+ G+F++EA+CPKL+ + KRC++KESVSK+L D HK+ +
Sbjct  149  ETLGFVDVALLPFYCWFYAYETIGNFNIEADCPKLITYCKRCLQKESVSKSLKDPHKVYD  208

Query  247  FTHVFREKLGF  215
            F  + R+ LG 
Sbjct  209  FVVMLRKMLGL  219



>ref|XP_002300487.1| hypothetical protein POPTR_0001s42820g [Populus trichocarpa]
 gb|EEE85292.1| hypothetical protein POPTR_0001s42820g [Populus trichocarpa]
Length=220

 Score =   273 bits (699),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS LLL+MNPVHKKIPVLVH+GKP+CES I V+YID+VWKDKAPLLPS
Sbjct  31   YEYSEQDLRN--KSALLLQMNPVHKKIPVLVHDGKPICESLIIVQYIDDVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++FWAD++DKKLYDLGRK WTTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYQRAQSRFWADFVDKKLYDLGRKIWTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETVGNFNIEAVCPKLIAYCKRCLEKESVSKSLEDPQKVSD  208

Query  247  FTHVFREKLGF  215
            F  + R+ LG 
Sbjct  209  FVVMRRKMLGL  219



>gb|AJE59679.1| tau class glutathione S-transferase [Glycine max]
Length=219

 Score =   273 bits (698),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAV+YI+EVW D+ PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+YDLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVD++LV +  WF  +E+FG  ++E+ECPK +AWAKRC++KESV+K+LPD  K+ E
Sbjct  148  DNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYE  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FIMDLRKKLGI  218



>ref|XP_007212347.1| hypothetical protein PRUPE_ppa014555mg [Prunus persica]
 gb|EMJ13546.1| hypothetical protein PRUPE_ppa014555mg [Prunus persica]
Length=220

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/190 (66%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED LNN KS LLL+ NPVHKKIPVL+HNGKPVCES   V+YIDE WKDKAPLLPS
Sbjct  30   YEYREEDLLNN-KSPLLLQTNPVHKKIPVLIHNGKPVCESANIVQYIDEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ A+FW DYIDK LY+ G+  W TKGEE EA   +LI  LK+LEG LGD  +FGG
Sbjct  89   DPYQRALARFWVDYIDKNLYEAGKNIWATKGEEQEAAKNKLIEILKLLEGQLGDNSFFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+DV+LV + CWF+++E+ G+FS+EAECPKL+ WAKRCMEKESV+K+L DS K+ E
Sbjct  149  EIFGFLDVALVTFYCWFFSYETCGNFSIEAECPKLIEWAKRCMEKESVAKSLADSKKVYE  208

Query  247  FTHVFREKLG  218
            FT + +++ G
Sbjct  209  FTLLLKKRFG  218



>ref|XP_011036235.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 160/190 (84%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS+LLL+MNPVHKKIPVLVH+GKPVCES I V+YIDEVWK+KAPLLPS
Sbjct  31   YEYSEQDLRN--KSDLLLQMNPVHKKIPVLVHDGKPVCESLIIVQYIDEVWKEKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE+++++FWAD++DKK+YD GRK WTTKGE+ E   K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYERARSRFWADFVDKKMYDFGRKIWTTKGEDQEVAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC++KESVSK+L D  K+ +
Sbjct  149  ETLGFVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLQKESVSKSLKDPRKVYD  208

Query  247  FTHVFREKLG  218
            F  + R+ LG
Sbjct  209  FVVMLRKMLG  218



>ref|XP_010060812.1| PREDICTED: probable glutathione S-transferase [Eucalyptus grandis]
 gb|KCW67684.1| hypothetical protein EUGRSUZ_F01428 [Eucalyptus grandis]
Length=219

 Score =   272 bits (696),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS+LLL+MNPVHKKIPVLVHNGKPVCES I ++YI+E W D+ PLLPS
Sbjct  30   YEYKEEDLRN--KSDLLLRMNPVHKKIPVLVHNGKPVCESLIILQYIEETWPDRCPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK YDLGRK WTTKGEE E   KELI ++KVLEG LGDKP+FGG
Sbjct  88   DPYQRAQARFWADYVDKKFYDLGRKVWTTKGEEQEVAKKELIESMKVLEGELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV++V +  WFY +E  G+FS+EAECPKL+AW KRC+E E+VSK+L D HK+ +
Sbjct  148  EKLGFVDVAIVPFSTWFYAYEMCGNFSIEAECPKLIAWTKRCLEIETVSKSLVDPHKVYD  207

Query  247  FTHVFREKLGF  215
            F    ++ LG 
Sbjct  208  FILQLKKALGI  218



>ref|XP_009783951.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
 ref|XP_009783952.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
Length=220

 Score =   272 bits (695),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 132/191 (69%), Positives = 156/191 (82%), Gaps = 3/191 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED L   KS LLLK+NP+HKK+PVL+HNGK VCES I VEYIDEVW DKAPLLPS
Sbjct  30   YEYKEED-LFTAKSPLLLKINPIHKKVPVLIHNGKIVCESLIVVEYIDEVWNDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLE-GALGDKPYFG  431
            DPYE++QA+FWADY DK LYD GRK W TK EEL+   KELI  LK+LE   LGDKPYFG
Sbjct  89   DPYERAQARFWADYTDK-LYDYGRKIWATKREELKEAKKELIDPLKLLELEVLGDKPYFG  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GE+FGFVD++L+G+ CWFYT+E+F +FS+EAECPKL AW KRCM++ESVSK+LPD +KI 
Sbjct  148  GENFGFVDIALIGFYCWFYTYENFANFSIEAECPKLAAWGKRCMQRESVSKSLPDPYKIY  207

Query  250  EFTHVFREKLG  218
            E    FR+  G
Sbjct  208  EVLLEFRKNYG  218



>pdb|2VO4|A Chain A, Glutathione Transferase From Glycine Max
 pdb|2VO4|B Chain B, Glutathione Transferase From Glycine Max
Length=219

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAV+YI+EVW D+ PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q +FWADY+DKK+YDLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVD++LV +  WF  +E+FG  ++E+ECPK +AWAKRC++KESV+K+LPD  K+ E
Sbjct  148  DNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYE  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FIMDLRKKLGI  218



>ref|NP_001237713.1| 2,4-D inducible glutathione S-transferase [Glycine max]
 pdb|4TOP|A Chain A, Glycine Max Glutathione Transferase
 pdb|4TOP|B Chain B, Glycine Max Glutathione Transferase
 gb|AAC18566.1| 2,4-D inducible glutathione S-transferase [Glycine max]
Length=219

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAV+YI+EVW D+ PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q +FWADY+DKK+YDLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQTRFWADYVDKKIYDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVD++LV +  WF  +E+FG  ++E+ECPK +AWAKRC++KESV+K+LPD  K+ E
Sbjct  148  DNLGFVDIALVPFYTWFKAYETFGTLNIESECPKFIAWAKRCLQKESVAKSLPDQQKVYE  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FIMDLRKKLGI  218



>ref|XP_009347994.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   271 bits (694),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N +KS+LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW+DKAPLLPS
Sbjct  30   YEYREEDLRNKIKSQLLLQMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWRDKAPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            +PY+K+ ++FWAD+IDKKLYD   K W+TKGEE EA  K+ I  LK LEG LGDK YF G
Sbjct  90   EPYQKAHSRFWADFIDKKLYDACSKIWSTKGEEREAAKKDFIEILKQLEGQLGDKQYFEG  149

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+D++L+ + CWF+ +E+ G+FS+EAECPKL+AWAKRCM++ESVS++L D  K+ E
Sbjct  150  EKFGFLDIALITFYCWFHAFETCGNFSIEAECPKLIAWAKRCMQRESVSRSLADEKKVYE  209

Query  247  FTHVFREKLG  218
                 ++ LG
Sbjct  210  LVLGVQKMLG  219



>ref|XP_010245128.1| PREDICTED: probable glutathione S-transferase [Nelumbo nucifera]
Length=219

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+E+  +  KS +LL+MNPVHKKIPVL+HNG+P+CES + V+YIDEVWKDK+PLLPS
Sbjct  30   YEYRDENLQD--KSPMLLEMNPVHKKIPVLIHNGRPICESLLIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+Y    + W  KGEE EA  +ELI +LKVL+G LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKMYYCMSRIWRNKGEEQEAAKEELIESLKVLQGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGFVD+S V +  WFY+ E+ G+FS+E+ECPK+VAWAKRCME+ESVSKTLP  HKI E
Sbjct  148  ETFGFVDLSFVSFYSWFYSTETCGNFSIESECPKIVAWAKRCMERESVSKTLPHHHKIYE  207

Query  247  FTHVFREKLGF  215
            F    R++LG 
Sbjct  208  FVLQLRKRLGI  218



>ref|XP_009591608.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
tomentosiformis]
 ref|XP_009591609.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
tomentosiformis]
 ref|XP_009591611.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
tomentosiformis]
Length=221

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/191 (70%), Positives = 154/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED L   KS LLLKMNP+HKKIPVL+HNGK VCES IAVEYIDEVW DKAPLLPS
Sbjct  31   YEYKEED-LFTAKSPLLLKMNPIHKKIPVLIHNGKTVCESLIAVEYIDEVWNDKAPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLE-GALGDKPYFG  431
            DPYE++QA+FWADY D KLYD GRK W TK EE E   K+LI  LK+LE   L DKPYFG
Sbjct  90   DPYERAQARFWADYTD-KLYDYGRKIWATKREEFEGITKDLIDPLKLLELEVLRDKPYFG  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GESFGFVD++L+G+ CWFYT+E+ G+FS+ AECPKL AW KRCM++ESVSK++PD HKI 
Sbjct  149  GESFGFVDIALIGFYCWFYTYENVGNFSIVAECPKLAAWGKRCMQRESVSKSVPDPHKIY  208

Query  250  EFTHVFREKLG  218
            E    FR+  G
Sbjct  209  EVLLEFRKNYG  219



>ref|XP_002532823.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF29553.1| glutathione s-transferase, putative [Ricinus communis]
Length=219

 Score =   271 bits (693),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 156/190 (82%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREE+  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IAV+YIDEVW D++PLLPS
Sbjct  30   YEYREENLRN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIAVQYIDEVWHDESPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++ A+FWAD++DKK+Y+LGRK WTTKGE+ EAG KE I  +K+LEG LGDKPYFGG
Sbjct  88   DSYPRAHARFWADFVDKKIYELGRKIWTTKGEDQEAGKKEFIDAIKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFG+VDV+L+ +  WFY +E+ G+FS+EAECPK +AW KRC++KESVSK LPD  K+ E
Sbjct  148  ESFGYVDVALIPFYSWFYAYETCGNFSIEAECPKFMAWIKRCLQKESVSKALPDQQKVYE  207

Query  247  FTHVFREKLG  218
            F    ++  G
Sbjct  208  FVLELKKVFG  217



>ref|XP_003634776.1| PREDICTED: probable glutathione S-transferase parC [Vitis vinifera]
Length=219

 Score =   271 bits (692),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+ ED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEYKGEDLWN--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKL +LG+K  +TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKLAELGKKICSTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVDV+LV + CWFY +ESFG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  
Sbjct  148  EKIGFVDVALVPFSCWFYAYESFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHG  207

Query  247  FTHVFREKLGF  215
            +    R+K G 
Sbjct  208  YVVGIRKKYGI  218



>emb|CDP06113.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   270 bits (690),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 156/191 (82%), Gaps = 4/191 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL++NPVHKKIPV++HNGKPVCES I V+YIDEVW DK PLLPS
Sbjct  17   YEYKEEDLGN--KSPLLLQLNPVHKKIPVMIHNGKPVCESLIIVQYIDEVWHDKNPLLPS  74

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++DKK+YD  R+ WTTKGEE EA  KE I  LK LEG LG+KPYFGG
Sbjct  75   DPYQRAQARFWADFVDKKVYDSTRRIWTTKGEEKEAAKKEFIEILKTLEGELGNKPYFGG  134

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VDV+L+ + CWFY +E+FG+F +  ECPKLV WAKRCM++ESVSK+L D HK+ E
Sbjct  135  ENFGYVDVALIPFYCWFYAYETFGNFKI--ECPKLVEWAKRCMQRESVSKSLADPHKVYE  192

Query  247  FTHVFREKLGF  215
            F    ++KLG 
Sbjct  193  FVVSLKKKLGI  203



>ref|XP_008226272.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=220

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  NN KS LLL+MNPVHKKIPVL+HNGKPVCES   V+YIDE WKDKAPLLPS
Sbjct  30   YEYREEDLPNN-KSPLLLQMNPVHKKIPVLIHNGKPVCESANIVQYIDEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW DYIDK LY+ G+  W TKGEE EA  K+LI  LK+LEG LGD  YFGG
Sbjct  89   DPYQRAQARFWVDYIDKNLYEAGKNIWATKGEEQEAAKKKLIEILKLLEGQLGDDTYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+DV+LV + CWF+++E+ G+FS+EAECPKL+ WAKRC++K+SV+K+L D  K+ E
Sbjct  149  EIFGFLDVALVTFYCWFFSYETCGNFSIEAECPKLIEWAKRCLQKDSVAKSLADPKKVYE  208

Query  247  FTHVFREKLG  218
            FT + ++  G
Sbjct  209  FTLLLKKMFG  218



>ref|XP_010245130.1| PREDICTED: probable glutathione S-transferase parC [Nelumbo nucifera]
Length=219

 Score =   270 bits (691),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I ++YIDEVWKDK PL+PS
Sbjct  30   YEYRDEDLQN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIILQYIDEVWKDKLPLMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP++++QA+FWAD+ DKK+YD GR+ W TKGE+ EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPHKRAQARFWADFTDKKIYDCGRRIWATKGEDQEAAKKEFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++  FVDV+LV +  WFY +E+ G+FS+EA CPK VAWAKRCM+KESVSK+LPD +K+ +
Sbjct  148  DALDFVDVTLVPFYSWFYAYETCGNFSIEAHCPKFVAWAKRCMQKESVSKSLPDQNKVYD  207

Query  247  FTHVFREKLGF  215
            F  V ++K G 
Sbjct  208  FVLVLKKKFGI  218



>ref|XP_006360016.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=221

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 156/192 (81%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED   + KS LLLKMNP+HKKIPVL+HNGKPVCES + VEYIDEVWKDKAPLLPS
Sbjct  31   YEYKEEDLFCS-KSPLLLKMNPIHKKIPVLIHNGKPVCESFVVVEYIDEVWKDKAPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVL-EGALGDKPYFG  431
            DPYE+SQA+FWA Y D KLYD GR+ WT K EE   G K+LI  LK+L E ALGD+PYFG
Sbjct  90   DPYERSQARFWASYTD-KLYDFGRRVWTHKREEFAEGKKDLIDPLKLLEEAALGDQPYFG  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GESFGFVD++L+G+  WFYT+E+  +FS+EAECPK+ AW KRCM++ESVSK+LPDSHKI 
Sbjct  149  GESFGFVDIALIGFYIWFYTYETICNFSIEAECPKIAAWGKRCMKRESVSKSLPDSHKIY  208

Query  250  EFTHVFREKLGF  215
            E     R+K G 
Sbjct  209  EVVIENRKKSGL  220



>emb|CAN81905.1| hypothetical protein VITISV_006049 [Vitis vinifera]
Length=220

 Score =   270 bits (691),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 130/191 (68%), Positives = 157/191 (82%), Gaps = 3/191 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREE+  N  KS LLL+MNPVHKK+PVL+HNGKP+CES + V+YIDEVWKDK+PLLPS
Sbjct  30   YEYREENLWN--KSPLLLEMNPVHKKVPVLIHNGKPICESLMIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLY-DLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            DPY+++QA+FWADY+DKKLY +LG+K W TKGEE EAG KE I  LK  EG LG+KPYFG
Sbjct  88   DPYQRAQARFWADYVDKKLYHELGKKIWYTKGEEHEAGKKEFIECLKFFEGELGEKPYFG  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GE+FGF DV+LV   CWFYT+ESFG+FS+E ECP L+AWAKRC +KESVS +L D HK+ 
Sbjct  148  GENFGFEDVALVPLSCWFYTYESFGNFSVEDECPNLMAWAKRCGQKESVSSSLADPHKVH  207

Query  250  EFTHVFREKLG  218
             F    R++LG
Sbjct  208  GFVMEMRKRLG  218



>ref|XP_010644726.1| PREDICTED: probable glutathione S-transferase isoform X2 [Vitis 
vinifera]
Length=219

 Score =   270 bits (690),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 129/191 (68%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED     KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPS
Sbjct  30   YEYREEDLWK--KSPLLLEMNPVHKKIPVLIHNGKPICESLIIVQYIDEVWCDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLY+LGR+ W+TKGEE E    E I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKLYELGRRIWSTKGEEQETAKNEFIEYLKILEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGFVDV+LV +   FY +ESFG+FS+E ECPKL+AW KRC EKESVS +L D  K+  
Sbjct  148  EKFGFVDVALVTFSTLFYAYESFGNFSIEVECPKLIAWTKRCKEKESVSSSLKDPQKVHG  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FVMEMRKKLGI  218



>gb|ADC95628.1| glutathione S-transferase [Bruguiera gymnorhiza]
Length=219

 Score =   270 bits (690),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYRE+D +N  KS LLL+MNPVHKKIPVLVHNGKPVCES IAV+Y+DE WKDKAPLLPS
Sbjct  30   FEYREQDLMN--KSPLLLQMNPVHKKIPVLVHNGKPVCESLIAVQYVDETWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++DKK+YDLGRKTW TKGEE E   KELI   K+LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWADFVDKKIYDLGRKTWQTKGEEQEGAKKELIECFKLLEKELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VDV+LV +  WF  +E  G+FS+EAECPKL+ WA RC++KESVSK+L D  K+  
Sbjct  148  ETFGYVDVTLVPFYSWFDVYERSGNFSVEAECPKLMEWANRCLQKESVSKSLVDREKVYG  207

Query  247  FTHVFREKLGF  215
            F    ++K G 
Sbjct  208  FVLELKKKFGI  218



>emb|CAA04391.1| glutathione transferase [Carica papaya]
Length=218

 Score =   270 bits (689),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I ++YIDEVW DKAPLLPS
Sbjct  30   YEYKEENLRN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIQIQYIDEVWSDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+Y+ GR+ WTTKGEE E   KE I  LK LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKMYEAGRRVWTTKGEEQEGAKKEFIEILKTLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFG+VD++ + +  WF  +ESFG  S+EAECPKL +W KRC+EKESVSK+LPD  K+  
Sbjct  148  ESFGYVDLTFIPFYTWFSVYESFGKMSIEAECPKLFSWVKRCLEKESVSKSLPDQDKVYG  207

Query  247  FTHVFREKLGF  215
            F    R+ LG 
Sbjct  208  FVLELRKALGI  218



>ref|XP_010537670.1| PREDICTED: glutathione S-transferase U19-like [Tarenaya hassleriana]
Length=219

 Score =   270 bits (689),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS+LLL+MNPVH+KIPVL+HNGKPVCES I V+YIDEVW DKAP+LPS
Sbjct  30   YEYREEDLRN--KSQLLLQMNPVHRKIPVLIHNGKPVCESLIQVQYIDEVWSDKAPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+YD  R+ W TKGEE EA  KE +  LK LE  LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYVDKKMYDPARRIWATKGEEQEAAKKEFLEILKTLESELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD+SL+G+  WF  +E FG+FS+EA CPKL+ WAKRC+++ESV+K+LP+  K+  
Sbjct  148  DEFGYVDISLIGFYTWFQAYEKFGNFSIEAGCPKLIGWAKRCLQRESVAKSLPEPEKVTG  207

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  208  FVAELRKKF  216



>ref|XP_009344316.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=221

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 155/190 (82%), Gaps = 0/190 (0%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED  N +KS+LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW+DKAPLLPS
Sbjct  30   YENREEDLRNKIKSQLLLQMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWRDKAPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            +PY+K+ ++FWAD+IDKKLYD   K W+TKGEE EA  K+ I  LK LEG LGD+PYF G
Sbjct  90   EPYQKAHSRFWADFIDKKLYDACSKIWSTKGEEREAAKKDFIEILKQLEGQLGDEPYFEG  149

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+D++L+ + CWF+ +E+ G+FS+EAECPKL+AWAKRCM++ESVS++L D  K+ E
Sbjct  150  EKFGFLDIALITFYCWFHAFETCGNFSIEAECPKLIAWAKRCMQRESVSRSLADEKKVYE  209

Query  247  FTHVFREKLG  218
                 ++ LG
Sbjct  210  LVLGVQKMLG  219



>ref|XP_008226270.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=225

 Score =   270 bits (689),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 156/190 (82%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED LNN KS LLL+MNPVHKKIPVL+HNGKPVCES   V+YIDE WKDKAPLLPS
Sbjct  30   YEYREEDLLNN-KSPLLLQMNPVHKKIPVLIHNGKPVCESANIVQYIDEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW DYIDK LY++G+    T+GEE EA  K+LI  LK+LEG LGD  YFGG
Sbjct  89   DPYQRAQARFWVDYIDKNLYEVGKNICATEGEEQEAAKKKLIEILKLLEGQLGDNAYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+DV+LV + C F+++E+ G+FS+EAECPKL+ WAKRCM+KESV+K+L D  K+ E
Sbjct  149  EIFGFLDVALVTFYCRFFSYETCGNFSIEAECPKLIEWAKRCMQKESVAKSLADPKKVYE  208

Query  247  FTHVFREKLG  218
            FT + +++ G
Sbjct  209  FTLLLKKRFG  218



>gb|AEB77867.1| glutathione S-transferase protein [Bruguiera gymnorhiza]
Length=219

 Score =   269 bits (688),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYRE+D +N  KS LLL+MNPVHKKIPVLVHNGKPVCES IAV+Y+DE WKDKAPLLPS
Sbjct  30   FEYREQDLMN--KSPLLLQMNPVHKKIPVLVHNGKPVCESLIAVQYVDETWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWAD++DKK+YDLGRKTW TKGEE E   KELI   K+LE  LGDKPYFGG
Sbjct  88   DPYRRAQARFWADFVDKKIYDLGRKTWQTKGEEQEGAKKELIECFKLLEKELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VDV+LV +  WF  +E  G+FS+EAECPKL+ WA RC++KESVSK+L D  K+  
Sbjct  148  ETFGYVDVTLVPFYSWFDVYERSGNFSVEAECPKLMEWANRCLQKESVSKSLVDREKVYG  207

Query  247  FTHVFREKLGF  215
            F    ++K G 
Sbjct  208  FVLELKKKFGI  218



>ref|XP_004243197.1| PREDICTED: probable glutathione S-transferase parC [Solanum lycopersicum]
Length=172

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 119/172 (69%), Positives = 148/172 (86%), Gaps = 1/172 (1%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNP+HKKIPVL+HNGK +CES I VEYIDEVWKDKAPLLPSDPYE++QA+FWADYIDKKL
Sbjct  1    MNPIHKKIPVLIHNGKSICESIIGVEYIDEVWKDKAPLLPSDPYERAQARFWADYIDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y   RK W TKGEE EAG K+ I  +KVLEGALG+KPYFGG++FGFVD++L+G+  WF++
Sbjct  61   YRSARKIWGTKGEEQEAGKKDFI-EVKVLEGALGEKPYFGGDNFGFVDIALIGFYSWFHS  119

