BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037B24

Length=750
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB30572.1|  hypothetical protein B456_005G149900                    173   2e-47   Gossypium raimondii
gb|KDO54649.1|  hypothetical protein CISIN_1g0100252mg                  166   3e-47   Citrus sinensis [apfelsine]
gb|KJB30571.1|  hypothetical protein B456_005G149900                    174   4e-47   Gossypium raimondii
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              171   8e-46   Gossypium arboreum [tree cotton]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    168   6e-45   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               168   6e-45   
ref|XP_006375528.1|  hypothetical protein POPTR_0014s15130g             160   7e-45   
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   7e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             168   9e-45   Citrus clementina [clementine]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            167   1e-44   Solanum lycopersicum
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            168   1e-44   Solanum lycopersicum
emb|CDM86696.1|  unnamed protein product                                167   1e-44   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007045633.1|  MATE efflux family protein isoform 1               167   1e-44   
emb|CDM86687.1|  unnamed protein product                                166   3e-44   Triticum aestivum [Canadian hard winter wheat]
gb|EMT26282.1|  Protein TRANSPARENT TESTA 12                            164   3e-44   
emb|CDP11780.1|  unnamed protein product                                166   5e-44   Coffea canephora [robusta coffee]
gb|EMT13258.1|  Protein TRANSPARENT TESTA 12                            166   5e-44   
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            165   7e-44   Glycine max [soybeans]
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            164   1e-43   Triticum urartu
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   1e-43   Solanum tuberosum [potatoes]
ref|XP_003596992.1|  Transparent testa 12 protein                       164   2e-43   Medicago truncatula
ref|XP_011005125.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   2e-43   Populus euphratica
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Cicer arietinum [garbanzo]
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   2e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   3e-43   
ref|XP_010488189.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   3e-43   Camelina sativa [gold-of-pleasure]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    164   4e-43   Gossypium raimondii
emb|CDM86680.1|  unnamed protein product                                161   4e-43   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            163   4e-43   Phoenix dactylifera
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   6e-43   Glycine max [soybeans]
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            163   6e-43   Glycine soja [wild soybean]
emb|CDM86692.1|  unnamed protein product                                162   7e-43   Triticum aestivum [Canadian hard winter wheat]
gb|EMS63520.1|  Protein TRANSPARENT TESTA 12                            161   7e-43   Triticum urartu
gb|EMT13254.1|  Protein TRANSPARENT TESTA 12                            160   8e-43   
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            162   8e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-42   Oryza brachyantha
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             162   1e-42   Phaseolus vulgaris [French bean]
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       162   1e-42   Nicotiana sylvestris
ref|XP_002883313.1|  mate efflux family protein                         162   1e-42   
ref|NP_188806.1|  MATE efflux family protein                            162   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026056.1|  MATE efflux family protein                         162   1e-42   
gb|AAM20595.1|  integral membrane protein, putative                     162   2e-42   Arabidopsis thaliana [mouse-ear cress]
emb|CAN73203.1|  hypothetical protein VITISV_008169                     156   2e-42   Vitis vinifera
emb|CDP11781.1|  unnamed protein product                                160   2e-42   Coffea canephora [robusta coffee]
ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-42   Nicotiana tomentosiformis
ref|XP_006406244.1|  hypothetical protein EUTSA_v10020869mg             159   2e-42   
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       161   2e-42   Cucumis melo [Oriental melon]
ref|XP_010233179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   2e-42   Brachypodium distachyon [annual false brome]
gb|ACL53378.1|  unknown                                                 160   2e-42   Zea mays [maize]
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    161   3e-42   
gb|AAR00628.1|  putative MATE family protein                            159   3e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       160   4e-42   Camelina sativa [gold-of-pleasure]
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    160   4e-42   Brachypodium distachyon [annual false brome]
dbj|BAM34459.1|  multidrug and toxic compound extrusion-type tran...    152   4e-42   Nicotiana alata [flowering tobacco]
emb|CBI28938.3|  unnamed protein product                                159   5e-42   Vitis vinifera
dbj|BAJ34540.1|  unnamed protein product                                160   5e-42   Eutrema halophilum
emb|CDM86677.1|  unnamed protein product                                160   6e-42   Triticum aestivum [Canadian hard winter wheat]
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            160   6e-42   Glycine soja [wild soybean]
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    160   6e-42   Vitis vinifera
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Setaria italica
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   1e-41   Vitis vinifera
ref|NP_001050520.1|  Os03g0570800                                       159   1e-41   
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            159   1e-41   Vitis vinifera
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Populus euphratica
gb|EEC75604.1|  hypothetical protein OsI_12313                          159   1e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Populus euphratica
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       159   2e-41   Elaeis guineensis
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   2e-41   
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    159   2e-41   Cicer arietinum [garbanzo]
emb|CBI28937.3|  unnamed protein product                                159   2e-41   Vitis vinifera
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             159   2e-41   Capsella rubella
ref|XP_006858199.1|  hypothetical protein AMTR_s00062p00172410          158   3e-41   
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   3e-41   Cicer arietinum [garbanzo]
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   3e-41   Solanum lycopersicum
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    158   3e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   3e-41   Elaeis guineensis
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   4e-41   