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +E++G+FS EAECPK VAWAKRCM+++SV+K+LP  HK+LEF  + R+K G 
Sbjct  120  YETYGNFSTEAECPKFVAWAKRCMQRDSVAKSLPGQHKVLEFAKILRQKFGL  171



>ref|XP_007214172.1| hypothetical protein PRUPE_ppa019045mg [Prunus persica]
 gb|EMJ15371.1| hypothetical protein PRUPE_ppa019045mg [Prunus persica]
Length=220

 Score =   269 bits (687),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 155/190 (82%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED LNN KS LLL+MNPVHKK+PVL+HNGKPVCES   V+YIDE WKDKAPLLPS
Sbjct  30   YEYKEEDLLNN-KSPLLLQMNPVHKKLPVLIHNGKPVCESANIVQYIDEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ A+FW DYIDK LY+ G+  W TKGEE E   K+LI  LK+LEG LGD  YFGG
Sbjct  89   DPYQRALARFWVDYIDKNLYEAGKNIWATKGEEQEEAKKKLIEILKLLEGQLGDNSYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+DV+LV + CWF+++E+ G+FS+EAECPKL+ WAKRCM+KESV+++L D  K+ E
Sbjct  149  EIFGFLDVALVTFYCWFFSYETCGNFSIEAECPKLIEWAKRCMQKESVAQSLADPKKVYE  208

Query  247  FTHVFREKLG  218
            FT + +++ G
Sbjct  209  FTLLLKKRFG  218



>gb|ADB11349.1| tau class glutathione transferase GSTU8 [Populus trichocarpa]
Length=220

 Score =   269 bits (687),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS+LLL+MNPVHKKIPVLVH+GKPVCES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYSEQDLRN--KSDLLLQMNPVHKKIPVLVHDGKPVCESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP++++Q++FWAD++DKK+YD GRK WTT GE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPHKRAQSRFWADFVDKKIYDFGRKIWTTNGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A  KRC++KESVSK+L D   + +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIACCKRCLQKESVSKSLKDPQILYD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FAVMVRKKLGL  219



>ref|XP_008226267.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=220

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 152/191 (80%), Gaps = 1/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED L N KS LLL+MNPVHKKIPVL+HNGKPV ES IAV+YIDEVWKDKAPLLPS
Sbjct  30   YESREEDYLTN-KSSLLLQMNPVHKKIPVLIHNGKPVSESLIAVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA FWAD++DKK+YD  ++TW TKGEE EA  +E +  +++LE  LGDKPYFGG
Sbjct  89   DPYLRAQAMFWADFVDKKVYDSAKRTWRTKGEEQEAAKREFLECIRLLEEELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+    WFY  E FG+FS+EA+ PK +AWAKRCM+KESVSK+LPD  ++ E
Sbjct  149  ENLGFVDVALIPTYSWFYVREKFGNFSVEAKHPKFIAWAKRCMQKESVSKSLPDQERVYE  208

Query  247  FTHVFREKLGF  215
            F    R KLG 
Sbjct  209  FALRLRSKLGL  219



>gb|KJB82120.1| hypothetical protein B456_013G177300 [Gossypium raimondii]
Length=219

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DKAPLLPS
Sbjct  30   YEYKEEDLRN--KSALLLQMNPVHKKIPVLIHNGKPVCESLIQVQYIDEVWHDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+K+  +FWADY+DKK+YDLG + W TKGEE     KE I TLK+LE  LGDKPYFGG
Sbjct  88   DPYQKATGRFWADYVDKKIYDLGSRVWKTKGEEQATAKKEFIETLKLLEKELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES G+VDV+ + +  WFY +E  G+FS+EAECPKL+AWAKRC +KESV+K+LPD  K+ +
Sbjct  148  ESLGYVDVAFIPFYSWFYAYEKCGNFSIEAECPKLIAWAKRCTQKESVAKSLPDQQKVYD  207

Query  247  FTHVFREKLGF  215
            F    +++ G 
Sbjct  208  FILEMKKRFGI  218



>ref|XP_009757658.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   268 bits (686),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 159/192 (83%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D  N  KS LLL++NP+HKKIPVL+HNGKPVCES I V+YIDEVWKDK+PL+P+
Sbjct  30   YEYKEQDLSN--KSSLLLQLNPIHKKIPVLIHNGKPVCESLIIVQYIDEVWKDKSPLMPT  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD GR+ WTTKGE+ E   KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYKRAQARFWADFIDKKVYDSGRRIWTTKGEDQETAKKEFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+DV+L+ Y  WF T+E  G+FS+EA+CPKLVAW K+C++KESV+K+L +S K+ +
Sbjct  148  EIFGFLDVALIPYYSWFPTYEKCGNFSIEAKCPKLVAWTKKCVQKESVAKSLAESDKVYD  207

Query  247  FTHVFREKLGFA  212
            F    +++LG A
Sbjct  208  FALQMKQRLGIA  219



>ref|XP_010087165.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB27070.1| putative glutathione S-transferase [Morus notabilis]
Length=219

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+  N  KS LLL+MNP+HKKIPVL+HNGKP+ ES   V+YIDEVW DKAPLLPS
Sbjct  30   YEYKEENLSN--KSPLLLQMNPIHKKIPVLIHNGKPISESLTIVQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD  RK WTTKGEE EAG KE +  LK+LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWADFIDKKVYDAWRKVWTTKGEEKEAGKKEFLDALKLLETELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +S GF+D++LVG+  WFY  E+FG+FS+EAECPKL+ WAK C EKESVSK+L D  K+ E
Sbjct  148  DSLGFLDIALVGFYPWFYALETFGNFSVEAECPKLIEWAKSCKEKESVSKSLADEKKVYE  207

Query  247  FTHVFREKLGF  215
            F    R+K+G 
Sbjct  208  FATERRKKIGI  218



>ref|XP_007022199.1| Glutathione S-transferase TAU 19 [Theobroma cacao]
 gb|EOY13724.1| Glutathione S-transferase TAU 19 [Theobroma cacao]
Length=219

 Score =   268 bits (685),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW D+APLLPS
Sbjct  30   HEYREEDLRN--KSALLLQMNPVHKKIPVLIHNGKPVCESLIQVQYIDEVWHDQAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ A+FWAD++DKK+Y+LGRK WTTKGEE E G KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYQRAIARFWADFVDKKIYELGRKIWTTKGEEQETGKKEFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV LV +  WF  +E  G+FS+EAECPKL+AWA+RC++KESVSK+LPD  K+  
Sbjct  148  ENLGYVDVVLVPFYSWFLAYEKCGNFSIEAECPKLIAWAQRCLQKESVSKSLPDQEKVYG  207

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  208  FVLQLKKIFGI  218



>ref|XP_004488707.1| PREDICTED: probable glutathione S-transferase-like [Cicer arietinum]
Length=219

 Score =   268 bits (684),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 125/191 (65%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+HKKIPVLVHNGKP+CES IAV+YIDEVW  K+PLLPS
Sbjct  30   FEYREEDLRN--KSPLLLQMNPIHKKIPVLVHNGKPICESLIAVQYIDEVWNHKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA+FWADY+DKK+YD GR  WT KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRSQARFWADYVDKKIYDAGRNIWTKKGEEQEAAKKEFIDALKLLEQELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVDV+L+ +  WF  +E+FG+F +E ECPK +AWAKRCM+ ESVSK+LPD  K+ E
Sbjct  148  DKLGFVDVALIPFYTWFKGYETFGNFIVEKECPKFIAWAKRCMQIESVSKSLPDQEKVYE  207

Query  247  FTHVFREKLGF  215
            F    R+K+G 
Sbjct  208  FIVDIRKKIGI  218



>ref|XP_006389991.1| hypothetical protein EUTSA_v10019118mg [Eutrema salsugineum]
 gb|ESQ27277.1| hypothetical protein EUTSA_v10019118mg [Eutrema salsugineum]
Length=219

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+HKKIPVL+HNGKPVCES+I V+YIDEVW  K P+LPS
Sbjct  30   FEYREEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPVCESSIQVQYIDEVWSHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD  RK W TKGEE EA  KE I  LK LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDAQRKVWATKGEEQEASKKEFIELLKTLESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD+ L+G+  WF  +E FG+FS+E+ECPKL+ WAKRC+++ESV+K+LP+S K+ E
Sbjct  148  DDFGYVDIGLIGFYTWFGAYEKFGNFSIESECPKLIGWAKRCLQRESVAKSLPESEKVTE  207

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  208  FVSELRKKF  216



>ref|XP_009759836.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=219

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 156/192 (81%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D LN  K+ LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWK+K P +PS
Sbjct  30   YEYKEQDLLN--KTPLLLQMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWKNKTPFMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWADYIDKK+Y+ G+K WT+K E+ EA  KE I  LK+LEG LGDK Y GG
Sbjct  88   DPYMRAQARFWADYIDKKIYESGKKMWTSKVEDQEAANKEFIECLKLLEGELGDKTYLGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGFVD++L+ Y  WF  +E FG+FS+EAECPK+V WAK+CM+KESVSK+L DS K+ +
Sbjct  148  ESFGFVDIALMPYYSWFPAYEKFGNFSIEAECPKIVEWAKKCMQKESVSKSLADSDKVYD  207

Query  247  FTHVFREKLGFA  212
            F  + R+K G A
Sbjct  208  FIVMARQKWGIA  219



>gb|AEI01103.1| glutathione transferase [Nicotiana benthamiana]
Length=221

 Score =   268 bits (684),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 154/192 (80%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D +N  K  LLL+MNP+HKKIPVL+HNGKP+CES + V+YIDEVWKD +PL+PS
Sbjct  30   YEYKEQDLMN--KDPLLLQMNPIHKKIPVLIHNGKPICESLVIVQYIDEVWKDNSPLMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++ A+FWADY+DKK+YD GRK WT+K E+ EA  KE I   K+LE  LGDKPYFGG
Sbjct  88   DPYERAHARFWADYVDKKIYDTGRKIWTSKKEDQEAANKEFIECFKLLEEELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGFVD++L+ Y  WF  +E FG+F++EAECPK+V WAK+CM+KESVSK+L D  K+  
Sbjct  148  ESFGFVDMALIPYYTWFPAYEKFGNFNIEAECPKIVEWAKKCMQKESVSKSLADPDKVYN  207

Query  247  FTHVFREKLGFA  212
            F  + R+K G A
Sbjct  208  FIVMVRQKWGIA  219



>ref|XP_002317608.1| glutathione transferase family protein [Populus trichocarpa]
 gb|EEE98220.1| glutathione transferase family protein [Populus trichocarpa]
 gb|ADB11322.1| tau class glutathione transferase GSTU30 [Populus trichocarpa]
Length=220

 Score =   267 bits (683),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY EED  N  KS LLL+MNPV+K+IPVLVHNGKPVCES I V+YIDEVWKD APLLPS
Sbjct  31   YEYSEEDLRN--KSALLLQMNPVNKQIPVLVHNGKPVCESLIIVQYIDEVWKDSAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++FWAD++DKK+YDLGRK WT KGEE EA  K+ I +LK++EG LGDKPYFGG
Sbjct  89   DPYQRAQSRFWADFVDKKIYDLGRKIWTKKGEEQEAAKKDFIDSLKLMEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VD++LV +  WFY +E+ G+F++EAECPK++A+ KRC++KE+VSK L D  K+ +
Sbjct  149  ETIGYVDIALVPFYSWFYAYETIGNFNIEAECPKMIAYCKRCLQKETVSKALEDPQKVYD  208

Query  247  FTHVFREKLGF  215
            F  +  +K G 
Sbjct  209  FVLMLMKKFGI  219



>emb|CAA45741.1| C-7 [Nicotiana tabacum]
Length=219

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 159/192 (83%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D LN  K+ LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDK+P +PS
Sbjct  30   YEYKEQDLLN--KTPLLLQMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWKDKSPFMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+Y+ G+K WT+K E+ EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYKRAQARFWADYVDKKIYESGKKMWTSKVEDQEAANKEFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGFVD++L+ Y  WF ++E FG+FS+EAECPK+V WAK+C++KESVSK+L D  K+ +
Sbjct  148  ERFGFVDMALMPYYSWFPSYEKFGNFSIEAECPKIVEWAKKCVQKESVSKSLADPDKVYD  207

Query  247  FTHVFREKLGFA  212
            +  + R+K G A
Sbjct  208  YIVMARQKWGIA  219



>ref|XP_002300485.1| hypothetical protein POPTR_0001s42800g [Populus trichocarpa]
 gb|EEE85290.1| hypothetical protein POPTR_0001s42800g [Populus trichocarpa]
Length=220

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 159/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS+LLL+MNPVHKKIPVLVH+GKPVCES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYCEQDLRN--KSDLLLQMNPVHKKIPVLVHDGKPVCESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP++++Q++FWAD++DKK+YD GRK WTT GE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPHKRAQSRFWADFVDKKIYDFGRKIWTTNGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A  KRC++KESVSK+L D   + +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIACCKRCLQKESVSKSLKDPQILYD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FAVMVRKKLGL  219



>gb|ABG90381.2| glutathione S-transferase [Caragana korshinskii]
Length=219

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES IAV+YIDEVW D++PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIAVQYIDEVWSDRSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+Y++GR  WT KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWADYVDKKIYEVGRNVWTKKGEEQEAAKKEFIDALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  G+VD++L+ +  WF  +E FG+ ++E ECPK +AWAKRCM+ E+VS++LPD HK+ E
Sbjct  148  EKLGYVDIALIPFYTWFKAYEVFGNLNIEKECPKFIAWAKRCMQIENVSRSLPDQHKVYE  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FIVEIRKRFGI  218



>ref|XP_002298935.2| hypothetical protein POPTR_0001s42770g [Populus trichocarpa]
 gb|EEE83740.2| hypothetical protein POPTR_0001s42770g [Populus trichocarpa]
Length=271

 Score =   269 bits (688),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  LLL+MNPVHK+IPVLVH+GKP+CES I V+YIDEVWKDKAPLLPS
Sbjct  82   YEYSEQDLWN--KGALLLQMNPVHKRIPVLVHDGKPICESLIIVQYIDEVWKDKAPLLPS  139

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKKLY+LG+K +TTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  140  DPYERAQSRFWADFVDKKLYELGKKIYTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  199

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  200  KTLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLEKESVSKSLEDPQKVYD  259

Query  247  FTHVFREKLGFA  212
            F  + R+K  +A
Sbjct  260  FVVMLRKKFNWA  271



>ref|XP_009616059.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=219

 Score =   267 bits (683),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 159/192 (83%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D LN  K+ LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDK+P +PS
Sbjct  30   YEYKEQDLLN--KTPLLLQMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWKDKSPFMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKK+Y+ G+K WT+K E+ EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYKRAQARFWADYVDKKIYESGKKMWTSKVEDQEAANKEFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGFVD++L+ Y  WF ++E FG+FS+EAECPK+V WAK+C++KESVSK+L D  K+ +
Sbjct  148  ERFGFVDMALMPYYSWFPSYEKFGNFSIEAECPKIVEWAKKCVQKESVSKSLADPDKVYD  207

Query  247  FTHVFREKLGFA  212
            +  + R+K G A
Sbjct  208  YIVMARQKWGIA  219



>ref|XP_011030768.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=219

 Score =   267 bits (683),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNPV+K+IPVLVH+GKPVCES I V+YIDEVWKD APLLPS
Sbjct  31   YEYREEDLWN--KSALLLQMNPVNKQIPVLVHDGKPVCESLIIVQYIDEVWKDSAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++DKK+YDLGRK WT KGEE E   K+ I +LK++EG LGDKPYFGG
Sbjct  89   DPYQRAQARFWADFVDKKIYDLGRKIWTKKGEEQETAKKDFIDSLKLMEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VD++LV +  WFY +E+ G+F++EAECPKL+A+ KRC++KE+VSK L D  K+ +
Sbjct  149  ETIGYVDIALVPFYSWFYAYETIGNFNIEAECPKLIAYCKRCLQKETVSKALEDPQKVYD  208

Query  247  FTHVFREKLGF  215
            F  +  +K G 
Sbjct  209  FVLILMKKFGI  219



>gb|ADB11346.1| tau class glutathione transferase GSTU4 [Populus trichocarpa]
Length=220

 Score =   267 bits (683),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  LLL+MNPVHK+IPVLVH+GKP+ ES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYSEQDLWN--KGALLLQMNPVHKRIPVLVHDGKPIFESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKK+YDLGRK WTTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYERAQSRFWADFVDKKVYDLGRKIWTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETVGNFNIEAVCPKLIAYCKRCLEKESVSKSLEDPQKVSD  208

Query  247  FTHVFREKLGF  215
            F  + R+ LG 
Sbjct  209  FVVMRRKMLGL  219



>emb|CBI39919.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   265 bits (678),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPSDPY+++QA+FWADYIDKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWCDKSPLLPSDPYQRAQARFWADYIDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGGE  GFVDV+LV + CWFY 
Sbjct  61   YELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +E+FG+FS+EAECPKL+AW KRCMEKESVS +L D HK+ +F    R+K G 
Sbjct  121  YETFGNFSMEAECPKLIAWTKRCMEKESVSSSLEDPHKVHDFVTWMRKKFGI  172



>gb|KDP43660.1| hypothetical protein JCGZ_24118 [Jatropha curcas]
Length=224

 Score =   267 bits (683),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 129/194 (66%), Positives = 155/194 (80%), Gaps = 5/194 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREE+  N  KS LLL+MNPVHKKIPVL+HNGKPV ES IAVEYIDEVWKDK PLLPS
Sbjct  32   HEYREENLRN--KSALLLQMNPVHKKIPVLIHNGKPVVESRIAVEYIDEVWKDKTPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFWAD++DKK+YDLGRKTW TKGEE EA  KE + +LK+LEG LGDKPYFGG
Sbjct  90   DPYQRAQAKFWADFVDKKIYDLGRKTWATKGEEQEAAKKEFMESLKILEGELGDKPYFGG  149

Query  427  ESFGFVDVSLVGYCCWFYTW---ESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHK  257
            E FG+VDV+ + +  WFY +   E  G+FS+EAECPKL+AW KRC+EKE+VS +LPD  K
Sbjct  150  ECFGYVDVAFIPFYSWFYWFYANEVSGNFSVEAECPKLIAWVKRCLEKETVSNSLPDQKK  209

Query  256  ILEFTHVFREKLGF  215
            I  F    ++  G 
Sbjct  210  IYGFVLELKKAYGI  223



>ref|XP_002298938.2| hypothetical protein POPTR_0001s42790g [Populus trichocarpa]
 gb|EEE83743.2| hypothetical protein POPTR_0001s42790g [Populus trichocarpa]
Length=220

 Score =   267 bits (682),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 160/191 (84%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K +LLL+MNPVHKKIPVLVH+GKP+CES I V+YIDEVW DKAPLL S
Sbjct  31   YEYSEQDLWN--KGDLLLQMNPVHKKIPVLVHDGKPICESLIIVQYIDEVWNDKAPLLFS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKK++D+GRK WTTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYERAQSRFWADFVDKKIHDVGRKIWTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC++KESVSK+L D  K+ +
Sbjct  149  DTLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLQKESVSKSLEDPQKVSD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FVVMMRKKLGL  219



>dbj|BAB32446.2| glutathione S-transferase [Matricaria chamomilla]
Length=220

 Score =   267 bits (682),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 152/192 (79%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+YID+ W +K+P LLP
Sbjct  31   YEYKEEDLSN--KSSLLLEMNPVHKKIPVLIHNGKPICESNIIVQYIDDAWSNKSPSLLP  88

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPY K+QA+FWAD++DKK+YD  RK WTTKGEE E   KE I  LKV+EG LGDKPY  
Sbjct  89   SDPYLKAQARFWADFVDKKIYDAARKIWTTKGEEQETAKKEFIDWLKVMEGQLGDKPYLI  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G+SFG+ D++L+ + CWFYT E+ G+ S+E ECPKLVAW KRCME+ESVSK+L D HK+ 
Sbjct  149  GDSFGYADIALIPFSCWFYTLETIGNMSIEKECPKLVAWVKRCMERESVSKSLADPHKMY  208

Query  250  EFTHVFREKLGF  215
            EF    ++KLG 
Sbjct  209  EFVLQLKKKLGL  220



>emb|CBI39935.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   265 bits (678),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPSDPY+++QA+FWADYIDKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWCDKSPLLPSDPYQRAQARFWADYIDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGGE  GFVDV+LV + CWFY 
Sbjct  61   YELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +E+FG+FS+EAECPKL+AW KRCMEKESVS +L D HK+ +F    R+K G 
Sbjct  121  YETFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHDFVTWMRKKFGI  172



>ref|XP_011098135.1| PREDICTED: LOW QUALITY PROTEIN: probable glutathione S-transferase 
[Sesamum indicum]
Length=218

 Score =   267 bits (682),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 127/191 (66%), Positives = 155/191 (81%), Gaps = 3/191 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREE+     KS LLL+MNPVHKKIPVL+HNGKPVCES I V  IDEVWKD++PLLPS
Sbjct  30   YEYREENLAE--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIIVX-IDEVWKDRSPLLPS  86

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+Y+ GRK WTTKGEELE+G K+ I  LKVLEG LGDKPYFGG
Sbjct  87   DPYQRAQARFWADFIDKKVYEAGRKLWTTKGEELESGKKDFIEILKVLEGELGDKPYFGG  146

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGFVDV+L+ +  WF  +E+  +FS+E  CPKL+AWAKRCME+ESVSK+L D +KI +
Sbjct  147  EDFGFVDVALIPFYSWFNAYETCANFSIEEHCPKLIAWAKRCMERESVSKSLADPNKIYD  206

Query  247  FTHVFREKLGF  215
            F    ++K G 
Sbjct  207  FVLAMKKKFGI  217



>emb|CBI39920.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   265 bits (678),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPSDPY+++QA+FWADY+DKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y+LG K W+TKGEE E G KE I  LK+LEG LG+KPYFGGE  GFVDV+LV + CWFY 
Sbjct  61   YELGGKIWSTKGEEQETGKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +E+FG+FS+EAECPKLVAW KRCMEKESVS +L D HK+  F    R++ G 
Sbjct  121  YETFGNFSIEAECPKLVAWTKRCMEKESVSSSLEDPHKVHGFIMGMRKRFGI  172



>ref|XP_009591607.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=222

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 160/193 (83%), Gaps = 4/193 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLL-P  611
            YEY+EED L+   S LL KMNP+HKKIPVL+HNGKPVCES IAVEYIDEVWKDKAPLL P
Sbjct  31   YEYKEEDLLSTKSSLLL-KMNPIHKKIPVLIHNGKPVCESIIAVEYIDEVWKDKAPLLLP  89

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLE-GALGDKPYF  434
            SDPYE++QA+FW DYIDK +YD GRK WTTKGEE E G K+ I +LK+LE  ALGDKPYF
Sbjct  90   SDPYERAQARFWCDYIDK-MYDFGRKIWTTKGEEHEEGKKKFIDSLKLLELEALGDKPYF  148