gb|KJB57728.1|  hypothetical protein B456_009G178100                    158   4e-41   Gossypium raimondii
gb|KJB57730.1|  hypothetical protein B456_009G178100                    158   4e-41   Gossypium raimondii
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       158   4e-41   Sesamum indicum [beniseed]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            157   5e-41   Nelumbo nucifera [Indian lotus]
ref|XP_002518492.1|  multidrug resistance pump, putative                157   5e-41   Ricinus communis
ref|XP_011047998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   6e-41   Populus euphratica
gb|AHI48506.1|  multidrug and toxic extrusion transporter               158   6e-41   Vaccinium corymbosum [American blueberry]
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             157   6e-41   Phaseolus vulgaris [French bean]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   6e-41   Cucumis melo [Oriental melon]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   7e-41   
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              157   1e-40   Gossypium arboreum [tree cotton]
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   Eucalyptus grandis [rose gum]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   1e-40   Nicotiana sylvestris
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             156   2e-40   
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            156   2e-40   Tarenaya hassleriana [spider flower]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    156   2e-40   Populus euphratica
ref|XP_004164859.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   2e-40   
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             155   2e-40   Eutrema salsugineum [saltwater cress]
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Cucumis melo [Oriental melon]
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   3e-40   Prunus mume [ume]
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          155   3e-40   Sorghum bicolor [broomcorn]
ref|NP_001147791.1|  transparent testa 12 protein                       155   3e-40   Zea mays [maize]
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             155   3e-40   Populus trichocarpa [western balsam poplar]
gb|KCW76952.1|  hypothetical protein EUGRSUZ_D01312                     154   3e-40   Eucalyptus grandis [rose gum]
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                155   4e-40   Erythranthe guttata [common monkey flower]
ref|NP_001050524.1|  Os03g0572900                                       155   4e-40   
gb|EEC75610.1|  hypothetical protein OsI_12322                          155   5e-40   Oryza sativa Indica Group [Indian rice]
ref|XP_010054588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   5e-40   
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            155   5e-40   
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   5e-40   Elaeis guineensis
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       155   5e-40   Cucumis sativus [cucumbers]
ref|NP_001142368.1|  uncharacterized protein LOC100274540               154   5e-40   Zea mays [maize]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           154   6e-40   Nicotiana tabacum [American tobacco]
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   6e-40   Glycine max [soybeans]
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            154   6e-40   Glycine soja [wild soybean]
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             154   6e-40   
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   7e-40   Elaeis guineensis
emb|CDP04390.1|  unnamed protein product                                153   9e-40   Coffea canephora [robusta coffee]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   9e-40   Prunus mume [ume]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    154   1e-39   Populus euphratica
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    154   1e-39   Nicotiana sylvestris
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       154   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148084.1|  transparent testa 12 protein                       154   1e-39   Zea mays [maize]
gb|ACZ55931.1|  MATE transporter 2                                      153   2e-39   Zea mays [maize]
gb|ACZ55932.1|  MATE transporter 2                                      153   2e-39   Zea mays [maize]
ref|XP_003605914.1|  Transparent testa 12 protein                       153   2e-39   Medicago truncatula
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       153   2e-39   Zea mays [maize]
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            153   2e-39   Triticum urartu
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   3e-39   Zea mays [maize]
dbj|BAH20308.1|  AT1G61890                                              149   3e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   4e-39   Setaria italica
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   4e-39   Solanum tuberosum [potatoes]
emb|CBI23253.3|  unnamed protein product                                146   4e-39   Vitis vinifera
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             152   5e-39   Populus trichocarpa [western balsam poplar]
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   5e-39   Sesamum indicum [beniseed]
ref|XP_002886501.1|  mate efflux family protein                         152   6e-39   
emb|CDY47166.1|  BnaA01g22920D                                          152   7e-39   Brassica napus [oilseed rape]
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    152   7e-39   Solanum tuberosum [potatoes]
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   7e-39   Brassica rapa
emb|CDY71092.1|  BnaAnng36070D                                          143   7e-39   Brassica napus [oilseed rape]
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   7e-39   Nicotiana tomentosiformis
ref|XP_006389638.1|  MATE efflux family protein                         151   9e-39   
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         151   9e-39   Jatropha curcas
emb|CDY25329.1|  BnaC01g29980D                                          151   9e-39   Brassica napus [oilseed rape]
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   9e-39   Pyrus x bretschneideri [bai li]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    151   9e-39   Solanum tuberosum [potatoes]
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   9e-39   Solanum lycopersicum
emb|CBI23254.3|  unnamed protein product                                150   1e-38   Vitis vinifera
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   1e-38   Cicer arietinum [garbanzo]
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   1e-38   Brassica rapa
emb|CDX98711.1|  BnaA03g44960D                                          151   1e-38   
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    151   1e-38   Arabis alpina [alpine rockcress]
gb|KEH36840.1|  MATE efflux family protein                              151   1e-38   Medicago truncatula
gb|ABF97209.1|  MATE efflux family protein, expressed                   151   1e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            151   1e-38   
gb|EEC75606.1|  hypothetical protein OsI_12318                          151   1e-38   Oryza sativa Indica Group [Indian rice]
emb|CDY07257.1|  BnaC04g19140D                                          147   1e-38   
emb|CDX76391.1|  BnaA08g10090D                                          150   2e-38   
emb|CDP17486.1|  unnamed protein product                                150   2e-38   Coffea canephora [robusta coffee]
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   2e-38   Brassica rapa
ref|NP_564787.1|  MATE efflux family protein                            150   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            150   2e-38   Vitis vinifera
emb|CDX94061.1|  BnaC07g36950D                                          150   2e-38   
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       150   2e-38   Cucumis sativus [cucumbers]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    150   2e-38   Elaeis guineensis
emb|CAN82750.1|  hypothetical protein VITISV_014577                     149   2e-38   Vitis vinifera
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   2e-38   Brassica rapa
gb|AAK82541.1|  At1g61890/F8K4_9                                        150   3e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            150   3e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002867813.1|  mate efflux family protein                         150   3e-38   Arabidopsis lyrata subsp. lyrata
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   3e-38   Brassica rapa
emb|CDY12916.1|  BnaA09g13580D                                          150   3e-38   Brassica napus [oilseed rape]
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   3e-38   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    150   4e-38   Arabis alpina [alpine rockcress]
emb|CDY19507.1|  BnaC09g13960D                                          149   4e-38   Brassica napus [oilseed rape]
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   4e-38   Malus domestica [apple tree]
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             149   5e-38   Eutrema salsugineum [saltwater cress]
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             149   5e-38   
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   6e-38   
ref|XP_002518495.1|  multidrug resistance pump, putative                149   6e-38   Ricinus communis
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   6e-38   Prunus mume [ume]
gb|ACF85024.1|  unknown                                                 142   6e-38   Zea mays [maize]
gb|AFW68307.1|  putative MATE efflux family protein                     147   7e-38   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   7e-38   Camelina sativa [gold-of-pleasure]
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    149   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    149   9e-38   Pyrus x bretschneideri [bai li]
gb|AAM62936.1|  unknown                                                 148   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       149   1e-37   
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   1e-37   Fragaria vesca subsp. vesca
emb|CDY34833.1|  BnaA09g47590D                                          148   1e-37   Brassica napus [oilseed rape]
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    148   1e-37   Arabis alpina [alpine rockcress]
ref|NP_567640.1|  MATE efflux family protein                            148   1e-37   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH19969.1|  AT4G21910                                              148   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|NP_974587.1|  MATE efflux family protein                            148   1e-37   Arabidopsis thaliana [mouse-ear cress]
gb|ACF85423.1|  unknown                                                 148   1e-37   Zea mays [maize]
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       148   1e-37   Brassica rapa
emb|CBI23251.3|  unnamed protein product                                147   1e-37   Vitis vinifera
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    148   2e-37   Nicotiana tomentosiformis
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    147   2e-37   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            148   2e-37   Brassica rapa
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    148   2e-37   Populus euphratica
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             147   2e-37   Capsella rubella
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             147   2e-37   Capsella rubella
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            147   2e-37   Vitis vinifera
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   3e-37   Nicotiana sylvestris
emb|CDX94063.1|  BnaC07g36970D                                          147   3e-37   
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   3e-37   Vitis vinifera
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          147   3e-37   Sorghum bicolor [broomcorn]
emb|CDY27431.1|  BnaC03g64710D                                          147   3e-37   Brassica napus [oilseed rape]
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             147   4e-37   
emb|CDY27434.1|  BnaC03g64740D                                          147   4e-37   Brassica napus [oilseed rape]
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    147   4e-37   Brassica rapa
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       147   4e-37   Brassica rapa
ref|XP_011463308.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   4e-37   Fragaria vesca subsp. vesca
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    147   5e-37   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   6e-37   
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   6e-37   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   6e-37   
emb|CDY34637.1|  BnaC08g41960D                                          145   6e-37   Brassica napus [oilseed rape]
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    146   7e-37   Camelina sativa [gold-of-pleasure]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       146   8e-37   Brassica rapa
dbj|BAD95082.1|  hypothetical protein                                   140   8e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   1e-36   Prunus mume [ume]
emb|CDX98713.1|  BnaA03g44980D                                          145   1e-36   
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   1e-36   Brassica rapa
emb|CDX98712.1|  BnaA03g44970D                                          145   1e-36   
ref|XP_009137228.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   1e-36   
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   1e-36   Prunus mume [ume]
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   2e-36   Brassica rapa
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       145   2e-36   Fragaria vesca subsp. vesca
gb|AGT17221.1|  transparent testa 12 protein                            145   2e-36   Saccharum hybrid cultivar R570
emb|CDX79109.1|  BnaA01g11760D                                          145   2e-36   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             145   2e-36   Capsella rubella
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       144   2e-36   
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             144   3e-36   Eutrema salsugineum [saltwater cress]
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   3e-36   Brachypodium distachyon [annual false brome]
ref|XP_007026057.1|  MATE efflux family protein                         144   3e-36   