Query  433  GGESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKI  254
            GGE+FGFVD++L+G+  WFY +++FG+FS+EAECPKLVAW KRCM++ESVS +L D HKI
Sbjct  149  GGENFGFVDIALIGFYSWFYAYDTFGNFSIEAECPKLVAWGKRCMQRESVSTSLADPHKI  208

Query  253  LEFTHVFREKLGF  215
             E   VFR+  G 
Sbjct  209  YEMLQVFRKNHGM  221



>ref|XP_008382602.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   266 bits (681),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS+LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DKAPLLPS
Sbjct  30   YEYREEDLRN--KSQLLLQMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWSDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            +PY+++ ++FWAD+IDKKLYD GRK W+TKGEE EA  K+ I  LK LEG LG KPYF G
Sbjct  88   EPYQRACSRFWADFIDKKLYDAGRKIWSTKGEEQEAAKKDFIEILKQLEGQLGGKPYFEG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+D++L+ +  WF+ +E+ G+FS+EAECPKL+AWAKRC ++ESVSK+L D  K+ E
Sbjct  148  EKFGFLDIALITFYSWFHAYETCGNFSIEAECPKLIAWAKRCKQRESVSKSLADEKKVYE  207

Query  247  FTHVFREKLG  218
            F    ++ LG
Sbjct  208  FVLSIKKMLG  217



>ref|XP_008451810.1| PREDICTED: probable glutathione S-transferase parC [Cucumis melo]
Length=219

 Score =   266 bits (680),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 153/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY EED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES+I V+YIDEVW DKAPLLPS
Sbjct  30   YEYIEEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESSIIVQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
             PY+++QA+FW D+IDKKLYD  RK W TKGEE EAG KE+I  LK LE  LG+K YFGG
Sbjct  88   HPYDRAQARFWVDFIDKKLYDPTRKIWATKGEEHEAGKKEMIEILKQLEQVLGEKDYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES G +D++L+G+  WFYT+E+ G FS+EAECPK+++W KRC++ ESV+K+LPDS KI +
Sbjct  148  ESMGIIDIALIGFYSWFYTYETIGKFSIEAECPKIISWGKRCLQNESVAKSLPDSRKIYD  207

Query  247  FTHVFREKLGF  215
            F    ++ +G 
Sbjct  208  FVVQVQKAMGI  218



>emb|CBI32899.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   265 bits (676),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES + V+YIDEVW DK+PLLPSDPY+++QA+FWADY+DKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLLIVQYIDEVWHDKSPLLPSDPYQRAQARFWADYVDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGGE  GFVDV+LV + CWF+ 
Sbjct  61   YELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFHA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +ESFG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  F    R+KLG 
Sbjct  121  YESFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHGFVMGMRKKLGI  172



>gb|ADB11312.1| tau class glutathione transferase GSTU3 [Populus trichocarpa]
Length=220

 Score =   266 bits (680),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 161/192 (84%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  LLL+MNPVHK+IPVLVH+GKP+CES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYSEQDLWN--KGALLLQMNPVHKRIPVLVHDGKPICESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKKLY+LG+K +TTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYERAQSRFWADFVDKKLYELGKKIYTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ G+VDV+L+ + CWFY +E+ G+F++E++CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  KTLGYVDVALLPFYCWFYAYETIGNFNIESDCPKLIAYCKRCLEKESVSKSLEDPQKVYD  208

Query  247  FTHVFREKLGFA  212
            F  + R+K  +A
Sbjct  209  FVVMLRKKFNWA  220



>emb|CBI39927.3| unnamed protein product [Vitis vinifera]
Length=186

 Score =   265 bits (677),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPSDPY+++QA+FWADY+DKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y+LG K W+TKGEE E G KE I  LK+LEG LG+KPYFGGE  GFVDV+LV + CWFY 
Sbjct  61   YELGGKIWSTKGEEQETGKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +E+FG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  F    R++ G 
Sbjct  121  YETFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHGFIMGMRKRFGI  172



>ref|XP_008226264.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=215

 Score =   266 bits (680),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 2/180 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES I V+Y+DEVW+DKAPLLPS
Sbjct  30   YENREEDLWN--KSSLLLQMNPVHKKIPVLIHNGKPICESLIIVQYVDEVWRDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++++++FWAD+IDKKLY   RK W TKGEE EAG KE I  LK LEG LGDKPYF G
Sbjct  88   DPYQRARSRFWADFIDKKLYVASRKIWGTKGEEQEAGKKEFIEALKQLEGELGDKPYFEG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+ +  WFY +E+FG+FS EAECPKL+ WAKRCM++ESVSK+L D  K+ E
Sbjct  148  ESFGFLDIALISFYSWFYAYETFGNFSTEAECPKLIEWAKRCMQRESVSKSLADPKKVYE  207



>ref|XP_002269705.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=223

 Score =   266 bits (679),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 157/194 (81%), Gaps = 6/194 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREE+  N  KS LLL+MNPVHKK+PVL+HNGKP+CES + V+YIDEVWKDK+PLLPS
Sbjct  30   YEYREENLWN--KSPLLLEMNPVHKKVPVLIHNGKPICESLMIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKL----YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKP  440
            DPY+++QA+FWADY+DKK+    ++LG+K W TKGEE EAG KE I  LK  EG LG+KP
Sbjct  88   DPYQRAQARFWADYVDKKVPQLYHELGKKIWYTKGEEHEAGKKEFIECLKFFEGELGEKP  147

Query  439  YFGGESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSH  260
            YFGGE+FGF DV+LV   CWFYT+ESFG+FS+E ECP L+AWAKRC +KESVS +L D H
Sbjct  148  YFGGENFGFEDVALVPLSCWFYTYESFGNFSVEDECPNLMAWAKRCGQKESVSSSLADPH  207

Query  259  KILEFTHVFREKLG  218
            K+  F    R++LG
Sbjct  208  KVHGFVMEMRKRLG  221



>ref|XP_009104572.1| PREDICTED: glutathione S-transferase U19 [Brassica rapa]
Length=219

 Score =   266 bits (679),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYR+E+     KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW  K P+LPS
Sbjct  30   FEYRDENLRE--KSPLLLQMNPVHKKIPVLIHNGKPVCESAIQVQYIDEVWPHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+Y+  RK + TKGEE E G KE I  LK LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYEAQRKVYATKGEEQETGKKEFIEILKTLESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD+ L+G+  WF  +E FG+FS+EAECPKL+AWAKRCM++ESV+K+LPD  K++E
Sbjct  148  DDFGYVDIGLIGFYTWFPGYEKFGNFSIEAECPKLIAWAKRCMQRESVAKSLPDPEKVVE  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FMAMLRKKFG  217



>ref|XP_009354819.1| PREDICTED: probable glutathione S-transferase isoform X2 [Pyrus 
x bretschneideri]
Length=219

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES +A++YIDEVW DKAPLLPS
Sbjct  30   YEYKDEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLVALQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+YD+GRK WTTKGEE +A  KE +  + VLEG L DKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIYDIGRKLWTTKGEEHDAASKEFLDCIGVLEGELEDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+ +  WF  +E FG+FS+EAE PK +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  ETLGFVDVALIPFYSWFLVYEKFGNFSVEAEHPKFIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FVALMRKKFG  217



>emb|CBI39926.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   264 bits (674),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 143/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVW DK+PLLPSDPY+++QA+FW DY+DKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWHDKSPLLPSDPYQRAQARFWVDYVDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y+LGRK W+TKGEE E   KE I  LK+LEG LG+KPYFGGE  GFVDV+LV + CWF+ 
Sbjct  61   YELGRKIWSTKGEEQETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFHA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +ESFG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  F    R+KLG 
Sbjct  121  YESFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHGFVMGMRKKLGI  172



>ref|XP_010644811.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 149/181 (82%), Gaps = 2/181 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  K  LLL+MNP+HKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEYRDEDLFN--KGPLLLEMNPIHKKIPVLIHNGKPICESQIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWADYIDKKL+ LG++ W TKGEE EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYHRAQARFWADYIDKKLHLLGKRLWRTKGEEQEANKKEYIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGFVDV+L+ Y  W Y +E   +FS+EAECPKL+ WAKRCMEKESVS +LPD  K+ +
Sbjct  148  ENFGFVDVNLMPYFSWLYVFEIAANFSIEAECPKLITWAKRCMEKESVSTSLPDRQKLYD  207

Query  247  F  245
            F
Sbjct  208  F  208



>gb|ADB11350.1| putative tau class glutathione transferase GSTU10 [Populus trichocarpa]
Length=220

 Score =   265 bits (678),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K+ LLL+MNPVHKKIPVLVHNGKPVCES I V+ IDE WKDKAPLLPS
Sbjct  31   YEYSEQDLRN--KTALLLQMNPVHKKIPVLVHNGKPVCESLIIVQNIDEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+  Q++FWAD++DKK+Y LGRK WTTKGE+ E+  K+ I +LK+LE  LG+KPYFGG
Sbjct  89   DPYQGVQSRFWADFVDKKIYALGRKIWTTKGEDQESAKKDFIDSLKLLERELGEKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+FS+EA+CPKL+A+ KRC++KESVSK+L D  K+ +
Sbjct  149  ETLGYVDVALLPFLCWFYAYETIGNFSIEADCPKLIAYCKRCLQKESVSKSLEDPQKVSD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FVVMMRKKLGL  219



>gb|KHG29593.1| putative glutathione S-transferase [Gossypium arboreum]
Length=219

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS+LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DKAPL+PS
Sbjct  30   YEYREEDLRN--KSDLLLQMNPVHKKIPVLIHNGKPVCESVIQVQYIDEVWHDKAPLIPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ A+FW D++DKK+YDLG K W TKGEE     KE I  LK+LEG LGDK YFGG
Sbjct  88   DPYQRAVARFWVDFVDKKIYDLGSKIWKTKGEEQANAKKEFIECLKLLEGELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES G+VDV+LV +  WFY +E  G FS+EAECPK++AW KRCM+KESV+K+LPD  K+ E
Sbjct  148  ESLGYVDVALVPFYTWFYAYEKCGDFSIEAECPKMIAWVKRCMQKESVAKSLPDQEKVYE  207

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  208  FVLQLKKLFGI  218



>ref|XP_006305593.1| hypothetical protein CARUB_v10010257mg [Capsella rubella]
 gb|EOA38491.1| hypothetical protein CARUB_v10010257mg [Capsella rubella]
Length=219

 Score =   265 bits (678),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 154/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            ++YRE+D  N  KS +LL+MNPVHKKIPVL+HNGKPVCES I VEYIDEVW  K PLLPS
Sbjct  30   FDYREQDLWN--KSPILLEMNPVHKKIPVLIHNGKPVCESLIQVEYIDEVWPSKNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW D+IDKK+Y   R  W  KGEE EAG KE I  LK LE  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDFIDKKVYASARLIWGAKGEEQEAGKKEFIEILKTLESELGDKIYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++L+G+  WF  ++ FG+FS+EAECPKL+AWAKRC+E+ESV+K+LPDS+KI+E
Sbjct  148  ETFGYVDIALIGFYSWFEAYDKFGNFSIEAECPKLIAWAKRCVERESVAKSLPDSNKIVE  207

Query  247  FTHVFREKLGF  215
            F  V ++ +G 
Sbjct  208  FVPVLKKHIGI  218



>ref|XP_010103479.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB96021.1| putative glutathione S-transferase [Morus notabilis]
Length=218

 Score =   265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGKP+ ES I V+Y+DEVW +KAPLLPS
Sbjct  29   YEYKEEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPISESLIIVQYVDEVWNEKAPLLPS  86

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD   K WT KGEE EA  KE I  LK+LE  LGDKPYFGG
Sbjct  87   DPYQRAQARFWADFIDKKVYDAAGKVWTAKGEEKEAAKKEFIDILKLLETELGDKPYFGG  146

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFGF+D++LVG+  WFY  E+FG+FS+EAECPKL+ WAK C EKESVSK+L D  K+ E
Sbjct  147  DSFGFLDIALVGFYPWFYALETFGNFSVEAECPKLIEWAKSCKEKESVSKSLADEKKLYE  206

Query  247  FTHVFREKLGF  215
            F    R+ +G 
Sbjct  207  FAAEKRKTMGI  217



>emb|CDX68016.1| BnaA07g20560D [Brassica napus]
Length=219

 Score =   265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYR+E+     KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW  K P+LPS
Sbjct  30   FEYRDENLRE--KSPLLLQMNPVHKKIPVLIHNGKPVCESAIQVQYIDEVWPHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+Y+  RK + TKGEE E G KE I  LK LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYEAQRKVYATKGEEQETGKKEFIEILKTLETELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD+ L+G+  WF  +E FG+FS+EAECPKL+AWAKRCM++ESV+K+LPD  K++E
Sbjct  148  DDFGYVDIGLIGFYTWFPGYEKFGNFSIEAECPKLIAWAKRCMQRESVAKSLPDPEKVVE  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FMAMLRKKFG  217



>ref|XP_007212649.1| hypothetical protein PRUPE_ppa018201mg [Prunus persica]
 gb|EMJ13848.1| hypothetical protein PRUPE_ppa018201mg [Prunus persica]
Length=220

 Score =   265 bits (677),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 151/191 (79%), Gaps = 1/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED L N KS LLL+MNPVHKKIPVL+HNGKPV ES IAV+YIDEVWKDKAPLLPS
Sbjct  30   YESREEDYLTN-KSSLLLQMNPVHKKIPVLIHNGKPVSESLIAVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA FWAD++DKK+Y+  ++TW TKGEE EA  +E +  +++LE  LGDKPYFGG
Sbjct  89   DPYLRAQAMFWADFVDKKVYESAKRTWRTKGEEQEAAKREFLECIRLLEEELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+    WFY  E  G+FS+EA+ PK +AWAKRCM+KESVSK+LPD  ++ E
Sbjct  149  ENLGFVDVALIPTYSWFYAREKIGNFSVEAKHPKFIAWAKRCMQKESVSKSLPDQKRVYE  208

Query  247  FTHVFREKLGF  215
            F    R KLG 
Sbjct  209  FALRLRSKLGL  219



>gb|KHG06513.1| putative glutathione S-transferase [Gossypium arboreum]
Length=232

 Score =   265 bits (678),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 155/192 (81%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS+LLLKMNP+HKKIPVL+HNGKP+CES I V+YIDE+W  K+PLLP+
Sbjct  31   YEYKEEDLSN--KSDLLLKMNPIHKKIPVLIHNGKPICESLIQVQYIDEIWPHKSPLLPT  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ AKFWAD+++KK+YDLG+K WTTKGEE EA  KE I  LK+LEG LG+K YFGG
Sbjct  89   DPYQRAIAKFWADFVEKKIYDLGKKVWTTKGEEQEAAKKEFIACLKLLEGELGNKDYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV LV +  WFY +E  G+FS+E ECPKL+AWAKRCMEK+SVSK+LPD  KI  
Sbjct  149  ENLGYVDVVLVPFYSWFYAYEKCGNFSIERECPKLIAWAKRCMEKDSVSKSLPDQQKIYG  208

Query  247  FTHVFREKLGFA  212
            F    R+ +G +
Sbjct  209  FVLHLRKVVGLS  220



>ref|XP_004248222.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=221

 Score =   265 bits (677),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/192 (67%), Positives = 153/192 (80%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED   + KS LL+KMNP+HKKIPVL+HNGKPVCES + VEYIDEVWKDKAPLLPS
Sbjct  31   YEYKEEDLFTS-KSPLLVKMNPIHKKIPVLIHNGKPVCESFVVVEYIDEVWKDKAPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVL-EGALGDKPYFG  431
             PY++SQA+FWA Y D KLYD GR+ WT K EE   G K+ I  LK+L E ALGDKPYFG
Sbjct  90   HPYDRSQARFWASYTD-KLYDFGRRIWTVKREEFAEGKKDFIDPLKLLEEAALGDKPYFG  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GESFGFVD++L+G+  WFYT+E+  +FS+EAECPK+ AW KRCM++ESVSK+L DS KI 
Sbjct  149  GESFGFVDIALIGFYSWFYTYETICNFSIEAECPKIAAWGKRCMKRESVSKSLADSRKIY  208

Query  250  EFTHVFREKLGF  215
            E    FR+K G 
Sbjct  209  EVVIEFRKKNGL  220



>ref|XP_008372264.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   265 bits (677),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES IA++YIDEVW DKAPLLPS
Sbjct  30   YEYKDEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIALQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+YD+GRK WTTKGEE +A  K+ +  + VLEG LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIYDIGRKLWTTKGEEYDAAKKDFLDCIGVLEGELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVDV+L+ +  WF  +E FG+FS+EA  PK + W KRCMEKESVSK+LPD  K+ +
Sbjct  148  DTLGFVDVALIPFYSWFLVYEKFGNFSVEAVHPKFIVWVKRCMEKESVSKSLPDQEKVYD  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FVALMRKKFG  217



>emb|CDX79261.1| BnaC06g20420D [Brassica napus]
Length=219

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYR+E+     KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW  K P+LPS
Sbjct  30   FEYRDENLRE--KSPLLLQMNPVHKKIPVLIHNGKPVCESAIQVQYIDEVWPHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+Y+  RK + TKGEE E G KE I  LK LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYEAQRKVYATKGEEQETGKKEFIEILKTLETELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD+ L+G+  WF  +E FG+FS+EAECPKL+AWAKRCM++ESV+K+LPD  K++E
Sbjct  148  DDFGYVDIGLIGFYTWFPGYEKFGNFSIEAECPKLIAWAKRCMQRESVAKSLPDPEKVVE  207

Query  247  FTHVFREKLG  218
            F  + R++ G
Sbjct  208  FMAMLRKRFG  217



>ref|XP_002262644.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 126/191 (66%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED  N  KS LLL++NPVHKKIPVL+HNGKP+CES I V+YIDEVW  K+PLLP+
Sbjct  30   YEKREEDLWN--KSPLLLEVNPVHKKIPVLIHNGKPICESMILVQYIDEVWNHKSPLLPT  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADYIDKKLYDLG+K   TKGEE E   KE I  LK+LEG LG+KPYFGG
Sbjct  88   DPYQRAQARFWADYIDKKLYDLGKKILLTKGEEQETAKKEFIECLKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG VDV+LV +   FY +ES G+FS+EAECPKL+AW KRCM+KESVS +L D HK+  
Sbjct  148  ENFGLVDVALVTFSSRFYAYESIGNFSIEAECPKLIAWTKRCMQKESVSSSLADPHKVHA  207

Query  247  FTHVFREKLGF  215
            F    R+K G 
Sbjct  208  FVMGLRKKTGI  218



>gb|KJB82123.1| hypothetical protein B456_013G177600 [Gossypium raimondii]
Length=219

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/191 (65%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS+LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DKAPL+PS
Sbjct  30   YEYREEDLRN--KSDLLLQMNPVHKKIPVLIHNGKPVCESVIQVQYIDEVWHDKAPLIPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ A+FW D+IDKK+Y+LG K W TKGEE     KE I  LK+LEG LGDK YFGG
Sbjct  88   DPYQRAVARFWVDFIDKKMYELGSKIWKTKGEEQANAKKEFIECLKLLEGELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES G+VDV+LV +  WFY +E  G FS+EAECPK++AW KRCM+KESV+K+LPD  K+ E
Sbjct  148  ESLGYVDVALVPFYSWFYAYEKCGDFSIEAECPKMIAWVKRCMQKESVAKSLPDQEKVYE  207

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  208  FILQLKKVFGI  218



>gb|KFK42224.1| hypothetical protein AALP_AA2G227300 [Arabis alpina]
Length=219

 Score =   264 bits (675),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+ NP+HKKIPVL+HNGKPVCES+I V+YIDEVW  K P+LPS
Sbjct  30   FEYREEDLRN--KSPLLLQTNPIHKKIPVLIHNGKPVCESSIQVQYIDEVWSHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW+D+IDKK+Y+  RKTWTTKGEELEA  KE I  LK LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWSDFIDKKVYEASRKTWTTKGEELEAAKKEFIEILKTLETELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FGFVD++++G+  WF  +E FG+ S+E ECPKL+ W K+C+E+E+V+K+LPD HK+ E
Sbjct  148  DGFGFVDIAMIGFYTWFPAFEKFGNLSIEEECPKLMVWVKKCLERETVAKSLPDPHKVTE  207

Query  247  FTHVFREKLGF  215
            F    R++ G 
Sbjct  208  FVAEVRKRFGL  218



>ref|XP_010087160.1| putative glutathione S-transferase [Morus notabilis]
 gb|EXB27065.1| putative glutathione S-transferase [Morus notabilis]
Length=220

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LL++MNP+HK+IPVL+HNGK +CES I V+Y+DEVW  KAPLLPS
Sbjct  31   YEYKEEDLWN--KSTLLVEMNPIHKRIPVLIHNGKSICESLIIVQYVDEVWHGKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ A+FWAD +D K+YD G+  W TKGE+ EA  K    TLK+LE  LGDKPYFGG
Sbjct  89   DPYQRAHARFWADVVDDKMYDAGKNVWATKGEDQEAANKVFFDTLKLLEAELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFGFVDV+L+ Y  WF+ +E+FG+FS+EAECPKL+AWAKRC EKESVSK+L D +KI E
Sbjct  149  DSFGFVDVALIPYYSWFHAYETFGNFSIEAECPKLIAWAKRCTEKESVSKSLADENKICE  208

Query  247  FTHVFREKLGF  215
            F    R K G 
Sbjct  209  FVSQLRNKFGI  219



>emb|CBI39936.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 144/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPSDPY+++QA+FWADY+DKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            Y+LG K W+TKGEE E G KE    LK+LEG LG+KPYFGGE  GFVDV+LV + CWFY 
Sbjct  61   YELGGKIWSTKGEEQETGKKEFTECLKLLEGELGEKPYFGGEKIGFVDVALVTFSCWFYA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +E+FG+FS+EAECPKLVAW KRCMEKESVS +L D HK+  +    R+KLG 
Sbjct  121  YETFGNFSIEAECPKLVAWTKRCMEKESVSSSLEDPHKVHGYVVGRRKKLGI  172



>ref|XP_008383009.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   264 bits (675),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES IA++YIDEVW DKAPLLPS
Sbjct  30   YEYKDEDVRN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIALQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWADY+DKK+Y+ GRK WTTKGEE +A  KE +  + VLEG LGDKP+FGG
Sbjct  88   DCYLRAQARFWADYVDKKIYEFGRKLWTTKGEEQDAAKKEFLDCMGVLEGELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GF+DV+L+ +  WF  +E FG+FS+EA  PK +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  ETIGFMDVALIPFYSWFLLYEKFGNFSVEALHPKFIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKLG  218
            F  + R+KLG
Sbjct  208  FVMLMRKKLG  217



>ref|XP_002266007.2| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   264 bits (674),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 125/181 (69%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  K  LLL+MNP+HKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEYRDEDLFN--KGPLLLEMNPIHKKIPVLIHNGKPICESQIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWADYIDKKL+ LG + W TKGEE EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DPYHRAQARFWADYIDKKLHLLGARLWRTKGEEQEANKKEYIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGFVDV+L+ Y  W Y +E   +FS+EAECPKL+ WAKRCMEKESVS +LPD  K+ +
Sbjct  148  ENFGFVDVNLMPYFSWLYVFEIAANFSIEAECPKLITWAKRCMEKESVSTSLPDHQKLYD  207

Query  247  F  245
            F
Sbjct  208  F  208



>ref|XP_004294219.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=220

 Score =   263 bits (673),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 126/193 (65%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YEYREED  N  K+ LLL+MNP+HKK+PVL+HNGKPVCES   V+YIDE WKDK P LLP
Sbjct  30   YEYREEDLPN--KTSLLLEMNPIHKKVPVLIHNGKPVCESVNIVQYIDEAWKDKGPTLLP  87

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPYE++QA+FW DYIDKKLY+ G+  W+TKGEE EA  K  +  LK+LEG LGDK YFG
Sbjct  88   SDPYERAQARFWVDYIDKKLYEAGKSIWSTKGEEQEAAKKVFLEILKLLEGELGDKTYFG  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G SFGFVD++LV + CWFYT+E+ G+FS+EAECPKL+AW ++CM KESVSKTLPD  K+ 
Sbjct  148  GVSFGFVDINLVTFYCWFYTYETIGNFSIEAECPKLIAWFEKCMLKESVSKTLPDPKKVY  207

Query  250  EFTHVFREKLGFA  212
            EF    ++  G A
Sbjct  208  EFCLFLQKYYGVA  220



>ref|XP_007212046.1| hypothetical protein PRUPE_ppa011371mg [Prunus persica]
 gb|EMJ13245.1| hypothetical protein PRUPE_ppa011371mg [Prunus persica]
Length=213

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 148/180 (82%), Gaps = 2/180 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED  N  KS LLL+MNPVHK IPVL+HNGKP+CES I V+Y+DEVW+DKAPLLPS
Sbjct  30   YENREEDLRN--KSSLLLQMNPVHKMIPVLIHNGKPICESLIIVQYVDEVWRDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++++++FWAD+IDKKLY   RK W TKGEE EAG KE I  LK LEG LGD+PYF G
Sbjct  88   DPYQRARSRFWADFIDKKLYVASRKIWGTKGEEQEAGKKEFIEALKQLEGELGDRPYFEG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+ +  WFY +E+FG+FS EAECPKL+ WAKRCM++ESVSK+L D  K+ E
Sbjct  148  ESFGFLDIALIPFYSWFYAYETFGNFSTEAECPKLIEWAKRCMQRESVSKSLADPKKVYE  207



>ref|XP_011030763.1| PREDICTED: probable glutathione S-transferase isoform X2 [Populus 
euphratica]
Length=219

 Score =   263 bits (672),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 155/190 (82%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  +  KS LLL+MNPV+KKIPVLVH GKPVCES I V+YID+VW+DKAPLLPS
Sbjct  30   YEYSEQDLRD--KSALLLQMNPVYKKIPVLVHRGKPVCESLIIVQYIDDVWRDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q+ FWAD+IDKK++++ +K WTTKGEELE   K+ I  LK+LEG LGD+PYFGG
Sbjct  88   DPYERAQSMFWADFIDKKVFEITKKIWTTKGEELEGAKKDFIECLKLLEGELGDRPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+ V + CWFY +E+ G+FS+EAECPK++AWAKRCM+KESVSK+L    K+ E
Sbjct  148  ENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPKIIAWAKRCMQKESVSKSLEQPKKVYE  207

Query  247  FTHVFREKLG  218
            F    R++ G
Sbjct  208  FVLELRKRFG  217



>ref|XP_002298937.1| hypothetical protein POPTR_0001s42780g [Populus trichocarpa]
 gb|EEE83742.1| hypothetical protein POPTR_0001s42780g [Populus trichocarpa]
Length=220

 Score =   263 bits (672),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 158/191 (83%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  L L+MNPVHKKIPVLVH+GKP+CES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYSEQDLWN--KGALYLQMNPVHKKIPVLVHDGKPICESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKK+Y+LG+K  TTKGE+ EA  K+ I +LK+LEG LGDKP FGG
Sbjct  89   DPYERAQSRFWADFVDKKVYELGKKICTTKGEDQEAAKKDFIDSLKLLEGELGDKPCFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLEKESVSKSLKDPQKVYD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FVVMMRKKLGL  219



>ref|XP_009344314.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
 ref|XP_009347997.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=219

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            Y Y++ED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES IA++YIDEVW DKAPLLPS
Sbjct  30   YVYKDEDVRN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIALQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+Y+ GRK WTTKGEE +A  KE +  + VLEG LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIYEFGRKIWTTKGEEQDAAKKEFLDCMGVLEGELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+ +  WF  +E FG+FS+EA  PK +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  ETLGFVDVALIPFYSWFLLYEKFGNFSVEALHPKFIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKLG  218
            F    R+KLG
Sbjct  208  FVMFMRKKLG  217



>ref|NP_001238691.1| glutathione S-transferase [Glycine max]
 pdb|4CHS|A Chain A, Crystal Structure Of A Tau Class Glutathione Transferase 
10 From Glycine Max
 pdb|4CHS|B Chain B, Crystal Structure Of A Tau Class Glutathione Transferase 
10 From Glycine Max
 gb|AAG34800.1|AF243365_1 glutathione S-transferase GST 10 [Glycine max]
 gb|AAR26528.1| glutathione S-transferase [Glycine max]
 gb|KHN26781.1| Putative glutathione S-transferase [Glycine soja]
 gb|AJE59673.1| tau class glutathione S-transferase [Glycine max]
Length=219

 Score =   263 bits (671),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 153/189 (81%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKP+ ES IAV+YI+EVW D+ PLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKPISESLIAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+D K++DLG+K WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWADYVDIKIHDLGKKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVD++LV +  WF  +E+FG  ++E ECP+ VAWAKRC++KESV+K+LPD HK+ E
Sbjct  148  DNIGFVDIALVPFYTWFKVYETFGSLNIENECPRFVAWAKRCLQKESVAKSLPDQHKVYE  207

Query  247  FTHVFREKL  221
            F    R+KL
Sbjct  208  FVVEIRKKL  216



>ref|XP_004294221.1| PREDICTED: probable glutathione S-transferase [Fragaria vesca 
subsp. vesca]
Length=218

 Score =   262 bits (670),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 153/190 (81%), Gaps = 3/190 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+ NPVHKKIPVL+HNGKPVCES IA++YIDEVW +K PLLPS
Sbjct  30   YEYKDEDLRN--KSPLLLQSNPVHKKIPVLIHNGKPVCESVIALQYIDEVWTNK-PLLPS  86

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY +SQA+FWAD++DKK+YD+GRKTWTTKG+E EA  KE I  +K+LE  LGDKP+FGG
Sbjct  87   DPYLRSQARFWADFVDKKIYDIGRKTWTTKGDEQEAAKKEFIDCIKLLEVELGDKPFFGG  146

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+LV +  WF  +E +G+FS+  ECPK +AW KRCMEKESVSK+LPD  K+  
Sbjct  147  ETLGFVDVTLVPFYSWFSVYEKYGNFSIAPECPKFMAWVKRCMEKESVSKSLPDQDKVCG  206

Query  247  FTHVFREKLG  218
            F    R+KLG
Sbjct  207  FVAEMRKKLG  216



>ref|XP_008226260.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=219

 Score =   262 bits (670),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/190 (64%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+ NPVHKKIPVL+HNGK V ES IAV+Y+DEVWKDKAPLLPS
Sbjct  30   YEYKEEDLRN--KSPLLLQSNPVHKKIPVLIHNGKAVSESLIAVQYVDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP+ ++QA+FWADY+DKK+Y++GRK WTTKGEE +A  KE +  + VLEG LGDKPYFGG
Sbjct  88   DPHLRAQARFWADYVDKKMYEIGRKVWTTKGEEQDAAKKEFLECISVLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVDV+L+ +  W   +E FG+FS+E+E PK +AWAKR +EKESVSK++PD  K+ +
Sbjct  148  KTFGFVDVALIPFYSWLSVYEKFGNFSVESEHPKFIAWAKRSLEKESVSKSVPDQQKVYD  207

Query  247  FTHVFREKLG  218
            F    R+KLG
Sbjct  208  FVLEMRKKLG  217



>ref|XP_004147764.1| PREDICTED: probable glutathione S-transferase parC-like [Cucumis 
sativus]
 ref|XP_004166600.1| PREDICTED: probable glutathione S-transferase parC-like [Cucumis 
sativus]
 gb|KGN53533.1| Glutathione S-transferase [Cucumis sativus]
Length=220

 Score =   262 bits (670),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY EED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES+I VEYIDE W DKAPLLPS
Sbjct  31   YEYVEEDLRN--KSPLLLEMNPIHKKIPVLIHNGKPICESSIIVEYIDEFWNDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
             PY+++QA+FW D+IDKKLY   RK W TKGEE EAG KE I  LK LE  LG+K YFGG
Sbjct  89   HPYDRAQARFWVDFIDKKLYGPTRKIWATKGEEHEAGKKEFIEILKQLEQVLGEKEYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES GF+D++L+G+  WFYT+E+ G FS+EAECPK+++W KRC++ ESV+K+LPDS KI +
Sbjct  149  ESLGFIDIALIGFYSWFYTYETVGKFSIEAECPKIISWGKRCLQNESVAKSLPDSKKIYD  208

Query  247  FTHVFREKLGF  215
            F    ++ LG 
Sbjct  209  FVVQVQKALGI  219



>ref|XP_008226269.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=213

 Score =   262 bits (669),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED  N  KS LLL+MNPVHK IPVL+HNGKP+CES I V+Y+DEVW+DKAPLLPS
Sbjct  30   YENREEDLRN--KSSLLLQMNPVHKMIPVLIHNGKPICESLIIVQYVDEVWRDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++++++FWAD+IDKKLY   RK W TKGEE EAG KE I  LK LEG LGD+PYF G
Sbjct  88   DPYQRARSRFWADFIDKKLYVASRKIWGTKGEEQEAGKKEFIEALKQLEGELGDRPYFEG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+ +  WFY +E+FG+FS EAECPKL+ WAKRCM +ESVSK+L D  K+ E
Sbjct  148  ESFGFLDIALIPFYSWFYAYETFGNFSTEAECPKLIEWAKRCMHRESVSKSLADPKKVYE  207



>ref|XP_010472053.1| PREDICTED: glutathione S-transferase U19-like [Camelina sativa]
Length=219

 Score =   262 bits (670),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LL++MNP+HKKIPVL+HNGKPV ES+I V+YIDEVW  K P+LPS
Sbjct  30   FEYREEDLRN--KSPLLIQMNPIHKKIPVLIHNGKPVVESSIQVQYIDEVWSHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWAD+IDKK+Y+  RK W TKGEE E G K+ I  LK LE  LGDKPYFGG
Sbjct  88   DPYHRAQARFWADFIDKKMYEAQRKVWATKGEEQETGKKDFIEILKTLESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FGFVD++L+G+  WF  +E FG+FS+E ECPKL+AW K+C++++SV+K+LPD  K+ E
Sbjct  148  DDFGFVDIALIGFYTWFPAYEKFGNFSIEQECPKLIAWVKKCLQRDSVAKSLPDPEKVTE  207

Query  247  FTHVFREKL  221
            F  + R K 
Sbjct  208  FVSMLRSKF  216



>ref|NP_173161.1| glutathione S-transferase TAU 25 [Arabidopsis thaliana]
 sp|Q9SHH7.1|GSTUP_ARATH RecName: Full=Glutathione S-transferase U25; Short=AtGSTU25; 
AltName: Full=GST class-tau member 25 [Arabidopsis thaliana]
 gb|AAD50015.1|AC007651_10 Putative glutathione transferase [Arabidopsis thaliana]
 dbj|BAC43490.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|AAO64063.1| putative glutathione transferase [Arabidopsis thaliana]
 gb|AEE29555.1| glutathione S-transferase TAU 25 [Arabidopsis thaliana]
Length=221

 Score =   262 bits (670),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            ++YRE+D  N  KS +LL+MNPVHKKIPVL+HNG PVCES I +EYIDEVW  K PLLPS
Sbjct  30   FDYREQDLWN--KSPILLEMNPVHKKIPVLIHNGNPVCESLIQIEYIDEVWPSKTPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW D+IDKK+Y   R  W  KGEE EAG KE I  LK LE  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDFIDKKVYASARLIWGAKGEEHEAGKKEFIEILKTLESELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++L+G+  WF  +E FG FS+EAECPKL+AW KRC+E+ESV+K+LPDS KI++
Sbjct  148  ETFGYVDIALIGFYSWFEAYEKFGSFSIEAECPKLIAWGKRCVERESVAKSLPDSEKIIK  207

Query  247  FTHVFREKLGF  215
            F    R+KLG 
Sbjct  208  FVPELRKKLGI  218



>gb|AFK34240.1| unknown [Lotus japonicus]
Length=221

 Score =   262 bits (670),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 150/180 (83%), Gaps = 2/180 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+  N  KS+LLL+MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDKAP+LPS
Sbjct  30   YEYKEENLRN--KSDLLLQMNPVHKKIPVLIHNGKPICESAIIVQYIDEVWKDKAPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FW DYIDKK+YD  RK W ++GEE EAG KELI   K+LE  LGDK ++GG
Sbjct  88   DPYERAQARFWVDYIDKKVYDTWRKMWLSEGEEHEAGKKELISIFKLLEETLGDKSFYGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGF+D+ L+ +  WFYT+E+FG+F +E ECPKL+ W KRCM+KE+VSKTLPD  K+ E
Sbjct  148  DTFGFLDLGLIPFYTWFYTFETFGNFKMETECPKLMDWVKRCMQKETVSKTLPDEKKVYE  207



>ref|XP_010428964.1| PREDICTED: glutathione S-transferase U19-like [Camelina sativa]
Length=219

 Score =   262 bits (670),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+HKKIPVL+HNGKPV ES I V+YIDEVW  K P+LPS
Sbjct  30   FEYREEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPVNESIIQVQYIDEVWSHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+Y+  RK W TKGEE E G K+ I  LK LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWADFIDKKMYEAQRKVWATKGEEQETGKKDFIEILKTLESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG VD++L+G+  WF ++E FG+FS+E ECPKL+AW K+C+++E+V+K+LPD  K+ E
Sbjct  148  DEFGLVDIALIGFSTWFPSYEKFGNFSIEQECPKLIAWVKKCLQRETVAKSLPDPEKVTE  207

Query  247  FTHVFREKL  221
            F  + R K 
Sbjct  208  FVSMLRSKF  216



>ref|XP_011082829.1| PREDICTED: probable glutathione S-transferase [Sesamum indicum]
Length=219

 Score =   262 bits (669),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREE+  N  KS LLL+MNPVHKKIPVL+HNGKP+ ES I V+YIDEVWKDK PLLPS
Sbjct  30   YEYREENLAN--KSPLLLEMNPVHKKIPVLIHNGKPISESLIIVQYIDEVWKDKFPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++DKK++D GR+ WT KGEE EA  KE I  LK+LEG LG+K YFGG
Sbjct  88   DPYQRAQARFWADFVDKKIFDAGRRIWTRKGEEQEAAKKEFIDALKLLEGELGEKAYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FGFVDV+L+ +  WF T+E+ G+FS+E  CPKLVAWAKRCMEKESVSK+L D   + E
Sbjct  148  DKFGFVDVALITFYSWFDTYETCGNFSVEEHCPKLVAWAKRCMEKESVSKSLADPKMVYE  207

Query  247  FTHVFREKLGF  215
               + ++K G 
Sbjct  208  AVLMLKKKFGI  218



>gb|ADB11329.1| tau class glutathione transferase GSTU54 [Populus trichocarpa]
Length=220

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 159/192 (83%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  LLL+MNPVHKKIPVLVH+GKP+CES I V+YIDEV KDKAPLL S
Sbjct  31   YEYSEQDLWN--KGALLLQMNPVHKKIPVLVHDGKPICESLIIVQYIDEVSKDKAPLLSS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKKLY+LG+K +TTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYERAQSRFWADFVDKKLYELGKKIYTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  DTLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLEKESVSKSLEDPQKVYD  208

Query  247  FTHVFREKLGFA  212
            F  + R+K  +A
Sbjct  209  FVVMLRKKFNWA  220



>emb|CDP11584.1| unnamed protein product [Coffea canephora]
Length=173

 Score =   259 bits (663),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 142/171 (83%), Gaps = 0/171 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DK PLLPSDPY+++QA+FWAD++DKK+
Sbjct  1    MNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWHDKNPLLPSDPYQRAQARFWADFVDKKV  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
            YD GR+ W TKGEE EA  KE IG +K LEG LG+KPYFGGE FG+VDV+L+ + CWF+ 
Sbjct  61   YDCGRRIWATKGEEKEAAKKEFIGIMKKLEGELGNKPYFGGEDFGYVDVALIPFYCWFHA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLG  218
            +E+FG+F  E ECPKLV WAKRCM++ESVSK+L D HK+ EF    ++KLG
Sbjct  121  YENFGNFKTETECPKLVEWAKRCMQRESVSKSLADPHKVYEFIVSLKKKLG  171



>ref|XP_002270159.1| PREDICTED: probable glutathione S-transferase [Vitis vinifera]
Length=219

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/181 (69%), Positives = 147/181 (81%), Gaps = 2/181 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  K  LLL+MNP+HKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPS
Sbjct  30   YEYRDEDLFN--KGPLLLEMNPIHKKIPVLIHNGKPICESQIIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWADYIDKKL+ LG + W TKGEE EA  KE I  LK+LEG LGDKPYFGG
Sbjct  88   DQYHRAQARFWADYIDKKLHLLGARLWRTKGEEQEANKKEYIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGFVDV+L+ Y  W Y +E   +FS+EAECPKL+ WAKRCMEKESVS +LPD  K+ +
Sbjct  148  ENFGFVDVNLMPYFSWLYVFEIAANFSIEAECPKLITWAKRCMEKESVSTSLPDRQKLYD  207

Query  247  F  245
            F
Sbjct  208  F  208



>ref|XP_011012342.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   261 bits (668),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS LLL+MNPVHKKIPVLVH+GKPVCES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYSEQDLRN--KSALLLQMNPVHKKIPVLVHDGKPVCESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++FWAD++DKKLY LGRK  TTKGE+ EA  K+ I +LK+LEG LGDK YF G
Sbjct  89   DPYQRAQSRFWADFVDKKLYYLGRKILTTKGEDQEAAKKDFIDSLKLLEGELGDKRYFVG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VDV+L+ + CWFY +E+ G+ ++EA CPKL+A+ +RC+EKESVSK+L D  K+ +
Sbjct  149  ETFGYVDVALIPFYCWFYAYETVGNINIEAVCPKLIAYCRRCLEKESVSKSLDDPQKVSD  208

Query  247  FTHVFREKLGF  215
            F  + R+ LG 
Sbjct  209  FVVMRRKLLGL  219



>ref|XP_006302801.1| hypothetical protein CARUB_v10020928mg [Capsella rubella]
 gb|EOA35699.1| hypothetical protein CARUB_v10020928mg [Capsella rubella]
Length=219

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 148/189 (78%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+HKKIPVL+HNGKPV ES I V+YIDEVW  K+P+LPS
Sbjct  30   FEYREEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPVNESIIQVQYIDEVWSHKSPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+IDKK+YD  RK W TKGEE E G K+ I  LK LE  LGDKPYF G
Sbjct  88   DPYQRAQARFWADFIDKKMYDAQRKVWATKGEEQETGKKDFIEILKTLESELGDKPYFAG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD++L+G+  WF  +E FG+FS+E ECPKL AW K+C+++ESV+K+LP+  K+ E
Sbjct  148  DDFGYVDIALIGFSTWFPAYEKFGNFSVEQECPKLTAWVKKCLQRESVAKSLPEPEKVTE  207

Query  247  FTHVFREKL  221
            F  + R K 
Sbjct  208  FVSMLRTKF  216



>ref|XP_006301003.1| hypothetical protein CARUB_v10021393mg [Capsella rubella]
 gb|EOA33901.1| hypothetical protein CARUB_v10021393mg [Capsella rubella]
Length=221

 Score =   261 bits (667),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 149/190 (78%), Gaps = 0/190 (0%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED +NN KS L+L+MN +HKKIPVL+HNGKPVCES I ++YIDEVW DK P LP+
Sbjct  30   YEYREEDVINNNKSPLVLEMNKIHKKIPVLIHNGKPVCESIIQIQYIDEVWSDKNPFLPT  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP +++QA FWAD+I+KKL+  GRKTW TKGEELEA  KELI  LK L+  LGDKPYFGG
Sbjct  90   DPIQRAQALFWADFIEKKLFRCGRKTWATKGEELEAAKKELIEVLKTLQSELGDKPYFGG  149

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD+ L+G+  WF  ++ FG+FS+E EC KL+AW KRCM++E V+K LPDS K+  
Sbjct  150  DTFGFVDIVLIGFYSWFPAYQKFGNFSVEPECSKLMAWGKRCMQRECVAKALPDSEKLFG  209

Query  247  FTHVFREKLG  218
            +    ++  G
Sbjct  210  YVLQLKKVYG  219



>ref|XP_004251827.1| PREDICTED: probable glutathione S-transferase [Solanum lycopersicum]
Length=220

 Score =   261 bits (666),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 152/192 (79%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLL-P  611
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGK +CES + ++YID+VWKD  PLL P
Sbjct  30   YEYKEEDLKN--KSPLLLQMNPIHKKIPVLIHNGKSICESLVIIQYIDDVWKDIGPLLIP  87

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
             DPY+K+QA FW+DY+D  +++  RKTW TKGEE E  +K+ +G LK+LEG LGDKPYFG
Sbjct  88   KDPYDKAQAWFWSDYMDNTVHEYARKTWATKGEEQEQAIKDFLGGLKLLEGVLGDKPYFG  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            GE+FGF+DVSL+GY  WF  +E+FG F++E ECPKL++W KRCME+ESVSK LPDS K+ 
Sbjct  148  GENFGFLDVSLIGYYSWFLAYETFGKFNVELECPKLISWVKRCMERESVSKALPDSKKVC  207

Query  250  EFTHVFREKLGF  215
            EF    R K+G 
Sbjct  208  EFVLHLRNKIGL  219



>ref|XP_009614585.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=221

 Score =   260 bits (665),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 153/188 (81%), Gaps = 1/188 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE++EE+ L N KS LLL+MNP+HKKIPVL+HNGK VCES + V+YIDEVWK   PL+PS
Sbjct  30   YEHKEEEDLKN-KSPLLLEMNPIHKKIPVLIHNGKSVCESLVIVQYIDEVWKGNGPLIPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYEK+QA FW+DY+D  ++    K WTTKGEE E  VK+ +G LK++EG LGDKPYFGG
Sbjct  89   DPYEKAQAWFWSDYMDNTVHGYAEKIWTTKGEEQEQAVKDFLGGLKLIEGILGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGF+DVSL+G+  WF+ +E+FG FS+EAECPKL++W KRC+E++SVSKTLPDS K+ E
Sbjct  149  ENFGFLDVSLIGFYSWFFAYETFGKFSVEAECPKLISWVKRCLERDSVSKTLPDSEKVCE  208

Query  247  FTHVFREK  224
            F   + E+
Sbjct  209  FAVEWNER  216



>ref|XP_007149245.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
 gb|ESW21239.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
Length=204