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    144   3e-36   Pyrus x bretschneideri [bai li]
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            144   3e-36   
ref|NP_001149176.1|  transparent testa 12 protein                       144   3e-36   Zea mays [maize]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               144   3e-36   
emb|CDY33129.1|  BnaCnng07000D                                          144   3e-36   Brassica napus [oilseed rape]
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             144   4e-36   Prunus persica
ref|XP_006449717.1|  hypothetical protein CICLE_v10014968mg             142   4e-36   
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             144   4e-36   Citrus clementina [clementine]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   4e-36   
gb|KGN43522.1|  Mate efflux family protein                              144   4e-36   Cucumis sativus [cucumbers]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   144   5e-36   Citrus sinensis [apfelsine]
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       144   5e-36   Citrus sinensis [apfelsine]
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       143   6e-36   Brassica rapa
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             143   8e-36   Citrus clementina [clementine]
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             143   8e-36   Eutrema salsugineum [saltwater cress]
emb|CDY64933.1|  BnaCnng45550D                                          143   8e-36   Brassica napus [oilseed rape]
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          143   9e-36   Sorghum bicolor [broomcorn]
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    143   1e-35   Sesamum indicum [beniseed]
dbj|BAJ90668.1|  predicted protein                                      143   1e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             143   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    143   1e-35   Citrus sinensis [apfelsine]
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   1e-35   Brachypodium distachyon [annual false brome]
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   1e-35   Brassica rapa
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    142   1e-35   Pyrus x bretschneideri [bai li]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   2e-35   Populus euphratica
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                142   2e-35   Erythranthe guttata [common monkey flower]
gb|KDO78209.1|  hypothetical protein CISIN_1g010561mg                   140   2e-35   Citrus sinensis [apfelsine]
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    142   3e-35   Arabis alpina [alpine rockcress]
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   3e-35   Setaria italica
gb|EMT14886.1|  Protein TRANSPARENT TESTA 12                            140   3e-35   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   3e-35   Camelina sativa [gold-of-pleasure]
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   4e-35   Populus euphratica
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    141   4e-35   Camelina sativa [gold-of-pleasure]
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   141   4e-35   Citrus sinensis [apfelsine]
ref|NP_001119025.1|  mate efflux domain-containing protein              141   4e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39494.1|  BnaA01g24940D                                          141   4e-35   Brassica napus [oilseed rape]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             140   6e-35   Populus trichocarpa [western balsam poplar]
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   7e-35   Pyrus x bretschneideri [bai li]
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   8e-35   Eucalyptus grandis [rose gum]
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   8e-35   
emb|CAN69304.1|  hypothetical protein VITISV_021604                     142   1e-34   Vitis vinifera
gb|EEE67272.1|  hypothetical protein OsJ_24453                          139   1e-34   
ref|NP_001059785.1|  Os07g0516600                                       140   1e-34   
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    140   1e-34   
gb|EEC82143.1|  hypothetical protein OsI_26198                          139   1e-34   
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             139   1e-34   
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    139   1e-34   
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    139   2e-34   
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    139   2e-34   
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    139   2e-34   
ref|XP_002867814.1|  mate efflux family protein                         139   2e-34   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   2e-34   
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   3e-34   
emb|CDY19294.1|  BnaC01g31860D                                          139   3e-34   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             139   3e-34   
emb|CDY24252.1|  BnaC03g42250D                                          133   3e-34   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   4e-34   
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    138   4e-34   
gb|AGT17223.1|  MATE efflux family protein                              138   4e-34   
ref|NP_172632.1|  MATE efflux family protein                            138   4e-34   
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       138   5e-34   
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       137   6e-34   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      137   6e-34   
ref|XP_002518493.1|  multidrug resistance pump, putative                137   7e-34   
ref|XP_008364803.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       134   7e-34   
emb|CDY38631.1|  BnaA05g19560D                                          137   8e-34   
ref|XP_002892653.1|  mate efflux family protein                         137   1e-33   
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             137   2e-33   
emb|CDY33131.1|  BnaCnng07020D                                          130   2e-33   
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       136   2e-33   
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       136   2e-33   
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    136   2e-33   
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            136   2e-33   
ref|XP_004158053.1|  PREDICTED: LOW QUALITY PROTEIN: polygalactur...    140   3e-33   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   3e-33   
gb|AAM98160.1|  unknown protein                                         135   3e-33   
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    135   3e-33   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   4e-33   
emb|CDM85992.1|  unnamed protein product                                135   4e-33   
emb|CDY39493.1|  BnaA01g24950D                                          135   5e-33   
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       134   2e-32   
emb|CDX92916.1|  BnaA03g36380D                                          134   2e-32   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     133   2e-32   
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    133   2e-32   
emb|CDY65669.1|  BnaCnng48120D                                          133   3e-32   