 Score =   259 bits (663),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 152/192 (79%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+H GKP+ ES I V+YIDEVW D+ PLLPS
Sbjct  14   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHKGKPISESLIVVQYIDEVWHDRTPLLPS  71

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKT-WTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            DPY+++QA+FWAD++DKK+YDLGRK  WT+KGEE E   KE I TLKVLE  LGD+ YFG
Sbjct  72   DPYQRAQARFWADFVDKKMYDLGRKILWTSKGEENEVAKKEFIETLKVLEEQLGDRTYFG  131

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G++ GF+DV+LV +  WF  +E+FG  +LE+ECPK +AWAKRC++KESV+K+LPD HKI 
Sbjct  132  GDNLGFMDVALVPFYTWFEAYETFGGLNLESECPKFIAWAKRCLQKESVAKSLPDQHKIH  191

Query  250  EFTHVFREKLGF  215
            E     R+K G 
Sbjct  192  EIVVEMRKKSGI  203



>ref|XP_011013655.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=220

 Score =   260 bits (664),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  L L+MNPVHKKIPVLVH+GKP+CES I V+YIDEVWKDKAPLL S
Sbjct  31   YEYSEQDLWN--KGALFLQMNPVHKKIPVLVHDGKPLCESLIIVQYIDEVWKDKAPLLSS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP E++Q++FWAD++DKKLY+LG+K  TTKGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPCERAQSRFWADFVDKKLYELGKKICTTKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLEKESVSKSLKDPQKVYD  208

Query  247  FTHVFREKLGF  215
            F  + R+K G 
Sbjct  209  FVVMLRKKFGL  219



>ref|XP_007149248.1| hypothetical protein PHAVU_005G054200g [Phaseolus vulgaris]
 gb|ESW21242.1| hypothetical protein PHAVU_005G054200g [Phaseolus vulgaris]
Length=222

 Score =   259 bits (663),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 150/192 (78%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL MNPVHKKIPVL+H GKP+ ES IAV+YIDEVW D+ PLLPS
Sbjct  32   YEYKEEDLKN--KSPLLLHMNPVHKKIPVLIHKGKPISESLIAVQYIDEVWHDRTPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRK-TWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            DPY+++QA+FW DY+DKK+YDLGRK  WT+KGEE E   KE I  LKVLE  LGDK YFG
Sbjct  90   DPYQRAQARFWVDYVDKKMYDLGRKIVWTSKGEEKEVAKKEFIEVLKVLEEQLGDKTYFG  149

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G++ GFVDV+LV +  WF  +E+FG  +LE+ECPK +AWAKRC++KESV+K+LPD HKI 
Sbjct  150  GDNLGFVDVALVPFYTWFEAYETFGGLNLESECPKFIAWAKRCLQKESVAKSLPDQHKIH  209

Query  250  EFTHVFREKLGF  215
            E     R+K G 
Sbjct  210  EIIVEMRKKSGL  221



>gb|KHF99304.1| putative glutathione S-transferase [Gossypium arboreum]
Length=220

 Score =   259 bits (663),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 152/191 (80%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS+LLLKMNPVHKKIPVL++NGKPVCES I V+YIDE+W  K+PLLP+
Sbjct  31   YEYKEEDLRN--KSDLLLKMNPVHKKIPVLIYNGKPVCESLIQVQYIDEIWPHKSPLLPT  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++ A+FW D++D K+YDLGRK WTTKGEE EA  KE I  LK+LEG LG+K YFGG
Sbjct  89   DPYQRAIARFWGDFVDNKIYDLGRKLWTTKGEEQEAAKKEFIECLKLLEGELGNKAYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV LV +  WFY +E  G+FS+E ECPKL+AWAKRCMEK++VSK+LPD  KI +
Sbjct  149  ENLGYVDVVLVPFYSWFYAYEKCGNFSIETECPKLIAWAKRCMEKDTVSKSLPDQDKIYD  208

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  209  FVLHLKKVFGI  219



>ref|XP_010476862.1| PREDICTED: glutathione S-transferase U25 [Camelina sativa]
Length=219

 Score =   259 bits (663),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            ++YRE+D  N  KS +LL+MNPVH KIPVL+HNGKPVCES I VEYIDEVW    PLLPS
Sbjct  30   FDYREQDLWN--KSPILLEMNPVHNKIPVLIHNGKPVCESLIQVEYIDEVWPGVNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW DYIDKK+Y   R TW  KGEE EAG KE I  LK LE  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDYIDKKVYASARLTWGAKGEEQEAGKKEFIEILKTLESKLGDKIYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++L+G+  WF  +E FG+FS+EAECPKL+AW KRC E+ESV+K+LPDS KI++
Sbjct  148  ETFGYVDIALIGFYSWFEAYEKFGNFSIEAECPKLIAWGKRCAERESVAKSLPDSEKIIK  207

Query  247  FTHVFREKLGF  215
            F    +++ G 
Sbjct  208  FVPELKKRFGI  218



>ref|XP_006389993.1| hypothetical protein EUTSA_v10019490mg, partial [Eutrema salsugineum]
 gb|ESQ27279.1| hypothetical protein EUTSA_v10019490mg, partial [Eutrema salsugineum]
Length=214

 Score =   259 bits (662),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 117/182 (64%), Positives = 149/182 (82%), Gaps = 1/182 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED +NN KS +LL+MNP+HKKIPVL+HNGKPVCES I V+YIDEVW DK P LP+
Sbjct  30   YEYREEDVINN-KSLMLLEMNPIHKKIPVLIHNGKPVCESIIQVQYIDEVWSDKNPFLPT  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA FWAD+I+KKL   GR+ WTTKGEELEA  KE +  LK+L+  LGDKPYFGG
Sbjct  89   DPYQRAQALFWADFIEKKLCVCGRRAWTTKGEELEATNKEFLELLKILQSELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
              FGFVD+ ++G+ CWF  ++ FG+FS+E+EC KL+AW KRCME+ESV+K+LPD  K++ 
Sbjct  149  AKFGFVDIIMIGFYCWFPAYDKFGNFSIESECCKLMAWGKRCMERESVAKSLPDPEKVVG  208

Query  247  FT  242
            + 
Sbjct  209  YV  210



>gb|ACI42271.1| glutathione S-transferase Tau2 [Citrus sinensis]
 gb|ACO05907.1| glutathione transferase Tau2 [Citrus sinensis]
Length=216

 Score =   259 bits (662),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 152/189 (80%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNG+PVCES+I V+YIDEVWKDKAPLLPS
Sbjct  30   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGRPVCESSIIVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD   KTWTTKGEE EA  KE    LK LEG LGDKP+FGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDASTKTWTTKGEEQEAAKKEFFEALKTLEGQLGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG++D+SL+ +   +YT+E+FG  S+EAECPK  AW KRC+++E+++K LPD  K+LE
Sbjct  148  DNFGYLDLSLIPF---YYTYETFGKSSVEAECPKFKAWVKRCLQRETIAKALPDEKKVLE  204

Query  247  FTHVFREKL  221
                 R+ L
Sbjct  205  HASGMRKNL  213



>gb|ADB11313.1| tau class glutathione transferase GSTU6 [Populus trichocarpa]
Length=220

 Score =   259 bits (662),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K +LLL+MNPVHKKIPVLVH+GKP+CES I V+YIDEVW DKAPLL S
Sbjct  31   YEYSEQDLWN--KGDLLLQMNPVHKKIPVLVHDGKPICESLIIVQYIDEVWNDKAPLLSS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKK+   GRK WT KGE+ EA  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYERAQSRFWADFVDKKVNYFGRKIWTPKGEDQEAAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC+EKESVSK++ D  K+ +
Sbjct  149  DTLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLEKESVSKSVKDPQKVYD  208

Query  247  FTHVFREKLGF  215
            F  + R+K G 
Sbjct  209  FVVMLRKKFGL  219



>gb|KFK42223.1| hypothetical protein AALP_AA2G227200 [Arabis alpina]
Length=219

 Score =   259 bits (662),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+HKK+PVL+HNGKPVCES+I V+YIDEVW  K  ++PS
Sbjct  30   FEYREEDLRN--KSPLLLEMNPIHKKVPVLIHNGKPVCESSIEVQYIDEVWSHKNRIIPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW+D+IDKKLYD+ +KTWT+KGEELEA  KELI  LK LE  LGDK YF G
Sbjct  88   DPYQRAQARFWSDFIDKKLYDVSKKTWTSKGEELEAATKELIEILKTLETELGDKLYFAG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD++L+G+  WF  +E  G+FS E+ECPKL+ W K+C+E+E+V K+LPD HK+ E
Sbjct  148  DEFGYVDIALIGFYTWFPAFEKLGNFSFESECPKLMVWVKKCLERETVVKSLPDPHKVTE  207

Query  247  FTHVFREKLG  218
                 R+K G
Sbjct  208  LVTELRKKFG  217



>ref|XP_002515772.1| glutathione s-transferase, putative [Ricinus communis]
 gb|EEF46611.1| glutathione s-transferase, putative [Ricinus communis]
Length=214

 Score =   259 bits (661),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 147/190 (77%), Gaps = 9/190 (5%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+ED  N  KS LLL+MNPV KKIPVL+HNGKPV ES IAV+YIDE+WKDKAPL PS
Sbjct  32   YEYRDEDLRN--KSALLLQMNPVSKKIPVLIHNGKPVAESLIAVQYIDEIWKDKAPLFPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY K+QA FWAD++DKK+YDLGR+ W TKG+  EA         K LEG LGDKPYFGG
Sbjct  90   DPYSKAQALFWADFVDKKVYDLGRQIWATKGDAQEA-------XFKTLEGELGDKPYFGG  142

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFG+VDV+ V +  WFYT+E  G+FS+EAECPKL+AWAKRC EKESVS +LPD  K+  
Sbjct  143  ESFGYVDVAFVPFYSWFYTYEVSGNFSIEAECPKLIAWAKRCAEKESVSASLPDKEKVYG  202

Query  247  FTHVFREKLG  218
            F    ++ LG
Sbjct  203  FMLELKKMLG  212



>ref|XP_010498064.1| PREDICTED: glutathione S-transferase U25-like [Camelina sativa]
Length=219

 Score =   259 bits (662),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 122/191 (64%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            ++YRE+D  N  KS +LL+MNPVH KIPVL+HNGKPVCES I VEYIDEVW    PLLPS
Sbjct  30   FDYREQDLWN--KSPILLEMNPVHSKIPVLIHNGKPVCESLIQVEYIDEVWPGINPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW DYIDKK+Y   R TW  KGEE EAG KELI  LK LE  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDYIDKKVYASARLTWGAKGEEQEAGKKELIEILKTLESELGDKIYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++L+G+  WF  +E FG+FS+EAECPKL+AW KRC+E+ESV+K+LPDS KI++
Sbjct  148  ETFGYVDIALIGFYSWFGAYEKFGNFSIEAECPKLIAWGKRCVERESVAKSLPDSEKIIK  207

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  208  FVPELKKHFGI  218



>gb|ADB11348.1| tau class glutathione transferase GSTU7 [Populus trichocarpa]
Length=220

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K+ LLL+MNPVH KI VLVHNGKP CES I V+YI+E WKDKAPLLPS
Sbjct  31   YEYGEQDLRN--KTALLLQMNPVHSKILVLVHNGKPACESLIIVQYINEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+ + ++FWAD++DKK+YDLGRK WTTK E+ E+  K+ I +LK+LEG LGDKPYFGG
Sbjct  89   DPYQGALSRFWADFVDKKIYDLGRKIWTTKREDQESAKKDFIDSLKLLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC++KESVSK+L D  K+ +
Sbjct  149  DTLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLQKESVSKSLEDPQKVSD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FVVMMRKKLGL  219



>ref|XP_008226263.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=216

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW+ KAPLLPS
Sbjct  31   YEYREEDLRN--KSSLLLEMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWEGKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++++A+ WAD+IDKK+ D  +K W+TKGEELE   KE I  LK LEG LGDKPYFGG
Sbjct  89   DPYQRARARVWADFIDKKVPDARKKLWSTKGEELEEAKKEFIDILKQLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+    WFY +E+ G+FS EAECPKL+ WAKRCM++ESVSK+L D  K+ E
Sbjct  149  ESFGFLDIALITSYNWFYAFETLGNFSTEAECPKLIEWAKRCMQRESVSKSLADPKKVYE  208

Query  247  F  245
            F
Sbjct  209  F  209



>gb|AFK49533.1| unknown [Medicago truncatula]
Length=219

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNPVHKKIPVL+HNGK +CES IAV+YIDEVW +K+PLLPS
Sbjct  30   HEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGKSICESLIAVQYIDEVWNEKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA+FWADY+DKK+Y++GR  WT KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQEAAKKEFIEALKLLEQELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVDV+L+ +  WF  +E+FG+ ++E ECPK +AWAKRCM+ ES+SK+LPD  K+  
Sbjct  148  DKIGFVDVALIPFYTWFKGYETFGNINVEKECPKFIAWAKRCMQVESISKSLPDQDKVYG  207

Query  247  FTHVFREKLGF  215
            F    R+K G 
Sbjct  208  FIVEIRKKFGL  218



>ref|XP_007149246.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
 gb|ESW21240.1| hypothetical protein PHAVU_005G054000g [Phaseolus vulgaris]
Length=222

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 152/192 (79%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+H GKP+ ES I V+YIDEVW D+ PLLPS
Sbjct  32   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHKGKPISESLIVVQYIDEVWHDRTPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKT-WTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            DPY+++QA+FWAD++DKK+YDLGRK  WT+KGEE E   KE I TLKVLE  LGD+ YFG
Sbjct  90   DPYQRAQARFWADFVDKKMYDLGRKILWTSKGEENEVAKKEFIETLKVLEEQLGDRTYFG  149

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G++ GF+DV+LV +  WF  +E+FG  +LE+ECPK +AWAKRC++KESV+K+LPD HKI 
Sbjct  150  GDNLGFMDVALVPFYTWFEAYETFGGLNLESECPKFIAWAKRCLQKESVAKSLPDQHKIH  209

Query  250  EFTHVFREKLGF  215
            E     R+K G 
Sbjct  210  EIVVEMRKKSGI  221



>ref|XP_008360297.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=218

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/189 (63%), Positives = 152/189 (80%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKPV ES IA++YIDEVW DKAPLLPS
Sbjct  30   YEYKEEDIWN--KSPLLLQMNPVHKKIPVLIHNGKPVSESLIALQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+++ GRK W TKGEE  A +KE +  + VLE  LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIFEFGRKLWATKGEEQNAAIKEFLDFIGVLERELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVDV+L+ Y  WF  +E FG+FS+EAE P+ +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  DTLGFVDVTLISYYSWFLEYEKFGNFSVEAEHPEFIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKL  221
            +  VF+EK+
Sbjct  208  YAIVFKEKV  216



>ref|XP_007149247.1| hypothetical protein PHAVU_005G054100g [Phaseolus vulgaris]
 gb|ESW21241.1| hypothetical protein PHAVU_005G054100g [Phaseolus vulgaris]
Length=222

 Score =   259 bits (662),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 151/192 (79%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+H GKP+ ES I V+YIDEVW D+ PLLPS
Sbjct  32   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHKGKPISESLIVVQYIDEVWHDRTPLLPS  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRK-TWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            DPY+++QA+FWADY+DKK+YD GRK  WT+KGEE E   KE I  LKVLE  LGDK YFG
Sbjct  90   DPYQRAQARFWADYVDKKIYDNGRKIVWTSKGEEKEVAKKEFIEGLKVLEEQLGDKTYFG  149

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G++ GFVDV+LV +  WF  +E+FG F+LE+ECPK +AWAKRC++KESV+K+LPD HKI 
Sbjct  150  GDNLGFVDVALVPFYTWFEAYETFGVFNLESECPKFIAWAKRCLQKESVAKSLPDQHKIH  209

Query  250  EFTHVFREKLGF  215
            E     R+K G 
Sbjct  210  EIVVEMRKKSGI  221



>ref|XP_007212678.1| hypothetical protein PRUPE_ppa018428mg [Prunus persica]
 gb|EMJ13877.1| hypothetical protein PRUPE_ppa018428mg [Prunus persica]
Length=216

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 148/181 (82%), Gaps = 2/181 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYRE+D  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW+ KAPLLPS
Sbjct  31   YEYREQDLRN--KSSLLLQMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWEGKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++++A+ WAD+IDKK+ D  +K W+TKGEELE   KE I  LK LEG LGDKPYFGG
Sbjct  89   DPYQRARARVWADFIDKKVPDARKKLWSTKGEELEEAKKEFIDILKQLEGELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+    WFY +E+ G+FS EAECPKL+ WAKRCM++ESVSK+L D  K+ E
Sbjct  149  ESFGFLDIALITSYNWFYAFETLGNFSTEAECPKLIEWAKRCMQRESVSKSLADPKKVYE  208

Query  247  F  245
            F
Sbjct  209  F  209



>ref|XP_010531898.1| PREDICTED: glutathione S-transferase U25 [Tarenaya hassleriana]
Length=219

 Score =   258 bits (660),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR ED  N  KSELL +MNPVHK IPVL+HNGKPVCES + VEY+DEVW DKAP+LPS
Sbjct  30   YEYRSEDPWN--KSELLTRMNPVHKTIPVLIHNGKPVCESLVQVEYVDEVWSDKAPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+ DKKLY+  +  W  KGEE EA  KE I  LK LE  LGDKPYFGG
Sbjct  88   DPYQRAQARFWADFADKKLYEASKGVWMKKGEEQEAAKKEFIQVLKTLESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG+VD++++G+  WF+T+E +G+FS+EAECP+ V WAKRC++++SV+K+LPD  ++  
Sbjct  148  QTFGYVDIAIIGFYSWFHTYEVYGNFSIEAECPRFVEWAKRCLQRDSVAKSLPDPKEVPA  207

Query  247  FTHVFREKLGF  215
            F  + ++  G 
Sbjct  208  FAEMLKKMFGL  218



>ref|XP_008360299.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 121/190 (64%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+E+D  N  KS LLL+MNPVHKKIPVL+HNGKPVCES IA++YIDEVW DKAPLLPS
Sbjct  30   YEYKEDDLWN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIALQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+++ GRK WTTKGEE +A  K+ +  + VLEG LG+KP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIHENGRKLWTTKGEEYDAAKKDFLDCIGVLEGELGNKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+LV +  WF  +E FG+FS+EAE PK +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  ETLGFVDVALVPFYSWFLVYEKFGNFSVEAEHPKFIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FFMLIRKKRG  217



>ref|XP_008226265.1| PREDICTED: probable glutathione S-transferase [Prunus mume]
Length=219

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+ NPVHK+IPVL+HNGK V ES IAV+YIDEVWKDKAPLLPS
Sbjct  30   YEYKDEDLSN--KSPLLLQSNPVHKQIPVLIHNGKAVSESLIAVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP+ ++ A+FWADY+DKK+Y++G+K WTTKGEE +A  KE +  + VLEG LGDKPYFGG
Sbjct  88   DPHLRAHARFWADYVDKKMYEIGKKVWTTKGEEQDAAKKEFLECISVLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVDV+L+ +  WF  +E FG+FS+EAE PK +AWAKRC+EKESVSK++PD  K+ +
Sbjct  148  KTFGFVDVALIPFYTWFSVYEKFGNFSVEAEHPKFIAWAKRCLEKESVSKSIPDQQKVYD  207

Query  247  FTHVFREKLG  218
                  +KLG
Sbjct  208  LVLEMSKKLG  217



>emb|CDP06112.1| unnamed protein product [Coffea canephora]
Length=218

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 153/191 (80%), Gaps = 4/191 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EY+EE+  +  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DK PLLPS
Sbjct  31   HEYKEENLAD--KSPLLLEMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWHDKNPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP++++QA+FWAD++DKKLYD G + W TKGEE EA  KELIGT+K LE  LGDK YFGG
Sbjct  89   DPHQRAQARFWADFVDKKLYDAGWRLWATKGEEQEAAKKELIGTVKTLEAELGDKTYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FG+VDV+L+ +  WFYT+E+ G+F +  ECPKLV WAKRCM++E+VSK+L D HKI E
Sbjct  149  EDFGYVDVALIPFYNWFYTYETCGNFKI--ECPKLVEWAKRCMQRETVSKSLADPHKIYE  206

Query  247  FTHVFREKLGF  215
            F    ++K G 
Sbjct  207  FVVSLKKKFGI  217



>ref|XP_004251828.1| PREDICTED: probable glutathione S-transferase parC [Solanum lycopersicum]
Length=219

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KSELLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDK+PL+P 
Sbjct  30   YEYKEEDLSN--KSELLLQMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWKDKSPLMPF  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            +PY+++QA+FWAD+IDKK+YD G++ W TKGE+ EA  KE I  LK+LEG LGDK YF G
Sbjct  88   NPYKRAQARFWADFIDKKVYDSGKRIWATKGEDQEAAKKEFIEYLKLLEGELGDKTYFNG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGFVD++L+ +  WF T+E FG+F++E ECPK VAWA +C+ K+SVSK+L +S+K+ E
Sbjct  148  ENFGFVDLALIPFYSWFPTFEKFGNFNIEKECPKFVAWANKCIYKDSVSKSLAESNKVYE  207

Query  247  FTHVFREKLGF  215
            +    ++ LG 
Sbjct  208  YVLKMKQHLGL  218



>ref|XP_011036234.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
 ref|XP_011013657.1| PREDICTED: probable glutathione S-transferase [Populus euphratica]
Length=217

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  +LL+MNPV+KK+PVL+HNGKP+CES IAV+YIDEVW +K+PLLPS
Sbjct  28   YEYSEQDLRN--KGPMLLQMNPVYKKVPVLIHNGKPICESLIAVQYIDEVWNNKSPLLPS  85

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++ WAD++D K+Y  GRKTWT KG+ELEAG  +LI +LK+LEG LGDKPYF G
Sbjct  86   DPYQRAQSRLWADFVDNKVYFPGRKTWTKKGQELEAGKNDLIESLKLLEGELGDKPYFEG  145

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ G+VD++LV +  WF+ +E+FG+FS+EAECPKL+AW KRC++ ESVS++L D  ++  
Sbjct  146  DNLGYVDIALVPFYSWFHGYETFGNFSIEAECPKLIAWCKRCLQNESVSRSLADPQEVYG  205

Query  247  FTHVFREKLGF  215
            F    R+KLGF
Sbjct  206  FLVELRKKLGF  216



>ref|XP_007213483.1| hypothetical protein PRUPE_ppa023395mg [Prunus persica]
 gb|EMJ14682.1| hypothetical protein PRUPE_ppa023395mg [Prunus persica]
Length=220

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 151/190 (79%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED L N KS LLL+MNP HKKIPVL+HNGKPVCES   V+YIDE WKDKAPLLPS
Sbjct  30   YESREEDLLYN-KSPLLLQMNPFHKKIPVLIHNGKPVCESANIVQYIDEAWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW  YIDK LY+ G+  W TKG+E EA  K+LI  LK+LEG LGD  YFGG
Sbjct  89   DPYQRAQARFWVSYIDKNLYEAGKNIWATKGKEQEAAKKKLIEILKLLEGQLGDNTYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FGF+DV+LV +  WF+++E+ G+FS+EAECPKL+ WAKRCM+KESV+K++ +  K+ E
Sbjct  149  EIFGFLDVALVTFYSWFFSYETCGNFSIEAECPKLIEWAKRCMQKESVAKSVAEPKKVYE  208

Query  247  FTHVFREKLG  218
            FT + ++  G
Sbjct  209  FTLLLKKMFG  218



>gb|ADB11366.1| tau class glutathione transferase GSTU39 [Populus trichocarpa]
Length=219

 Score =   258 bits (659),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 156/191 (82%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D +N  KS+LLL+MNPV+KKIPVLVH GKPVCES I V+YID+VW+DKAPLLPS
Sbjct  30   YEYSEQDLMNG-KSDLLLQMNPVYKKIPVLVHRGKPVCESLIIVQYIDDVWRDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DP+E++Q+ FWAD+IDKK+ DL RK WTTKGEELEA  K     LK+LEG LG+KPYFGG
Sbjct  89   DPHERAQSMFWADFIDKKINDLSRKIWTTKGEELEAAKKGFF-ELKLLEGELGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VD++ + +CC F T+E+ G+FS+EA+CPK++AWAKRC++KESV+K+L +  K+ E
Sbjct  148  ETLGYVDIAFLPFCCGFSTYETIGNFSIEAQCPKIIAWAKRCLQKESVAKSLAEPGKLHE  207

Query  247  FTHVFREKLGF  215
                 R+ LGF
Sbjct  208  LVLEMRKSLGF  218



>ref|XP_010459291.1| PREDICTED: glutathione S-transferase U25-like [Camelina sativa]
Length=219

 Score =   258 bits (659),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            ++YRE+D  N  KS +LL+MNPVH KIPVL+HNGKPVCES I VEYIDEVW    PLLPS
Sbjct  30   FDYREQDLWN--KSPILLEMNPVHNKIPVLIHNGKPVCESLIQVEYIDEVWPGINPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW DYIDKK+Y   R TW  KGEE EAG KE I  LK LE  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDYIDKKVYASARLTWGAKGEEQEAGKKEFIEILKTLESELGDKIYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++L+G+  WF  +E FG+FS+EAECPKL+AW KRC+E+ESV+K+LPDS KI++
Sbjct  148  ETFGYVDIALIGFYSWFGAYEKFGNFSIEAECPKLIAWGKRCVERESVAKSLPDSEKIIK  207

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  208  FVPELKKHFGI  218



>emb|CBI32895.3| unnamed protein product [Vitis vinifera]
Length=173

 Score =   256 bits (654),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 142/172 (83%), Gaps = 0/172 (0%)
 Frame = -3

Query  730  MNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPSDPYEKSQAKFWADYIDKKL  551
            MNPVHKKIPVL+HNGKP+CES I V+YIDEVWKDK+PLLPSDPY+++QA+FWADY+DKKL
Sbjct  1    MNPVHKKIPVLIHNGKPICESLIIVQYIDEVWKDKSPLLPSDPYQRAQARFWADYVDKKL  60

Query  550  YDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGGESFGFVDVSLVGYCCWFYT  371
             +LG+K  +TKGEE E   KE I  LK+LEG LG+KPYFGGE  GFVDV+LV + CWFY 
Sbjct  61   AELGKKICSTKGEEQETAKKEFIECLKLLEGELGEKPYFGGEKIGFVDVALVPFSCWFYA  120

Query  370  WESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILEFTHVFREKLGF  215
            +ESFG+FS+EAECPKL+AW KRCMEKESVS +L D HK+  +    R+K G 
Sbjct  121  YESFGNFSIEAECPKLIAWTKRCMEKESVSSSLEDPHKVHGYVVGIRKKYGI  172



>gb|AAM64593.1| glutathione transferase, putative [Arabidopsis thaliana]
Length=219

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+HKKIPVL+HNGKPV ES I V+YIDEVW  K P+LPS
Sbjct  30   FEYREEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPVNESIIQVQYIDEVWSHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWAD+IDKKLYD  RK W TKGEE EAG K+ I  LK LE  LGDKPYF G
Sbjct  88   DPYLRAQARFWADFIDKKLYDAQRKVWATKGEEQEAGKKDFIEILKTLESELGDKPYFSG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD++L+G+  WF  +E F +FS+E+E PKL+AW K+C+++ESV+K+LPD  K+ E
Sbjct  148  DDFGYVDIALIGFYTWFPAYEKFANFSIESEVPKLIAWVKKCLQRESVAKSLPDPEKVTE  207

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  208  FVSELRKKF  216



>ref|XP_009117719.1| PREDICTED: glutathione S-transferase U25 [Brassica rapa]
 emb|CDY21758.1| BnaA09g45090D [Brassica napus]
Length=219

 Score =   258 bits (658),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            ++YRE+D  N  KS +LL+MNPVHKKIPVL+HNGKPVCES I VEYIDE W    P LPS
Sbjct  30   FDYREQDLFN--KSPILLEMNPVHKKIPVLIHNGKPVCESLIQVEYIDETWPGGNPFLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW D+IDKK+Y   R  W  KGEE EAG KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDFIDKKVYGPTRLIWGAKGEEQEAGTKEFIEMLKMLESELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++++G+ CWF   E  G+FS+EAECPKL+AWAKRCM++ESV+K+LPDS+KI +
Sbjct  148  ETFGYVDIAMIGFYCWFDVLEKCGNFSIEAECPKLIAWAKRCMKRESVAKSLPDSNKITK  207

Query  247  FTHVFREKLGF  215
            F    ++K+G 
Sbjct  208  FVPELKKKIGI  218



>ref|NP_001236312.1| glutathione transferase [Glycine max]
 emb|CAA71784.1| glutathione transferase [Glycine max]
Length=216

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 150/189 (79%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLLKMNPVHKKIPVL+HNGKP+CES +AV+YI+EVW D+ PLLPS
Sbjct  30   YESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGKPICESLVAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++D K++DLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVD++L+ +  WF T   FG  ++E+ECPK VAWAKRCM+K+SV+++LPD HK+ E
Sbjct  148  DDLGFVDIALIPFDTWFKT---FGSLNIESECPKFVAWAKRCMQKDSVARSLPDQHKVYE  204

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  205  FIMGIRKKF  213



>gb|ADB11352.1| tau class glutathione transferase GSTU15 [Populus trichocarpa]
Length=219

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/191 (64%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE RE++ ++  KS LLL+MNPVHK IPVL+HNGKP+CES   V+YIDEVWKDK+PLLPS
Sbjct  30   YESREQNLID--KSSLLLEMNPVHKTIPVLIHNGKPICESHNIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA+FWADYIDKK+Y+  +K W  KGE+ E   +E I  LK LEG LGDK YFGG
Sbjct  88   DPYQRSQARFWADYIDKKIYNNAKKLWKEKGEKQEEVKREFIEGLKTLEGELGDKLYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGFVDV LV    WFY+ E  G FS+EAECPK+ AW KRCMEKESVS +LPD HKI +
Sbjct  148  ESFGFVDVVLVPVTSWFYSLEICGKFSIEAECPKITAWIKRCMEKESVSSSLPDPHKIYD  207

Query  247  FTHVFREKLGF  215
            F  + ++K+G 
Sbjct  208  FVLLLKQKMGI  218



>ref|XP_006584638.1| PREDICTED: glutathione S-transferase GST 9 isoform X1 [Glycine 
max]
 gb|ACU18934.1| unknown [Glycine max]
 gb|KHN26786.1| Glutathione S-transferase 3 [Glycine soja]
 gb|AJE59671.1| tau class glutathione S-transferase [Glycine max]
Length=219

 Score =   257 bits (657),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 147/182 (81%), Gaps = 2/182 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I V+YIDEVW DKAP+LPS
Sbjct  30   YEYKEENLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESAIIVQYIDEVWNDKAPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FW DYIDKK+YD  RK W +KGEE EAG KE I   K LE  L DK Y+G 
Sbjct  88   DPYERAQARFWVDYIDKKVYDTWRKMWLSKGEEHEAGKKEFISIFKQLEETLSDKAYYGS  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGF+D+ L+ +  WFYT+E++G+F +E ECPKLVAWAKRCM++E+VSK+LPD  K+ +
Sbjct  148  DTFGFLDIGLIPFYSWFYTFETYGNFKMEEECPKLVAWAKRCMQREAVSKSLPDEKKVYD  207

Query  247  FT  242
            + 
Sbjct  208  YV  209



>ref|NP_565178.1| glutathione S-transferase TAU 19 [Arabidopsis thaliana]
 sp|Q9ZRW8.1|GSTUJ_ARATH RecName: Full=Glutathione S-transferase U19; Short=AtGSTU19; 
AltName: Full=GST class-tau member 19; AltName: Full=Glutathione 
S-transferase 8 [Arabidopsis thaliana]
 gb|AAK60284.1|AF385691_1 At1g78380/F3F9_11 [Arabidopsis thaliana]
 emb|CAA10060.1| glutathione transferase [Arabidopsis thaliana]
 gb|AAL77713.1| At1g78380/F3F9_11 [Arabidopsis thaliana]
 gb|AEE36099.1| glutathione S-transferase TAU 19 [Arabidopsis thaliana]
Length=219

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 147/189 (78%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNP+HKKIPVL+HNGKPV ES I V+YIDEVW  K P+LPS
Sbjct  30   FEYREEDLRN--KSPLLLQMNPIHKKIPVLIHNGKPVNESIIQVQYIDEVWSHKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWAD+IDKKLYD  RK W TKGEE EAG K+ I  LK LE  LGDKPYF G
Sbjct  88   DPYLRAQARFWADFIDKKLYDAQRKVWATKGEEQEAGKKDFIEILKTLESELGDKPYFSG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD++L+G+  WF  +E F +FS+E+E PKL+AW K+C+++ESV+K+LPD  K+ E
Sbjct  148  DDFGYVDIALIGFYTWFPAYEKFANFSIESEVPKLIAWVKKCLQRESVAKSLPDPEKVTE  207

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  208  FVSELRKKF  216



>emb|CDY14615.1| BnaC02g24980D [Brassica napus]
Length=219

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/189 (61%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYR+ED  N  KS LLL+ NPVHKKIPVL+HNGKPVCESTI V+YIDEVW DK  +LPS
Sbjct  30   FEYRDEDLWN--KSPLLLETNPVHKKIPVLIHNGKPVCESTIQVQYIDEVWSDKNRILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD  RK W TKGEE E G KE I  LK LE  LG+  YFGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDAQRKVWGTKGEEQETGKKEFIELLKTLESELGENTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD+ L+G+  WF+ +E +G+ ++E+ECPKL+AWAK CM++ESV+K+LPDS K++E
Sbjct  148  DDFGYVDIGLIGFYSWFHAYEKYGNLNIESECPKLIAWAKTCMQRESVAKSLPDSEKVIE  207

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  208  FVTEIRKKF  216



>ref|XP_008451814.1| PREDICTED: probable glutathione S-transferase [Cucumis melo]
Length=217

 Score =   257 bits (656),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 151/189 (80%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  KS LLL+MNP+HK+IPVL+HNGKP+CES+I VEYIDE WKDKAPLLPS
Sbjct  30   YEYVEQDLRN--KSPLLLQMNPIHKQIPVLIHNGKPICESSIIVEYIDEFWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FW D+IDKK+Y+  +K +T KGEE E G KE+I  LK LE  LG+K YFGG
Sbjct  88   DPYERAQARFWVDFIDKKIYESAKKIYTKKGEEQEGGKKEVIEILKQLEQVLGEKAYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E FG++D+ L+G+  WFY +E+ G+FS+EAECPKL++W KRC+EKESVS +LPD  K+ E
Sbjct  148  ECFGYLDIGLIGFSSWFYAYETIGNFSIEAECPKLISWVKRCLEKESVSNSLPDPKKVCE  207

Query  247  FTHVFREKL  221
                F+++ 
Sbjct  208  SLLQFKKRF  216



>gb|ADB11347.1| tau class glutathione transferase GSTU5 [Populus trichocarpa]
Length=220

 Score =   257 bits (656),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 155/191 (81%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E+D  N  K  L L+MNPVHKKIPVLVH+GKP+CES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYSEQDLWN--KGALYLQMNPVHKKIPVLVHDGKPICESLIIVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++Q++FWAD++DKK+   G+K  TTKGE+ EA  K+ I +LK+LEG LGDKP FGG
Sbjct  89   DPYERAQSRFWADFVDKKVNYFGKKICTTKGEDQEAAKKDFIDSLKLLEGELGDKPCFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+L+ + CWFY +E+ G+F++EA+CPKL+A+ KRC+EKESVSK+L D  K+ +
Sbjct  149  ETLGYVDVALLPFYCWFYAYETIGNFNIEADCPKLIAYCKRCLEKESVSKSLKDPQKVYD  208

Query  247  FTHVFREKLGF  215
            F  + R+KLG 
Sbjct  209  FVVMMRKKLGL  219



>gb|KHN27773.1| Putative glutathione S-transferase [Glycine soja]
Length=216

 Score =   256 bits (655),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 151/189 (80%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLLKMNPVHKKIPVL+HNGKP+CES +AV+YI+EVW D+ PLLPS
Sbjct  30   YESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGKPICESLVAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++D K++DLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVD++L+ +  WF T   FG+ ++E+ECPK VAWAKRC++K+SV+++LPD HK+ E
Sbjct  148  DDLGFVDIALIPFDTWFKT---FGNLNIESECPKFVAWAKRCLQKDSVARSLPDQHKVYE  204

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  205  FIMDIRKKF  213



>gb|ACL80571.1| glutathione S-transferase [Glycine max]
 gb|AJE59678.1| tau class glutathione S-transferase [Glycine max]
Length=216

 Score =   256 bits (655),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 150/189 (79%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLLKMNPVHKKIPVL+HNGKP+CES +AV+YI+EVW D+ PLLPS
Sbjct  30   YESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGKPICESLVAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++D K++DLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVD++L+ +  WF T   FG  ++E+ECPK VAWAKRC++K+SV+K+LPD HK+ E
Sbjct  148  DDLGFVDIALIPFDTWFKT---FGSLNIESECPKFVAWAKRCLQKDSVAKSLPDQHKVYE  204

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  205  FIMDIRKKF  213



>ref|XP_004147761.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 ref|XP_004161559.1| PREDICTED: probable glutathione S-transferase-like [Cucumis sativus]
 gb|KGN53529.1| Glutathione S-transferase [Cucumis sativus]
Length=218

 Score =   256 bits (655),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 115/191 (60%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY +ED  N  KS LLL+MNP+HKKIPVL+HNGKP+CES+I V+YIDE WKDKAPL P+
Sbjct  30   YEYVDEDLTN--KSPLLLQMNPIHKKIPVLIHNGKPICESSIIVQYIDEFWKDKAPLFPT  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
             PY+++QA+FW D+IDKKL+D GRK W +KGEE E G  E+IG LK LE  +G+K YFGG
Sbjct  88   HPYDRAQARFWVDFIDKKLFDCGRKIWASKGEEQEEGKTEVIGILKQLEEVIGEKAYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E  GFVD+ L+GY  WFY +E+ G+FS+E+ECPK+++WAKRC++ ESVS++LPD  K+ +
Sbjct  148  ECLGFVDIVLIGYYTWFYAYETIGNFSIESECPKIMSWAKRCLQNESVSESLPDPKKVCD  207

Query  247  FTHVFREKLGF  215
            F    ++K G 
Sbjct  208  FVLQMKKKYGL  218



>ref|XP_010428961.1| PREDICTED: glutathione S-transferase U21-like [Camelina sativa]
Length=221

 Score =   256 bits (655),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 115/182 (63%), Positives = 146/182 (80%), Gaps = 0/182 (0%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREE+     KS LLL+MNP++KKIPVL+HNGKPVCES I ++YIDEVW DK P LP+
Sbjct  30   YEYREEEDAIRNKSPLLLEMNPIYKKIPVLIHNGKPVCESIIQIQYIDEVWSDKNPFLPT  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA FWAD+I+KKL+  GRKTW TKGEELEA  KELI  LK L+  LGDKPYFGG
Sbjct  90   DPYQRSQAFFWADFIEKKLFLCGRKTWATKGEELEAAKKELIEILKTLQSELGDKPYFGG  149

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD+ L+G+  WF  ++ FG+FS+E EC KL+ W KRCM+++SV+KTLPDS ++  
Sbjct  150  DTFGFVDIVLIGFYSWFPAYQKFGNFSIEPECSKLMTWGKRCMQRDSVAKTLPDSERVFG  209

Query  247  FT  242
            + 
Sbjct  210  YV  211



>ref|XP_011030762.1| PREDICTED: probable glutathione S-transferase isoform X1 [Populus 
euphratica]
Length=219

 Score =   256 bits (655),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E++  +  KS LLLKMNPV+K+IP L+HNG+ VCES I V+Y+D+VWK KAPLLPS
Sbjct  30   YEYSEQNLRD--KSALLLKMNPVYKRIPTLIHNGRSVCESLIIVQYVDDVWKGKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++FWAD+IDKK++++ +K WTTKGEELE   K+ I  LK+LEG LGD+PYFGG
Sbjct  88   DPYQRAQSRFWADFIDKKVFEITKKIWTTKGEELEGAKKDFIECLKLLEGELGDRPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+ V + CWFY +E+ G+FS+EAECPK++AWAKRCM+KESVSK+L    K+ E
Sbjct  148  ENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPKIIAWAKRCMQKESVSKSLEQPKKVYE  207

Query  247  FTHVFREKLG  218
            F    R++ G
Sbjct  208  FVLELRKRFG  217



>gb|KEH38382.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=203

 Score =   256 bits (653),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/191 (61%), Positives = 150/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EY+EED  N  KS LLL+MNPVHKKIPVL+HNGK +CES IAV+YIDEVW +K+PLLPS
Sbjct  14   HEYKEEDLRN--KSPLLLQMNPVHKKIPVLIHNGKSICESLIAVQYIDEVWNEKSPLLPS  71

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA+FWADY+DKK+Y++G+  WT KGEE EA  KE +  LK+LE  LGDK YFGG
Sbjct  72   DPYQRSQARFWADYVDKKIYEVGKNLWTKKGEEQEAAKKEFVEALKLLEQELGDKTYFGG  131

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVDV+L+ +  WF  +E+FG+ ++E ECPK +AWAKRCM+ ES+SK+LPD  K+  
Sbjct  132  DKIGFVDVALIPFYTWFKGYETFGNINVEKECPKFIAWAKRCMQVESISKSLPDQDKVYG  191

Query  247  FTHVFREKLGF  215
            F    R+K G 
Sbjct  192  FIVEIRKKFGL  202



>gb|ACJ85907.1| unknown [Medicago truncatula]
Length=219

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNPVHKKIPVL+HNGK +CES IAV+YIDEVW +K+PLLPS
Sbjct  30   HEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGKSICESLIAVQYIDEVWNEKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA+FWADY+DKK+Y++GR  WT KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQEAAKKEFIEALKLLEQELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVDV+L+ +  WF  +E+FG+ ++E ECPK +AWAKRCM+ ES+SK+LPD  K+  
Sbjct  148  DKIGFVDVALIPFYTWFKGYETFGNINVEKECPKFIAWAKRCMQVESISKSLPDQDKVYG  207

Query  247  FTHVFREKLGF  215
            F     +K G 
Sbjct  208  FIVEITKKFGL  218



>ref|XP_004295706.1| PREDICTED: probable glutathione S-transferase parC isoform X1 
[Fragaria vesca subsp. vesca]
Length=220

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/179 (66%), Positives = 144/179 (80%), Gaps = 3/179 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YEYREED  N  K+ LLL+MNP+HKKIPVL+HNGKPVCES   V+YIDE WKDK P LLP
Sbjct  30   YEYREEDLRN--KTSLLLEMNPIHKKIPVLIHNGKPVCESANIVQYIDEAWKDKGPALLP  87

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPYE++QA+FW DYIDK LY+ G+  W+TKGEE EA  K  +  LK+LEG LGDK YFG
Sbjct  88   SDPYERAQARFWVDYIDKNLYEAGKNIWSTKGEEQEAAKKIFLEILKLLEGELGDKTYFG  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKI  254
            GESFGFVD++LV + CWF+T+E+ G+FS+EA CP L+AW KRCM+KE VS+ LPD  K+
Sbjct  148  GESFGFVDINLVTFHCWFFTYETIGNFSIEAVCPTLIAWCKRCMQKERVSRILPDPRKV  206



>emb|CDY26861.1| BnaA02g18860D [Brassica napus]
Length=219

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 149/189 (79%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYR+ED  N  KS LLL+ NPVHKKIPVL+HNGKPVCESTI V+YIDEVW DK P+LPS
Sbjct  30   FEYRDEDLWN--KSPLLLETNPVHKKIPVLIHNGKPVCESTIQVQYIDEVWSDKNPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FW D+IDKK+YD  RK W TKGEE E G KE I  LK LE  L DK YFGG
Sbjct  88   DPYQRAQARFWVDFIDKKMYDAQRKVWWTKGEEQETGKKEFIELLKTLESELRDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG+VD+ L+G+  WF+  E +G+ ++E+ECPKL+AWAK CM++ESV+K+LPDS K+++
Sbjct  148  DDFGYVDIGLIGFYSWFHACEKYGNLNIESECPKLIAWAKTCMQRESVAKSLPDSEKVIK  207

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  208  FVTEIRKKF  216



>ref|NP_001234094.1| uncharacterized protein LOC543817 [Solanum lycopersicum]
 gb|AAG16760.1| putative glutathione S-transferase T5 [Solanum lycopersicum]
Length=220

 Score =   256 bits (654),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 153/193 (79%), Gaps = 3/193 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKA-PLLP  611
            YEY+EED +N  KS+LLL+MNP+HKKIPVL+HNGKP+CES I VEYIDEVWKDK+ PL+P
Sbjct  30   YEYKEEDLMN--KSQLLLQMNPIHKKIPVLIHNGKPICESLIIVEYIDEVWKDKSTPLMP  87

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPY+++ A+FWADYI KK+YD G K W++K EE +   K+ I  LKVLEG LGDKPYF 
Sbjct  88   SDPYKRAHARFWADYIGKKIYDGGMKIWSSKVEEHKTANKDFIECLKVLEGELGDKPYFD  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G++FG VD++ + Y  WF  ++   + ++EAECPK VAWAKRCM+KESVSKTL D  KI 
Sbjct  148  GKNFGLVDMAFIPYYSWFPVYKKLSNLNIEAECPKFVAWAKRCMQKESVSKTLVDPDKIY  207

Query  250  EFTHVFREKLGFA  212
            EF  +FR+K+G A
Sbjct  208  EFIVLFRQKIGVA  220



>gb|AAR26529.1| glutathione S-transferase 2 [Glycine max]
Length=216

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 150/189 (79%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLLKMNPVHKKIPVL+HNGKP+CES +AV+YI+EVW D+ PLLPS
Sbjct  30   YESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGKPICESLVAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++D K++DLGRK WT+KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEKEAAKKEFIEALKLLEEQLGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVD++L+ +  WF T   FG  ++E+ECPK VAWAKRC++K+SV+++LPD HK+ E
Sbjct  148  DDLGFVDIALIPFDTWFKT---FGSLNIESECPKFVAWAKRCLQKDSVARSLPDQHKVYE  204