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                132   4e-32   
gb|ABF97208.1|  MATE efflux family protein, expressed                   130   5e-32   
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                132   5e-32   
ref|NP_001050521.1|  Os03g0571700                                       130   6e-32   
gb|AAS01962.1|  putative MATE efflux family protein                     132   6e-32   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             132   8e-32   
gb|EEE59383.1|  hypothetical protein OsJ_11499                          131   8e-32   
ref|XP_008342112.1|  PREDICTED: MATE efflux family protein ALF5-like    126   9e-32   
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       131   9e-32   
gb|ADE77677.1|  unknown                                                 131   1e-31   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    131   1e-31   
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                131   1e-31   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       131   1e-31   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         134   1e-31   
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   2e-31   
emb|CDX94064.1|  BnaC07g36980D                                          130   2e-31   
emb|CBI28940.3|  unnamed protein product                                122   2e-31   
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   2e-31   
gb|ABF97220.1|  MATE efflux family protein, expressed                   130   2e-31   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             130   3e-31   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       130   3e-31   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       129   6e-31   
gb|EPS59093.1|  hypothetical protein M569_15717                         124   6e-31   
gb|EPS67796.1|  hypothetical protein M569_06975                         129   7e-31   
ref|XP_004174037.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   9e-31   
ref|NP_001190793.1|  MATE efflux family protein                         129   1e-30   
ref|XP_010451295.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       128   1e-30   
emb|CDP20703.1|  unnamed protein product                                127   3e-30   
ref|XP_004144587.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   8e-30   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          125   1e-29   
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       125   1e-29   
gb|EMT02572.1|  Protein TRANSPARENT TESTA 12                            127   1e-29   
gb|ABK24492.1|  unknown                                                 125   2e-29   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            126   3e-29   
emb|CDP04391.1|  unnamed protein product                                125   3e-29   
ref|NP_001190792.1|  mate efflux domain-containing protein              124   5e-29   
gb|AGT17222.1|  MATE efflux family protein                              124   6e-29   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            123   7e-29   
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       123   8e-29   
emb|CAA17157.1|  putative protein                                       125   1e-28   
gb|EEC68782.1|  hypothetical protein OsI_37323                          118   1e-28   
ref|NP_001065641.2|  Os11g0129000                                       117   1e-28   
ref|XP_004982539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    119   9e-28   
ref|XP_004982538.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    119   1e-27   
gb|EEC68785.1|  hypothetical protein OsI_37326                          119   1e-27   
ref|NP_001066047.1|  Os12g0126000                                       119   2e-27   
gb|EEE51571.1|  hypothetical protein OsJ_32800                          117   3e-27   
ref|NP_001176328.1|  Os11g0128900                                       117   6e-27   
ref|NP_001176768.1|  Os12g0125800                                       115   8e-27   
emb|CDY19296.1|  BnaC01g31840D                                          112   1e-26   
gb|EEC68781.1|  hypothetical protein OsI_37322                          117   1e-26   
gb|ABA91295.1|  MATE efflux family protein, expressed                   117   1e-26   
ref|NP_001141051.1|  putative MATE efflux family protein                116   3e-26   
ref|XP_003578998.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   3e-26   
ref|NP_001065623.1|  Os11g0126100                                       115   5e-26   
ref|XP_006663775.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   7e-26   
gb|KCW66473.1|  hypothetical protein EUGRSUZ_F00275                     110   1e-25   
ref|XP_009365296.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   1e-25   
ref|XP_010931488.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   2e-25   
ref|XP_003575793.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-25   
gb|EEE51569.1|  hypothetical protein OsJ_32798                          112   4e-25   
gb|ABR16195.1|  unknown                                                 112   4e-25   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               112   5e-25   
gb|EEC73528.1|  hypothetical protein OsI_07920                          112   6e-25   
ref|XP_002272578.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   7e-25   
ref|XP_002450192.1|  hypothetical protein SORBIDRAFT_05g001760          112   7e-25   
ref|XP_004977438.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    112   7e-25   
ref|XP_002441747.1|  hypothetical protein SORBIDRAFT_08g001710          112   8e-25   
emb|CBI31189.3|  unnamed protein product                                112   8e-25   
gb|EMS64531.1|  Protein TRANSPARENT TESTA 12                            111   1e-24   
emb|CAN63841.1|  hypothetical protein VITISV_021179                     110   1e-24   
ref|XP_010064192.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   1e-24   
ref|XP_002267053.2|  PREDICTED: protein TRANSPARENT TESTA 12            111   2e-24   
ref|XP_010269383.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   3e-24   
ref|XP_006437275.1|  hypothetical protein CICLE_v10032747mg             106   3e-24   
emb|CAN77557.1|  hypothetical protein VITISV_033224                     110   3e-24   
gb|EMS45672.1|  Protein TRANSPARENT TESTA 12                            111   4e-24   
dbj|BAJ90744.1|  predicted protein                                      110   5e-24   
ref|XP_006437283.1|  hypothetical protein CICLE_v10032663mg             106   5e-24   
gb|ACG27773.1|  transparent testa 12 protein                            110   5e-24   
ref|XP_010060175.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   6e-24   
ref|XP_008386910.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    108   6e-24   
gb|AFW55870.1|  putative MATE efflux family protein                     108   8e-24   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       109   9e-24   
emb|CBI31190.3|  unnamed protein product                                108   9e-24   
ref|XP_002530955.1|  multidrug resistance pump, putative                108   9e-24   
ref|XP_004489770.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
gb|ACF87410.1|  unknown                                                 108   1e-23   
ref|XP_011079018.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