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  205  FIMDIRKKF  213



>ref|XP_008226266.1| PREDICTED: probable glutathione S-transferase parC [Prunus mume]
Length=215

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 147/180 (82%), Gaps = 2/180 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+Y+DEVW+DKAPLLPS
Sbjct  30   YENKEEDLRN--KSSLLLQMNPVHKKIPVLIHNGKPVCESLIIVQYVDEVWRDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++++++FWAD+IDKKLY   RK W TK EE EAG KE I  LK LEG LGD+PYF G
Sbjct  88   DPYQRARSRFWADFIDKKLYVASRKIWGTKEEEQEAGKKEFIEALKQLEGELGDEPYFEG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+ +  WFY +E+ G+FS EAECPKL+ WAKRCM++ESVSK+L D  K+ E
Sbjct  148  ESFGFLDIALIPFYSWFYAYETCGNFSTEAECPKLIEWAKRCMQRESVSKSLADPKKVYE  207



>ref|XP_009354818.1| PREDICTED: probable glutathione S-transferase isoform X1 [Pyrus 
x bretschneideri]
Length=219

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 119/190 (63%), Positives = 152/190 (80%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES IA++YIDEVW DKAPLLPS
Sbjct  30   YEYKDEDLWN--KSPLLLQMNPVHKKIPVLIHNGKPVCESLIALQYIDEVWNDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+YD+GRK  TTKGEE +A  K+ +  + VLEG LGDK +FGG
Sbjct  88   DSYLRAQARFWADFVDKKIYDIGRKLGTTKGEEYDAAKKDFLDCIGVLEGELGDKTFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GFVDV+L+ +  WF  +E  G+FS+EAE PK +AW KRCMEKESVSK+LP+  ++ +
Sbjct  148  ETLGFVDVALIPFYSWFLVYEKSGNFSVEAEHPKFIAWVKRCMEKESVSKSLPEQERVYD  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FVALMRKKFG  217



>ref|XP_007212042.1| hypothetical protein PRUPE_ppa011334mg [Prunus persica]
 gb|EMJ13241.1| hypothetical protein PRUPE_ppa011334mg [Prunus persica]
Length=215

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 148/185 (80%), Gaps = 2/185 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE REED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+Y+DEVW+DKAPLLPS
Sbjct  30   YENREEDLWN--KSSLLLQMNPVHKKIPVLIHNGKPVCESLIIVQYVDEVWRDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++++++FWAD+IDKKLY   RK W TK EE EAG KE I  LK LEG LGD+PYF G
Sbjct  88   DPYQRARSRFWADFIDKKLYVASRKIWGTKEEEQEAGKKEFIEALKQLEGELGDEPYFEG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGF+D++L+ +  WF  +E+ G+FS EAECPKL+ WAKRCM +ESVSK+L D  K+ E
Sbjct  148  ESFGFLDIALIPFYSWFNAYETCGNFSTEAECPKLIEWAKRCMRRESVSKSLADPKKVYE  207

Query  247  FTHVF  233
            F  ++
Sbjct  208  FLTIW  212



>gb|KHN27766.1| Glutathione S-transferase 3 [Glycine soja]
Length=217

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/184 (64%), Positives = 149/184 (81%), Gaps = 4/184 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+  N  KS LLL+MNP+HKKIPVL+HNGKP+CES I V+YIDEVW DKAP+LPS
Sbjct  30   YEYKEENLRN--KSPLLLQMNPIHKKIPVLIHNGKPICESAIIVQYIDEVWNDKAPILPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FW DYIDKK+ D  RK W + GEE E   KE I   K LE ALGDKP++GG
Sbjct  88   DPYERAQARFWVDYIDKKVNDTWRKMWLSTGEEHETWKKEFISVFKQLEEALGDKPFYGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD+ L+ +  WFYT+E++G+F +EAECPKLVAWAKRC+++E+VSKTLPD  K+  
Sbjct  148  DTFGFVDLGLIPFYSWFYTFETYGNFKMEAECPKLVAWAKRCLQRETVSKTLPDEKKV--  205

Query  247  FTHV  236
            + HV
Sbjct  206  YDHV  209



>ref|XP_007133435.1| hypothetical protein PHAVU_011G178400g [Phaseolus vulgaris]
 gb|ESW05429.1| hypothetical protein PHAVU_011G178400g [Phaseolus vulgaris]
Length=219

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREED LNN KS+LLL+MNPVHKKIPVL+HNGKP+ ES I VEYIDEVWK+KA  LPS
Sbjct  30   YEYREED-LNN-KSQLLLQMNPVHKKIPVLIHNGKPISESIIIVEYIDEVWKNKASFLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            +PY+++QA+FWAD+++KK+ D+G + W  K EE+EA  KEL+  LK LE  LG+KPYFGG
Sbjct  88   EPYQRAQARFWADFVNKKIGDVGGRIWAGKREEIEAAKKELVEGLKELEKNLGEKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD++L+ +  WFY++E+ G+F +EAECPK++AWAKRC E+ESVSK++ D  K+ E
Sbjct  148  DTFGFVDIALIPFSTWFYSYEALGNFKVEAECPKIIAWAKRCNERESVSKSVADEKKVYE  207

Query  247  FTHVFR  230
            F   FR
Sbjct  208  FVVDFR  213



>gb|ADB11324.1| tau class glutathione transferase GSTU33 [Populus trichocarpa]
Length=219

 Score =   256 bits (653),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 154/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E++  +  KS LLL+MNPV+KKIP L+HNG+ VCES I V+Y+D+ WK KAPLLPS
Sbjct  30   YEYSEQNLRD--KSALLLQMNPVYKKIPTLIHNGRSVCESLIIVQYVDDAWKGKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++FWAD+IDKK++++ +K WTTKGEELE   K+ I  LK+LEG LGDKPYFGG
Sbjct  88   DPYQRAQSRFWADFIDKKVFEITKKIWTTKGEELEGAKKDFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+ V + CWFY +E+ G+FS+EAECPK++AWAKRCM+KESVSK+L D  K+ E
Sbjct  148  ENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPKIIAWAKRCMQKESVSKSLEDPKKVYE  207

Query  247  FTHVFREKLG  218
            F    +++ G
Sbjct  208  FVLELKKRFG  217



>gb|KJB82121.1| hypothetical protein B456_013G177400 [Gossypium raimondii]
Length=215

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 148/190 (78%), Gaps = 6/190 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE++EED  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVW DKAPLLPS
Sbjct  30   YEHKEEDLRN--KSALLLQMNPVHKKIPVLIHNGKPVCESLIQVQYIDEVWHDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+K+ A+FWADYI    Y+LG + W TKGEE     KELI TLK+LE  LGDKPYFGG
Sbjct  88   DPYQKATARFWADYI----YELGGRVWKTKGEEQATAKKELIETLKLLEKELGDKPYFGG  143

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES G+VDV+ + +  WFY  E  G+FS+EAECPKL+AWAKRCM+KESV+K+LPD  K+ +
Sbjct  144  ESLGYVDVAFIPFYSWFYALEKCGNFSIEAECPKLIAWAKRCMQKESVAKSLPDQQKVYD  203

Query  247  FTHVFREKLG  218
            F    ++  G
Sbjct  204  FILEMKKHFG  213



>ref|XP_008390701.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   255 bits (652),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 149/190 (78%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNGKPV ES IA++YIDEVW  KAPLLPS
Sbjct  30   YEYKEEDIWN--KSPLLLQMNPVHKKIPVLIHNGKPVSESLIALQYIDEVWNXKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+++ GRK W TKGEE  A +KE +  + VLE  LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIFEFGRKLWATKGEEQNAAIKEFLDFIGVLERELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVDV+L+ Y  WF  +E FG+FS+EAE P+ +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  DTLGFVDVTLISYYSWFLEYEKFGNFSVEAEHPEFIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKLG  218
            +    R+K G
Sbjct  208  YAMFLRKKFG  217



>gb|ACU15945.1| unknown [Glycine max]
Length=216

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/189 (62%), Positives = 149/189 (79%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED  N  KS LLLKMNPVHKKIPVL+HNGKP+CES +AV+YI+EVW D+ PLLPS
Sbjct  30   YESKEEDLQN--KSPLLLKMNPVHKKIPVLIHNGKPICESLVAVQYIEEVWNDRNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD++D K++DLGRK WT+KGEE EA  KE I  LK+LE  LGDK YF G
Sbjct  88   DPYQRAQARFWADFVDNKIFDLGRKIWTSKGEEKEAANKEFIEALKLLEEQLGDKTYFAG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +  GFVD++L+ +  WF T   FG  ++E+ECPK VAWAKRC++K+SV+K+LPD HK+ E
Sbjct  148  DDLGFVDIALIPFDTWFKT---FGSLNIESECPKFVAWAKRCLQKDSVAKSLPDQHKVYE  204

Query  247  FTHVFREKL  221
            F    R+K 
Sbjct  205  FIMDIRKKF  213



>ref|XP_009117717.1| PREDICTED: glutathione S-transferase U25-like [Brassica rapa]
Length=219

 Score =   255 bits (651),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 118/191 (62%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            ++YRE+D  N  KS +LL+MNPVHKKIPVL+HNGKPVCES I VEYIDE W    P LPS
Sbjct  30   FDYREQDLFN--KSPILLEMNPVHKKIPVLIHNGKPVCESLIQVEYIDETWPGGNPFLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW D+IDKK+Y   R  W  KG+E EAG KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDFIDKKVYGPTRLIWGAKGKEQEAGTKEFIEMLKMLESELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++++G+ CWF   E  G+FS+EAECPKL+AWAKRCM++ESV+K+LPDS KI +
Sbjct  148  ETFGYVDIAMIGFYCWFDVLEKCGNFSIEAECPKLIAWAKRCMKRESVAKSLPDSDKITK  207

Query  247  FTHVFREKLGF  215
            F    ++K+G 
Sbjct  208  FVPELKKKIGI  218



>ref|XP_004243193.1| PREDICTED: probable glutathione S-transferase parA [Solanum lycopersicum]
Length=219

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 148/189 (78%), Gaps = 2/189 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EE+  N  KS LLLKMNP+HK+IPVL+HNGKP+CES I V+YIDEVWKDKAPLLPS
Sbjct  30   YESKEENLSN--KSSLLLKMNPIHKQIPVLIHNGKPICESLIIVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++ AKFWADY+DKK+Y  GR  WTTKGE  EA  KELI   K+LE  LGDK +FGG
Sbjct  88   DPYERAHAKFWADYVDKKIYSTGRLVWTTKGEAQEAAKKELIHHFKLLEKELGDKTFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FG VD++L+ +  WFY  E+ G+FS+  ECPKLV WAKRCME+ESVS +LPD +K+ +
Sbjct  148  DQFGLVDIALIPFYSWFYALETCGNFSMIHECPKLVEWAKRCMERESVSTSLPDQYKVYD  207

Query  247  FTHVFREKL  221
            F    ++KL
Sbjct  208  FILELKKKL  216



>ref|NP_001275790.1| glutathione S-transferase [Citrus sinensis]
 gb|ABQ95990.2| glutathione S-transferase [Citrus sinensis]
 gb|ACO05906.1| glutathione transferase Tau1 [Citrus sinensis]
Length=216

 Score =   255 bits (651),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 151/189 (80%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNG+PVCES+I V+YIDEVWKDKAPLLPS
Sbjct  30   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGRPVCESSIIVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y+++QA+FW D+IDKK+YD   KTWTT+GEE EA  KE    LK LEG LGDKP+FGG
Sbjct  88   DRYQRAQARFWVDFIDKKMYDASTKTWTTEGEEQEAAKKEFFEALKTLEGQLGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG++D+SL+ +   +YT+E+FG  S+EAECPK  AW KRC+++E+++K LPD  K+LE
Sbjct  148  DNFGYLDLSLIPF---YYTYETFGKSSIEAECPKFKAWVKRCLQRETIAKALPDEKKVLE  204

Query  247  FTHVFREKL  221
                 R+ L
Sbjct  205  HASGMRKNL  213



>ref|XP_006442221.1| hypothetical protein CICLE_v10022193mg [Citrus clementina]
 gb|ESR55461.1| hypothetical protein CICLE_v10022193mg [Citrus clementina]
Length=216

 Score =   254 bits (650),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/189 (62%), Positives = 151/189 (80%), Gaps = 5/189 (3%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHKKIPVL+HNG+PVCES+I V+YIDEVWKDKAPLLPS
Sbjct  30   YEYKEEDLKN--KSPLLLQMNPVHKKIPVLIHNGRPVCESSIIVQYIDEVWKDKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y+++QA+FW D+IDKK+YD   KTWTT+GEE EA  KE    LK LEG LGDKP+FGG
Sbjct  88   DRYQRAQARFWVDFIDKKMYDASTKTWTTEGEEQEAAKKEFFEALKTLEGQLGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG++D+SL+ +   +YT+E+FG  S+EAECPK  AW KRC+++E+++K LPD  K+LE
Sbjct  148  DNFGYLDLSLIPF---YYTYETFGKSSIEAECPKFKAWVKRCLQRETIAKALPDEKKVLE  204

Query  247  FTHVFREKL  221
                 R+ L
Sbjct  205  HASGMRKNL  213



>gb|EYU26249.1| hypothetical protein MIMGU_mgv1a013392mg [Erythranthe guttata]
Length=221

 Score =   255 bits (651),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/193 (62%), Positives = 154/193 (80%), Gaps = 4/193 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDK--APLL  614
            YEY+EE+  +  KS LLL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVWKD     LL
Sbjct  30   YEYKEENLED--KSALLLEMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWKDNNSPSLL  87

Query  613  PSDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYF  434
            PSDPY+K+QA+FWAD++DKK+YD G++ WTTKG+E+E   K+ I  LK++E  LG+KPYF
Sbjct  88   PSDPYQKAQARFWADFVDKKVYDAGKRLWTTKGDEIETAKKDFIKALKLMEAELGEKPYF  147

Query  433  GGESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKI  254
            GGE+FGFVDV+L+ +  WFYT+E+ G+FS+E  CPKL+ W KRCMEKESVSK+L D  K+
Sbjct  148  GGENFGFVDVALITFSSWFYTYETCGNFSVEEHCPKLMEWVKRCMEKESVSKSLADPKKL  207

Query  253  LEFTHVFREKLGF  215
             +    F++K GF
Sbjct  208  YDSILFFKKKHGF  220



>gb|EYU26251.1| hypothetical protein MIMGU_mgv1a013400mg [Erythranthe guttata]
Length=221

 Score =   255 bits (651),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 122/193 (63%), Positives = 150/193 (78%), Gaps = 4/193 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDK--APLL  614
            YEY+EE+  +  KS +LL+MNPVHKKIPVL+HNGKPVCES I V+YIDEVWKD     LL
Sbjct  30   YEYKEENLGD--KSPILLEMNPVHKKIPVLIHNGKPVCESLIIVQYIDEVWKDNNSPSLL  87

Query  613  PSDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYF  434
            PSDPY+K+QA+FWAD++DKK+YD GR+ WTTKG+ELE   K+ I  LK+LE  LG KPYF
Sbjct  88   PSDPYQKAQARFWADFVDKKVYDAGRRLWTTKGDELETAKKDFIEALKLLEAELGKKPYF  147

Query  433  GGESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKI  254
            GGE+FGFVDV+LV Y  WFY +E+ G+FS+   CPKL+ W KRCMEKESVSK+L D  K+
Sbjct  148  GGENFGFVDVALVTYSSWFYAYETCGNFSVAEHCPKLMEWVKRCMEKESVSKSLADPKKV  207

Query  253  LEFTHVFREKLGF  215
             +F    R+K G 
Sbjct  208  YDFVLFLRKKHGL  220



>ref|XP_009106545.1| PREDICTED: glutathione S-transferase U21 [Brassica rapa]
 emb|CDX87452.1| BnaA07g34210D [Brassica napus]
Length=220

 Score =   254 bits (650),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/190 (61%), Positives = 147/190 (77%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE+REED +NN KS LLL+MNP++KKIPVL+HNGKP+CES I V+YIDE+W DK PLLP 
Sbjct  30   YEHREEDLINN-KSALLLEMNPIYKKIPVLIHNGKPICESVIQVQYIDEIWSDKNPLLPK  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA FWAD+IDKKLY  GRKTW TKGEE E   KE IG LK L+  LGDKPYFGG
Sbjct  89   DPYQRAQALFWADFIDKKLYVCGRKTWATKGEEQEEAKKEFIGILKTLQSELGDKPYFGG  148

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FGF+D+ L+G+  WF  ++ FG+FS+E EC KL+ W KRCME+ESV+ +LPD  ++  
Sbjct  149  DRFGFLDIVLIGFYSWFPAYQKFGNFSIEPECSKLMDWGKRCMERESVATSLPDPERVGG  208

Query  247  FTHVFREKLG  218
            F    ++  G
Sbjct  209  FILQLKKLYG  218



>ref|XP_010087162.1| putative glutathione S-transferase parC [Morus notabilis]
 gb|EXB27067.1| putative glutathione S-transferase parC [Morus notabilis]
Length=221

 Score =   254 bits (650),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 150/192 (78%), Gaps = 4/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWK-DKAPLL-  614
            YE+REED  N  KS LLL+MNP+HKKIPVL+HNG+P+ ES   V YID+VW  D+APLL 
Sbjct  30   YEHREEDLRN--KSPLLLQMNPIHKKIPVLIHNGRPISESLNIVHYIDDVWNHDRAPLLL  87

Query  613  PSDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYF  434
            PSDP ++SQA+FWA ++D+ ++  GR+ W TKGEE EA  KE + TL++ E  LGDKPYF
Sbjct  88   PSDPDQRSQARFWAHFVDQNVFSSGRRVWATKGEEQEAAKKEFMETLRLFEVELGDKPYF  147

Query  433  GGESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKI  254
            GGESFG+VDVSLV +  WFY +E+FG+FS+E ECP+L+AWAKRCMEKESV K+LPD  KI
Sbjct  148  GGESFGYVDVSLVAFYSWFYAYETFGNFSIEEECPRLIAWAKRCMEKESVYKSLPDEKKI  207

Query  253  LEFTHVFREKLG  218
             EF    R+K G
Sbjct  208  FEFVIQLRKKFG  219



>ref|XP_008360298.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   254 bits (650),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 151/190 (79%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+MNPVHKKIPVL+HNGKP+CES IA++YIDEVW DKAPLLP 
Sbjct  30   YEYKDEDLWN--KSPLLLQMNPVHKKIPVLIHNGKPICESLIALQYIDEVWNDKAPLLPX  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+Y++GRK WTTKGEE  A  KE +  + VLE  LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIYEIGRKLWTTKGEEQXAXKKEFLDCIGVLERELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
             + GFVDV+L+ Y  WF  +E FG+FS+EAE P+ +AW KRCMEK+SVSK+LP+  K+ +
Sbjct  148  NTLGFVDVALIPYYSWFLVYEKFGNFSVEAEHPEFIAWVKRCMEKKSVSKSLPEQEKVYD  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FVMLVRKKHG  217



>ref|XP_010694823.1| PREDICTED: probable glutathione S-transferase [Beta vulgaris 
subsp. vulgaris]
Length=218

 Score =   254 bits (649),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR+E+  +  KSELLLKMNPVHKKIPVLVHN KPVCES I VEYIDEVW DK PLLPS
Sbjct  30   YEYRDENLRD--KSELLLKMNPVHKKIPVLVHNNKPVCESLIIVEYIDEVWSDKYPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWAD+++KK+Y  GR  W+TKG E EA +++ I  LK+LE  LG+KPYFGG
Sbjct  88   DPYQRAQARFWADFVEKKMYTTGRSVWSTKGAEQEAAIRDFIDHLKLLEQELGNKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FG+VD++ + Y  WF+ +E+ G+F +E  CPK++ WAKRCME+E+V+K LPD  K+ E
Sbjct  148  DNFGYVDLTFIPYYSWFHAYETLGNFKIEESCPKIIEWAKRCMERETVAKALPDQKKVYE  207

Query  247  FTHVFREKLGF  215
            F    ++  G 
Sbjct  208  FVLELKKMYGL  218



>gb|ABK94892.1| unknown [Populus trichocarpa]
Length=219

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/190 (60%), Positives = 153/190 (81%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY E++  +  KS LLL+MNPV+KKIP L+HNG+ VCES I V+Y+D+ WK KAPLLPS
Sbjct  30   YEYSEQNLRD--KSALLLQMNPVYKKIPTLIHNGRSVCESLIIVQYVDDAWKGKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++Q++FWAD+IDKK++++ +K WTTKGEELE    + I  LK+LEG LGDKPYFGG
Sbjct  88   DPYQRAQSRFWADFIDKKVFEITKKIWTTKGEELEGAKTDFIECLKLLEGELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ G+VDV+ V + CWFY +E+ G+FS+EAECPK++AWAKRCM+KESVSK+L D  K+ E
Sbjct  148  ENLGYVDVAFVPFYCWFYAYETCGNFSIEAECPKIIAWAKRCMQKESVSKSLEDPKKVYE  207

Query  247  FTHVFREKLG  218
            F    +++ G
Sbjct  208  FVLELKKRFG  217



>gb|ABZ80407.1| tau glutathione S-transferase [Casuarina glauca]
Length=219

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED +N  KSELLLKMNPV+KKIPV +HNGKP+CES I V+YIDEVW D++PLLPS
Sbjct  30   YEYKEEDLMN--KSELLLKMNPVYKKIPVFIHNGKPICESLIIVQYIDEVWGDRSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FWAD+IDKK ++  +  W  KGEELEA  K+    LK LEG L  KPYFGG
Sbjct  88   DPYERAQARFWADFIDKKFHEASKGLWFNKGEELEAAKKDFFEALKTLEGELDHKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGFVD++L+ +  WFY +++ G FS+E ECPK++ W +RC+E+ESV+KTLPD+ K+ E
Sbjct  148  ENFGFVDLALITFYNWFYFYDTIGKFSIEVECPKIMQWGRRCLERESVAKTLPDTKKLCE  207

Query  247  FTHVFREKLG  218
                 R+K+G
Sbjct  208  AALELRKKIG  217



>ref|XP_009783953.1| PREDICTED: probable glutathione S-transferase [Nicotiana sylvestris]
Length=214

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/193 (64%), Positives = 151/193 (78%), Gaps = 12/193 (6%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLL-P  611
            YEY+EED         LL+MNP+HKKIPVL+HNGKP+CES IAVEYIDEVWKDK PLL P
Sbjct  31   YEYKEED---------LLRMNPIHKKIPVLIHNGKPICESIIAVEYIDEVWKDKTPLLLP  81

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLE-GALGDKPYF  434
              PY ++QA+FW DYIDK +YD GRK WTTKGEE E G K+ I +LK++E  ALG+KPY 
Sbjct  82   FVPYVRAQARFWGDYIDK-MYDFGRKIWTTKGEEHEEGKKKFIDSLKLMELEALGEKPYI  140

Query  433  GGESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKI  254
            GGE+FGFVD++L+G+   FY +E+FG+FS+EAECPKLVAW KRCM++ESVS +L D HKI
Sbjct  141  GGENFGFVDIALIGFYSCFYAYETFGNFSIEAECPKLVAWGKRCMQRESVSTSLADPHKI  200

Query  253  LEFTHVFREKLGF  215
             E   VFR+  G 
Sbjct  201  YEMLQVFRKNHGM  213



>ref|NP_177958.1| glutathione S-transferase TAU 20 [Arabidopsis thaliana]
 sp|Q8L7C9.1|GSTUK_ARATH RecName: Full=Glutathione S-transferase U20; Short=AtGSTU20; 
AltName: Full=FIN219-interacting protein 1; AltName: Full=GST 
class-tau member 20 [Arabidopsis thaliana]
 gb|AAM97004.1| 2,4-D-inducible glutathione S-transferase, putative [Arabidopsis 
thaliana]
 gb|AAN15487.1| 2,4-D-inducible glutathione S-transferase, putative [Arabidopsis 
thaliana]
 gb|AEE36098.1| glutathione S-transferase TAU 20 [Arabidopsis thaliana]
Length=217

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/187 (63%), Positives = 145/187 (78%), Gaps = 2/187 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+ NP+HKKIPVLVHNGKPVCES   V+Y+DE W +K P  PS
Sbjct  30   FEYREEDFSN--KSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWAD++DKK  D   K W  KGEE EAG KE I  +K+LE  LGDKPYFGG
Sbjct  88   DPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFG+VD+SL+ +  WF  +E FG+FS+E+E PKL+AWAKRCMEKESVSK+LPDS KI+ 
Sbjct  148  DSFGYVDISLITFSSWFQAYEKFGNFSIESESPKLIAWAKRCMEKESVSKSLPDSEKIVA  207

Query  247  FTHVFRE  227
            +   +R+
Sbjct  208  YAAEYRK  214



>ref|XP_010416819.1| PREDICTED: glutathione S-transferase U21-like isoform X2 [Camelina 
sativa]
Length=221

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 115/190 (61%), Positives = 148/190 (78%), Gaps = 0/190 (0%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYR E+ + N KS LLL+MNP+HKKI VL+HNGKPVCES I ++YIDEVW DK P LP+
Sbjct  30   YEYRGEEDVINNKSPLLLEMNPIHKKISVLIHNGKPVCESIIQIQYIDEVWSDKNPFLPT  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA FWAD+I+KKL+  GRKTW TKGEELEA  KELI  LK L+  LGDKPYFGG
Sbjct  90   DPYQRSQALFWADFIEKKLFLCGRKTWATKGEELEAAKKELIEILKTLQSELGDKPYFGG  149

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGFVD+ LVG+  WF  ++ FG+FS+E+EC KL+ W K+CM+++SV+K LPD  K+  
Sbjct  150  DTFGFVDIVLVGFYSWFPAYQKFGNFSIESECSKLMTWGKKCMQRDSVAKALPDYDKVFG  209

Query  247  FTHVFREKLG  218
            +    ++  G
Sbjct  210  YVLQLKKVYG  219



>gb|ADB11318.1| tau class glutathione transferase GSTU16 [Populus trichocarpa]
Length=219

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 121/191 (63%), Positives = 148/191 (77%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE RE++ ++  KS LLL+MNPVHK IPVL+HNGKP+CES   V+YIDEVWKDK+PLLPS
Sbjct  30   YESREQNLID--KSPLLLEMNPVHKTIPVLIHNGKPICESHNIVQYIDEVWKDKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA+FWADYIDKK+Y+  +K W  KGEE E   +E I  LK LEG LGDK YFGG
Sbjct  88   DPYQRSQARFWADYIDKKIYNNAKKLWKEKGEEQEEVKREFIEGLKTLEGELGDKLYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ESFGFVDV LV    WFY+ E  G FS+EAECP+  AW KRCMEKESVS +LPD HK+ +
Sbjct  148  ESFGFVDVVLVPVTSWFYSLEICGKFSIEAECPRFTAWIKRCMEKESVSSSLPDPHKVYD  207

Query  247  FTHVFREKLGF  215
            +  + ++K+G 
Sbjct  208  YVLLLKKKMGI  218



>ref|XP_009117716.1| PREDICTED: glutathione S-transferase U25-like [Brassica rapa]
Length=219

 Score =   254 bits (648),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 149/191 (78%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            + YRE+D  N  KS LLL+MNPVHKKIPVL+HNGKPVCES I VEYIDE W  K PLLPS
Sbjct  30   FGYREQDLFN--KSALLLEMNPVHKKIPVLIHNGKPVCESLIQVEYIDETWAGKNPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QAKFW D+IDK +  + R  W  KGEE EAG KE +  LK +E  LGDK YFGG
Sbjct  88   DPYQRAQAKFWGDFIDKMVPGVVRLMWGAKGEEQEAGKKEFVEMLKTVESELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FG+VD++L+GY CWF  +E +G+FS++AECPK++AWAKRCM+++SV+K+LPDS K+ E
Sbjct  148  EAFGYVDIALIGYYCWFDAFEKYGNFSIKAECPKIIAWAKRCMKRDSVAKSLPDSEKVTE  207

Query  247  FTHVFREKLGF  215
                 ++K+G 
Sbjct  208  LVPELKKKMGI  218



>emb|CDX88441.1| BnaC06g38850D [Brassica napus]
Length=221

 Score =   253 bits (647),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 150/191 (79%), Gaps = 0/191 (0%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEYREE+ + N K+ LLL+MNPVHKKIPVL+HNGKPVCES + V+YIDE+W +K P LP 
Sbjct  30   YEYREEEDVINNKTRLLLEMNPVHKKIPVLIHNGKPVCESIVQVQYIDEIWPEKNPFLPK  89

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA FWAD+I+KK+   GR+ WTTKGEELEA  KE +  LK+L+  LGDKPYFGG
Sbjct  90   DPYQRAQALFWADFIEKKVCVCGRRVWTTKGEELEAANKEFLELLKILQSELGDKPYFGG  149

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            + FGFVD+ L+G+ CWF  +E FG++S+E+EC KL+AW KRCM+++SV+ +LPD  +++ 
Sbjct  150  DKFGFVDIVLIGFFCWFPAYEKFGNYSMESECSKLMAWGKRCMQRDSVANSLPDPERVIG  209

Query  247  FTHVFREKLGF  215
            +    ++  G 
Sbjct  210  YVLHLKKLFGL  220



>ref|XP_009757657.1| PREDICTED: probable glutathione S-transferase parC [Nicotiana 
sylvestris]
Length=215

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/185 (63%), Positives = 149/185 (81%), Gaps = 2/185 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED LNN KS LLL+MNP+HKK+PVL+HNGK +CES + V+YIDEVWK   PL+PS
Sbjct  30   YEYKEED-LNN-KSPLLLEMNPIHKKVPVLIHNGKSICESLVIVQYIDEVWKGNGPLIPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYEK+QA FW+DY+   +++   K W TKGEE E  VK+ +G LK++EG LGDKPYFGG
Sbjct  88   DPYEKAQAWFWSDYMGNTVHEYAVKIWATKGEEQEQAVKDYLGGLKLIEGVLGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+FGF+D+SL+G+  WF  +E+FG FS+E ECPKL+ W KRC+E++SVSKTLPDS K+ E
Sbjct  148  ENFGFLDISLIGFYSWFLAYETFGKFSVEKECPKLILWVKRCLERDSVSKTLPDSEKVCE  207

Query  247  FTHVF  233
            F + F
Sbjct  208  FAYEF  212



>ref|XP_008390703.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
 ref|XP_008391906.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 151/192 (79%), Gaps = 2/192 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS LLL+MNPVHKKI VL+HNGKPV ES IA++YIDEVW  KAPLLPS
Sbjct  30   YEYKDEDLWN--KSPLLLQMNPVHKKIRVLIHNGKPVSESLIALQYIDEVWNHKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+Y++GRK W TKGEE +A  KE +  + VLE  LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKMYEIGRKLWATKGEEQDAAKKEFLDCIGVLERELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
             + GFVDV+L+ Y  WF  +E FG+FS+EAE P+ +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  NTLGFVDVTLIPYYSWFLVYEKFGNFSVEAEHPEFIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKLGFA  212
            +  + R+KLG A
Sbjct  208  YAMLIRKKLGIA  219



>ref|XP_009591606.1| PREDICTED: probable glutathione S-transferase [Nicotiana tomentosiformis]
Length=219

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 152/192 (79%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EE+     KS LLL+MNPV++KIPVL+HNGKPVCES I V+YIDEVWKDKAPLLPS
Sbjct  31   YEYKEENL--GEKSSLLLEMNPVYQKIPVLIHNGKPVCESLIVVQYIDEVWKDKAPLLPS  88

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYEK +A FWADY++K ++DLGRK W T+G E +   K  I +L++LEG LGDKPYFGG
Sbjct  89   DPYEKYEAIFWADYVEK-VFDLGRKIWMTRGGEQQTRKKNYIDSLRMLEGILGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            E+ GF+D++L+G+C WFYT+E FG+F+ EAE PKL+AW KRCM++ESVSK++ +  K+ +
Sbjct  148  ENIGFLDIALIGFCSWFYTYEKFGNFNTEAETPKLIAWMKRCMQRESVSKSVAEPLKVYD  207

Query  247  FTHVFREKLGFA  212
            F    R+  G  
Sbjct  208  FALQIRKHYGIV  219



>emb|CAC24549.1| glutathione S-transferase [Cichorium intybus x Cichorium endivia]
Length=219

 Score =   253 bits (646),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/191 (62%), Positives = 147/191 (77%), Gaps = 3/191 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAP-LLP  611
            YE REED  N  KS LLL+MNPVHKK+PVL+H+GKP+CES I V+YIDE W++ +P LLP
Sbjct  31   YERREEDLTN--KSSLLLQMNPVHKKVPVLIHDGKPICESNIIVQYIDEAWQNNSPPLLP  88

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
            SDPY K+QA+FWAD+IDKK+YD G + W  KGEE E   KE I  +KVLEG LG+  Y  
Sbjct  89   SDPYLKAQARFWADFIDKKIYDAGTRIWRRKGEEQEIAKKEFIDWMKVLEGQLGENSYLM  148

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G+SFG+VD+++V + CWFY  E  G+ S+E ECPKLVAWAKRCME+ESVSKTLPD HK+ 
Sbjct  149  GKSFGYVDIAMVPFYCWFYALEKIGNISIEKECPKLVAWAKRCMERESVSKTLPDPHKVY  208

Query  250  EFTHVFREKLG  218
            E+     +KLG
Sbjct  209  EYALELMKKLG  219



>ref|XP_006349999.1| PREDICTED: probable glutathione S-transferase-like [Solanum tuberosum]
Length=220

 Score =   253 bits (645),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 116/192 (60%), Positives = 149/192 (78%), Gaps = 3/192 (2%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLL-P  611
            YEY+EED  N  KS LLL+MNP+HKKIPVL+HNGK +CES + ++YID+VWK   PLL P
Sbjct  30   YEYKEEDLKN--KSPLLLQMNPIHKKIPVLIHNGKSICESLVIIQYIDDVWKGTGPLLVP  87

Query  610  SDPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFG  431
             DPYEK+QA FW+DY+D  +++  RKTW TKGEE E  +K+ +  LK+LEG LGDKPYFG
Sbjct  88   KDPYEKAQAWFWSDYMDNTVHEYARKTWATKGEEQEQSIKDFLDGLKLLEGVLGDKPYFG  147

Query  430  GESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKIL  251
            G++FGF+DVSL+GY  WF  +E+FG F++E ECPKL++W KRC+E++SVSK LPDS K+ 
Sbjct  148  GDNFGFLDVSLIGYYSWFLAYETFGKFNVELECPKLISWVKRCLERDSVSKALPDSKKVC  207

Query  250  EFTHVFREKLGF  215
            EF    R K G 
Sbjct  208  EFVLHLRNKFGL  219



>emb|CBI32903.3| unnamed protein product [Vitis vinifera]
Length=344

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 141/167 (84%), Gaps = 2/167 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNPVHK+IPVL+HNGKP+CES I V+YIDEVW DK+PLL S
Sbjct  170  YEYKEEDLRN--KSPLLLEMNPVHKQIPVLIHNGKPICESLIIVQYIDEVWHDKSPLLRS  227

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+++QA+FWADY+DKKLY LGRK W+TKGEE E   KE I  L++LEG LG+KPYFGG
Sbjct  228  DPYQRAQARFWADYVDKKLYGLGRKVWSTKGEEQETAKKEFIECLQLLEGELGEKPYFGG  287

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKES  287
            E  GFVDV+LV + CWFY +ESFG+FS+EAECPKL+AW KRC EKE+
Sbjct  288  EKIGFVDVALVTFSCWFYAYESFGNFSIEAECPKLIAWTKRCKEKEN  334



>gb|KEH38383.1| glutathione S-transferase, amino-terminal domain protein, partial 
[Medicago truncatula]
Length=204

 Score =   252 bits (643),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/177 (66%), Positives = 144/177 (81%), Gaps = 2/177 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+MNPVHKKIPVL+HNGK +CES IAV+YIDEVW +K+PLLPS
Sbjct  30   HEYREEDLRN--KSPLLLQMNPVHKKIPVLIHNGKSICESLIAVQYIDEVWNEKSPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY++SQA+FWADY+DKK+Y++GR  WT KGEE EA  KE I  LK+LE  LGDK YFGG
Sbjct  88   DPYQRSQARFWADYVDKKIYEVGRNLWTKKGEEQEAAKKEFIEALKLLEQELGDKTYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHK  257
            +  GFVDV+L+ +  WF  +E+FG+ ++E ECPK +AWAKRCM+ ES+SK+LPD  K
Sbjct  148  DKIGFVDVALIPFYTWFKGYETFGNINVEKECPKFIAWAKRCMQVESISKSLPDQDK  204



>ref|XP_006302800.1| hypothetical protein CARUB_v10020927mg [Capsella rubella]
 gb|EOA35698.1| hypothetical protein CARUB_v10020927mg [Capsella rubella]
Length=220

 Score =   253 bits (645),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+ NPVHKKIPVLVHNGKPVCES   V+Y+DE W DK P  PS
Sbjct  30   FEYREEDFSN--KSALLLQSNPVHKKIPVLVHNGKPVCESLNVVQYVDEAWPDKNPFFPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY +SQA+FWAD++DKK  +   K W  KGEE EAG KE I  LK+LE  LGDKPYFGG
Sbjct  88   DPYGRSQARFWADFVDKKFTEAQVKIWMKKGEEQEAGKKEFIEALKILESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFG+VD+SL+ +  WF  +E FG+ S+EAE PKLVAW KRCMEKESVSK+LP+S KI+ 
Sbjct  148  DSFGYVDISLITFYSWFQAYEKFGNISIEAESPKLVAWGKRCMEKESVSKSLPESEKIVG  207

Query  247  FTHVFRE  227
            +   FR+
Sbjct  208  YVAEFRK  214



>ref|XP_009354820.1| PREDICTED: probable glutathione S-transferase [Pyrus x bretschneideri]
Length=219

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/191 (61%), Positives = 151/191 (79%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EY++ED  N  KS LLL+MNPVHKKIPVL+HNGKPV ES IA++YIDEVW  KAPLLPS
Sbjct  30   HEYKDEDLSN--KSPLLLQMNPVHKKIPVLIHNGKPVSESLIALQYIDEVWNHKAPLLPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK++++GRK W TKGEE  A  KE +  + VLE  LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIFEIGRKLWATKGEEQNAAKKEFLDCIGVLERELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++ GFVDV+L+ Y  WF  +E FG+FS+EAE P+ +AW KRCMEKESVSK+LP+  K+ +
Sbjct  148  DTLGFVDVTLISYYSWFLVYEKFGNFSVEAEHPEYIAWVKRCMEKESVSKSLPEQEKVYD  207

Query  247  FTHVFREKLGF  215
            +  + R+KLG 
Sbjct  208  YAMLLRKKLGI  218



>ref|XP_008390702.1| PREDICTED: probable glutathione S-transferase [Malus domestica]
Length=219

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 117/190 (62%), Positives = 150/190 (79%), Gaps = 2/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY++ED  N  KS  LL+MNPVHKKIPVL+HNGKP+CES IA++YIDEVW DKAPLLP 
Sbjct  30   YEYKDEDLWN--KSPXLLQMNPVHKKIPVLIHNGKPICESLIALQYIDEVWNDKAPLLPX  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            D Y ++QA+FWAD++DKK+Y++GRK WTTKGEE  A  KE +  + VLE  LGDKP+FGG
Sbjct  88   DSYLRAQARFWADFVDKKIYEIGRKLWTTKGEEQXAXKKEFLDCIGVLERELGDKPFFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
             + GFVDV+L+ Y  WF  +E FG+FS+EAE P+ +AW KRCMEK+SVSK+LP+  K+ +
Sbjct  148  NTLGFVDVALIPYYSWFLVYEKFGNFSVEAEHPEFIAWVKRCMEKKSVSKSLPEQEKVYD  207

Query  247  FTHVFREKLG  218
            F  + R+K G
Sbjct  208  FVMLVRKKHG  217



>gb|KEH38377.1| glutathione S-transferase, amino-terminal domain protein [Medicago 
truncatula]
Length=219

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 146/191 (76%), Gaps = 2/191 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YEY+EED  N  KS LLL+MNP+H KIPVL+HNGK +CES I V+YIDEVW DKA  +PS
Sbjct  30   YEYKEEDLRN--KSPLLLQMNPIHNKIPVLIHNGKSICESAIIVQYIDEVWNDKASFMPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPYE++QA+FW DY DKK+YD  +K W +KGEE E G  ELI   K LEGAL DK ++GG
Sbjct  88   DPYERAQARFWVDYSDKKVYDTWKKMWLSKGEEYEEGKMELISIFKTLEGALSDKLFYGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ++FGF+D+ L+ +  WFY +E++G+F +E ECPKL+AW KRCMEK+SVSK+LPD  K+ +
Sbjct  148  DTFGFLDIGLIPFYSWFYAFETYGNFKMETECPKLMAWTKRCMEKDSVSKSLPDQKKVYD  207

Query  247  FTHVFREKLGF  215
            F    ++ LG 
Sbjct  208  FVVSIKKALGL  218



>gb|AAM64587.1| 2,4-D inducible glutathione S-transferase, putative [Arabidopsis 
thaliana]
Length=217

 Score =   252 bits (644),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 144/187 (77%), Gaps = 2/187 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +EYREED  N  KS LLL+ NP+HKKIPVLVHNGKPVCES   V+Y+DE W +K P  PS
Sbjct  30   FEYREEDFSN--KSPLLLQSNPIHKKIPVLVHNGKPVCESLNVVQYVDEAWPEKNPFFPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY ++QA+FWAD++DKK  D   K W  KGEE EAG KE I  +K+LE  LGDKPYFGG
Sbjct  88   DPYGRAQARFWADFVDKKFTDAQFKVWGKKGEEQEAGKKEFIEAVKILESELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFG+VD+SL+ +  WF  +E FG+FS+E+E P L+AWAKRCMEKESVSK+LPDS KI+ 
Sbjct  148  DSFGYVDISLITFSSWFQAYEKFGNFSIESESPNLIAWAKRCMEKESVSKSLPDSEKIVA  207

Query  247  FTHVFRE  227
            +   +R+
Sbjct  208  YAAEYRK  214



>ref|XP_002264813.1| PREDICTED: probable glutathione S-transferase parA [Vitis vinifera]
 emb|CAN82751.1| hypothetical protein VITISV_009609 [Vitis vinifera]
Length=221

 Score =   252 bits (644),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 148/190 (78%), Gaps = 1/190 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            YE +EED L   KS LLLKMNPVHKKIPVL+HNGKP+CES I VEYIDEVWKD+ PLLPS
Sbjct  32   YEGKEED-LTGDKSSLLLKMNPVHKKIPVLIHNGKPICESLIIVEYIDEVWKDRCPLLPS  90

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY+K+QAKFWAD+IDK +Y   +K WT KG E EA  KE +  +K+LEG L   PYFGG
Sbjct  91   DPYQKAQAKFWADFIDKMVYPCSKKLWTAKGAEQEASKKEFLDRIKLLEGELKSYPYFGG  150

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            ES GF+D++ + +   FYT+E+FG+FS+EAECPKLVAW KRCME+E VS++LP  HK+ +
Sbjct  151  ESLGFLDIAFLPFYSRFYTFEAFGNFSIEAECPKLVAWGKRCMEEEFVSRSLPHQHKMYD  210

Query  247  FTHVFREKLG  218
                F +K+G
Sbjct  211  LVVEFTKKVG  220



>gb|ABD36807.1| glutathione S-transferase [Brassica napus]
 emb|CDX79260.1| BnaC06g20430D [Brassica napus]
Length=217

 Score =   252 bits (643),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/187 (62%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +E REED  N  KS LLL+ NP+HKK+PVL+HNGKPVCES   V+Y+DE W DK P  PS
Sbjct  30   FEAREEDLTN--KSPLLLQSNPIHKKVPVLIHNGKPVCESLNVVQYVDEAWSDKNPFFPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY K+QA+FWAD++DKK  D   K W  KGEE  AGVKE I  +K+LE  LGDKPYFGG
Sbjct  88   DPYGKAQARFWADFVDKKFSDAQFKIWGKKGEEQAAGVKEFIEAVKILEAELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFG+VD++L+ +  WF  +E FG+FS+EAE PKL+AWAKRCMEKESVSK+LPD  KI+ 
Sbjct  148  DSFGYVDIALITFYSWFGAYEKFGNFSIEAESPKLIAWAKRCMEKESVSKSLPDQEKIVA  207

Query  247  FTHVFRE  227
            +   FR+
Sbjct  208  YAAEFRK  214



>ref|XP_009104573.1| PREDICTED: glutathione S-transferase U20 [Brassica rapa]
Length=217

 Score =   252 bits (643),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 143/187 (76%), Gaps = 2/187 (1%)
 Frame = -3

Query  787  YEYREEDXLNNMKSELLLKMNPVHKKIPVLVHNGKPVCESTIAVEYIDEVWKDKAPLLPS  608
            +E REED  N  KS LLL+ NP+HKK+PVL+HNGKP+CES   V+Y+DE W DK P  PS
Sbjct  30   FEAREEDLTN--KSPLLLRSNPIHKKVPVLIHNGKPICESLNVVQYVDEAWSDKNPFFPS  87

Query  607  DPYEKSQAKFWADYIDKKLYDLGRKTWTTKGEELEAGVKELIGTLKVLEGALGDKPYFGG  428
            DPY K+QA+FWAD++DKK  D   K W  KGEE  AGVKE I  +K+LE  LGDKPYFGG
Sbjct  88   DPYGKAQARFWADFVDKKFSDAQFKIWGKKGEEQAAGVKEFIEAVKILEAELGDKPYFGG  147

Query  427  ESFGFVDVSLVGYCCWFYTWESFGHFSLEAECPKLVAWAKRCMEKESVSKTLPDSHKILE  248
            +SFG+VD++L+ +  WF  +E FG+FS+EAE PKL+AWAKRCMEKESVSK+LPD  KI+ 
Sbjct  148  DSFGYVDIALITFYSWFGAYEKFGNFSIEAESPKLIAWAKRCMEKESVSKSLPDQEKIVA  207

Query  247  FTHVFRE  227
            +   FR+
Sbjct  208  YAAEFRK  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1561126461570