ref|XP_008350142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   1e-23   
gb|KCW66477.1|  hypothetical protein EUGRSUZ_F00278                     108   1e-23   
ref|XP_008386909.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    108   1e-23   
dbj|BAJ95959.1|  predicted protein                                      108   1e-23   
gb|EMS64530.1|  Protein TRANSPARENT TESTA 12                            109   2e-23   
gb|AAN64140.1|  Putative ripening regulated protein                     107   2e-23   
ref|NP_001130797.1|  putative MATE efflux family protein                108   2e-23   
ref|XP_003613128.1|  Protein TRANSPARENT TESTA                          108   2e-23   
emb|CDY01227.1|  BnaC05g25050D                                          102   3e-23   
ref|XP_010922926.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   3e-23   
ref|XP_011086621.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       108   3e-23   
gb|EMS63313.1|  Protein TRANSPARENT TESTA 12                            108   3e-23   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          107   4e-23   
ref|XP_006852301.1|  hypothetical protein AMTR_s00049p00190450          103   4e-23   
gb|EEC74654.1|  hypothetical protein OsI_10313                          107   4e-23   
ref|XP_009410462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       107   5e-23   
gb|KCW66759.1|  hypothetical protein EUGRSUZ_F00509                     106   5e-23   
ref|XP_003624784.1|  Protein TRANSPARENT TESTA                          105   6e-23   
ref|XP_006349556.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   6e-23   
ref|XP_002460370.1|  hypothetical protein SORBIDRAFT_02g027130          106   6e-23   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   7e-23   
ref|XP_011086623.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   8e-23   
gb|KJB26655.1|  hypothetical protein B456_004G253200                    105   9e-23   
gb|KJB80754.1|  hypothetical protein B456_013G114200                    106   9e-23   
ref|XP_008807331.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   1e-22   
gb|KCW66747.1|  hypothetical protein EUGRSUZ_F00501                     105   1e-22   
ref|XP_010064252.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   1e-22   
ref|XP_008792470.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   1e-22   
ref|XP_006827534.1|  hypothetical protein AMTR_s00009p00209720          102   1e-22   
ref|XP_009413656.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   1e-22   
ref|XP_011086620.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       106   1e-22   
gb|KJB57729.1|  hypothetical protein B456_009G178100                    104   1e-22   
gb|KDO86235.1|  hypothetical protein CISIN_1g015884mg                   104   2e-22   
ref|XP_003613101.1|  Protein TRANSPARENT TESTA                          105   2e-22   
gb|AFK46935.1|  unknown                                                 105   2e-22   
gb|KJB26650.1|  hypothetical protein B456_004G253200                    105   2e-22   
ref|XP_010060170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   2e-22   
ref|XP_011013211.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   2e-22   
ref|XP_008240632.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   2e-22   
ref|XP_009122060.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       105   2e-22   
ref|XP_006375947.1|  hypothetical protein POPTR_0013s06650g             104   2e-22   
ref|XP_009628061.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   2e-22   
emb|CDP13215.1|  unnamed protein product                                105   2e-22   
gb|KHG22339.1|  Protein TRANSPARENT TESTA 12 -like protein              105   3e-22   
emb|CDY68535.1|  BnaCnng59430D                                          100   3e-22   
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    104   3e-22   
ref|XP_006852295.1|  hypothetical protein AMTR_s00049p00187620        99.8    3e-22   
ref|XP_006828412.1|  hypothetical protein AMTR_s00060p00075340          104   3e-22   
ref|XP_004489662.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   3e-22   
ref|XP_008240646.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   3e-22   
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    104   3e-22   
gb|KJB31160.1|  hypothetical protein B456_005G179100                    105   3e-22   
ref|XP_006856151.1|  hypothetical protein AMTR_s00059p00169290          103   4e-22   
ref|XP_007044786.1|  MATE efflux family protein isoform 3               103   4e-22   
ref|XP_009594771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   4e-22   
ref|XP_007044784.1|  MATE efflux family protein isoform 1               103   4e-22   
ref|XP_002319744.1|  MATE efflux family protein                         104   4e-22   
ref|XP_006491465.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   4e-22   
gb|KDP39623.1|  hypothetical protein JCGZ_02643                         104   4e-22   
ref|XP_004249274.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   5e-22   
ref|XP_007051759.1|  MATE efflux family protein                         104   5e-22   
gb|KHG29776.1|  Protein TRANSPARENT TESTA 12 -like protein              104   5e-22   
emb|CDX78379.1|  BnaA03g02910D                                          103   5e-22   
ref|XP_007203372.1|  hypothetical protein PRUPE_ppa020699mg             103   5e-22   
ref|XP_004957085.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   5e-22   
ref|XP_008367310.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   6e-22   
ref|XP_011026194.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       104   6e-22   
gb|KHN42167.1|  Protein TRANSPARENT TESTA 12                            103   6e-22   
gb|AHI48503.1|  multidrug and toxic extrusion transporter               104   6e-22   
ref|XP_009131157.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   6e-22   
ref|XP_007044785.1|  MATE efflux family protein isoform 2               103   6e-22   
gb|KFK30626.1|  hypothetical protein AALP_AA6G006400                    104   7e-22   
ref|XP_004985412.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    103   7e-22   
ref|XP_003520899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   8e-22   
ref|XP_010556333.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   8e-22   
gb|AAZ66942.1|  117M18_23                                               103   8e-22   
ref|XP_007203855.1|  hypothetical protein PRUPE_ppa004706mg             103   9e-22   
ref|XP_002468362.1|  hypothetical protein SORBIDRAFT_01g044660          103   9e-22   
gb|KHN34614.1|  Protein TRANSPARENT TESTA 12                            102   9e-22   
ref|XP_010317921.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    103   9e-22   
ref|XP_009353042.1|  PREDICTED: protein TRANSPARENT TESTA 12 isof...    103   9e-22   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...    103   9e-22   
ref|XP_003554068.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-21   
emb|CDX81176.1|  BnaC03g04300D                                          103   1e-21   
gb|KHN00401.1|  Protein TRANSPARENT TESTA 12                            103   1e-21   
ref|XP_003519833.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-21   
ref|XP_010905904.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-21   
ref|XP_008391733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       103   1e-21   



>gb|KJB30572.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
 gb|KJB30573.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=396

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY VGVP+G
Sbjct  276  FTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYYFVGVPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  336  SLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  395



>gb|KDO54649.1| hypothetical protein CISIN_1g0100252mg, partial [Citrus sinensis]
Length=168

 Score =   166 bits (420),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG
Sbjct  48   FTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG  107

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  108  SLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  167



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA+AVSDLCP LALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY VGVP+G
Sbjct  385  FTEGEVVAEAVSDLCPFLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYYFVGVPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W+ K EPLL
Sbjct  445  SLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWEVKEEPLL  504



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 112/121 (93%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA+AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY VGVP+G
Sbjct  385  FTEGEVVAEAVSDLCPLLALTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYYFVGVPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPL  394
            ++LGFYFNLGAKGIW GMIGGTVMQT++L+WVT RTDW KEVE A+KR++ W  K+ EPL
Sbjct  445  SLLGFYFNLGAKGIWSGMIGGTVMQTLVLIWVTFRTDWKKEVEEARKRMDAWQVKKEEPL  504

Query  393  L  391
            L
Sbjct  505  L  505



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  395  FTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  454

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  455  CLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  514



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   168 bits (426),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VADAVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  394  FTDGEAVADAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F LGAKGIW GMIGGT+MQTI+LLWVT RTDW KEVE A+KRL++W+ K+EPLL
Sbjct  454  CLLGFKFGLGAKGIWSGMIGGTLMQTIVLLWVTFRTDWNKEVETARKRLDKWEDKKEPLL  513



>ref|XP_006375528.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
 gb|ERP53325.1| hypothetical protein POPTR_0014s15130g, partial [Populus trichocarpa]
Length=194

 Score =   160 bits (406),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  74   FTGGETVAKAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  133

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++ GFYFNLGAKGIW GMI G V+QT+ILLWVTIRTDW KEV+ A KRL  W+ K EPL+
Sbjct  134  SLFGFYFNLGAKGIWSGMIAGIVLQTVILLWVTIRTDWNKEVQEALKRLETWEGKEEPLV  193



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   168 bits (425),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGEVVA AVSDLCPLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY++GVP G
Sbjct  366  FTDGEVVARAVSDLCPLLATTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIIGVPFG  425

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGF F LGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE AKKRLN+W+ K+EPLL
Sbjct  426  SLLGFKFGLGAKGIWGGMIGGTFMQTLILLWVTFRTDWNKEVEEAKKRLNKWEDKKEPLL  485



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   168 bits (425),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 111/120 (93%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG
Sbjct  400  FTGGEAVAAAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVVGVPVG  459

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYFNLGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV+ A KRL++W+ K++PLL
Sbjct  460  SLLGFYFNLGAKGIWSGMIGGTVMQTLILIWVTFRTDWNKEVQEALKRLDRWEDKKKPLL  519



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/122 (80%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA+AVSDLCPLLALTL LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVP+G
Sbjct  382  FTGGEVVAEAVSDLCPLLALTLALNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPLG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGFYF LGAKGIW GM+GGTVMQT+IL+W+TIRTDW KEVE A+ RLN+W  K+EP L
Sbjct  442  ALLGFYFKLGAKGIWLGMMGGTVMQTVILIWITIRTDWNKEVEAAQGRLNKWGDKKEPEL  501

Query  390  PK  385
             +
Sbjct  502  KE  503



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQTFVAYVN+GCYY+VGVP+G
Sbjct  391  FTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQTFVAYVNIGCYYIVGVPLG  450

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD K+E +L
Sbjct  451  ALLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVEAAQSRLKKWDDKKESIL  510

Query  390  PK  385
             +
Sbjct  511  EE  512



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G
Sbjct  372  FTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLG  431

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF+FNLGAKGIW G+IGGT +QT ILLWVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  432  VVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTMRTDWTKEVEEAQKRLNKWDEKKEPLL  491



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA+AVSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  384  FTGGEVVAEAVSDLCPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE A+KRL  W+ K+EPLL
Sbjct  444  SLLGFYFKLGAKGIWSGMIGGTAMQTLILVWVTFRTDWKKEVEEARKRLVTWEDKKEPLL  503



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   166 bits (421),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G
Sbjct  374  FTDGEAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLG  433

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  434  VVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWSKEVEEAQKRLNKWDEKKQPLL  493



>gb|EMT26282.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=402

 Score =   164 bits (416),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G
Sbjct  276  FTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+W  K+EPLL
Sbjct  336  VVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWSEKKEPLL  395



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   166 bits (419),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 111/121 (92%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVADAVSDL PLLALTLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  379  FTEGEVVADAVSDLAPLLALTLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLVGIPLG  438

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
            ++LGFYF LGAKG+W GM+GGT MQTIILLWVTIRTDW KEVEVA KRL++W D K+E L
Sbjct  439  SLLGFYFQLGAKGLWSGMLGGTTMQTIILLWVTIRTDWNKEVEVALKRLDKWEDQKKEAL  498

Query  393  L  391
            L
Sbjct  499  L  499



>gb|EMT13258.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=570

 Score =   166 bits (421),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDG+ V+DAV+DLCPLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G
Sbjct  443  FTDGKAVSDAVADLCPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLG  502

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD K+EPLL
Sbjct  503  VVLGFFFNLGAKGIWGGLIGGTALQTAILLWVTIRTDWTKEVEEAQKRLNKWDEKKEPLL  562



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   165 bits (418),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 98/120 (82%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCPLLAL+LVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  384  FTGGEEVAAAVSDLCPLLALSLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            AVLGFYF  GAKGIW GM+GGTVMQTIILLWVT RTDW KEVE A KRL +W+ K+EPLL
Sbjct  444  AVLGFYFQFGAKGIWLGMLGGTVMQTIILLWVTFRTDWTKEVEEAAKRLTKWEDKKEPLL  503



>gb|EMS67482.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=437

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+DAV+DLCP LA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G
Sbjct  311  FTDGEAVSDAVADLCPFLAVTLVLGGIQPVLTGVAVGCGWQKFVAYVNVGSYYIVGVPLG  370

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRT+W +EVE A+KRLN+WD K+EPLL
Sbjct  371  VVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTNWTEEVEEAQKRLNKWDEKKEPLL  430



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   165 bits (417),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA+AVSDLCPLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  391  FTEGEVVAEAVSDLCPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNIGCYYIVGVPLG  450

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL  WD K+E +L
Sbjct  451  VLLGFYFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQSRLKMWDDKKESIL  510

Query  390  PK  385
             +
Sbjct  511  EE  512



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA AVSDLCPLL+L+LVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  386  FTEGEVVAAAVSDLCPLLSLSLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
            AVLGFYFN GAKGIW GM+GGT MQTIIL+WVT RTDW KEV+ A KRLN+W + K+EPL
Sbjct  446  AVLGFYFNFGAKGIWLGMLGGTTMQTIILMWVTFRTDWNKEVKEAAKRLNKWEEKKKEPL  505

Query  393  L  391
            L
Sbjct  506  L  506



>ref|XP_011005125.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=401

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  281  FTDGETVAQAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQGFVAYVNVGCYYVVGIPLG  340

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++ GFYFNLGAKGIW GMIGG V++T+ILLWVT RTDW KEV+ A KRL  W+ K+EPL+
Sbjct  341  SLFGFYFNLGAKGIWSGMIGGVVLRTVILLWVTCRTDWNKEVQEALKRLETWEGKKEPLV  400



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLL+L+++LNG+QPVLSGVAVGCGWQ FVAYVNV CYY VG+P+G
Sbjct  386  FTEGETVAAAVSDLCPLLSLSILLNGIQPVLSGVAVGCGWQAFVAYVNVACYYGVGIPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            AVLGFYF  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD K+EPLL
Sbjct  446  AVLGFYFQFGAKGIWLGMLGGTTMQTIILIWVTFRTDWNKEVEESAKRLNKWDDKKEPLL  505



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 109/121 (90%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP G
Sbjct  400  FTEGETVARAVSDLCPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPFG  459

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPL  394
            ++LGF F LGAKGIW GMIGGT+MQT+IL+WVT RTDW KEVE AKKRLN+WD K+ EPL
Sbjct  460  SLLGFKFGLGAKGIWGGMIGGTIMQTLILMWVTFRTDWNKEVEEAKKRLNKWDGKKEEPL  519

Query  393  L  391
            L
Sbjct  520  L  520



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY++GVP+G
Sbjct  373  FTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIIGVPLG  432

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FNLG KGIW GM+GGT MQT IL+WVT+RTDW KEVE A+KRLN+WD K+EPLL
Sbjct  433  VLLGFVFNLGVKGIWGGMLGGTCMQTAILVWVTLRTDWKKEVEEAQKRLNKWDDKKEPLL  492



>ref|XP_010488189.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=188

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+G
Sbjct  67   FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLG  126

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W  K++ L+
Sbjct  127  ALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWSDKKQELV  186

Query  390  PK  385
             +
Sbjct  187  RE  188



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 110/120 (92%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQTFVAYVNVGCYYVVG+P+G
Sbjct  401  FTEGETVAEAVSELCPFLAVTLILNGVQPVLSGVAVGCGWQTFVAYVNVGCYYVVGIPLG  460

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF ++LGAKGIW GMIGGT+MQT+ILLWVT RTDW KEVE AKKRL++W+ KRE LL
Sbjct  461  CLLGFIYHLGAKGIWSGMIGGTLMQTLILLWVTFRTDWNKEVETAKKRLDKWEDKRETLL  520



>emb|CDM86680.1| unnamed protein product [Triticum aestivum]
Length=403

 Score =   161 bits (408),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  276  FTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W D K++PL
Sbjct  336  IVLGFVFNLGVKGIWSGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPL  395

Query  393  L  391
            L
Sbjct  396  L  396



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY+VG+P+G
Sbjct  399  FTEGETVAHAVSELTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVACYYIVGIPLG  458

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FNLGAKGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRLN+W+ K++PLL
Sbjct  459  VLLGFKFNLGAKGIWSGMIGGTFMQTLILLWVTFRTDWNKEVEQAIKRLNKWEGKKQPLL  518



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G
Sbjct  397  FTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLG  456

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  457  SVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G
Sbjct  397  FTDGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLG  456

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +VLGFYF L AKGIW GM+GGTV+QTIIL+WVT RTDW  EVE A KRLN+W+ K EPL+
Sbjct  457  SVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFRTDWNNEVEEAAKRLNKWENKTEPLV  516



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   162 bits (411),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+DAV+DL PLLA+TLVL G+QPVL+GVAVGCGWQ FVAYVNVG YY+VGVP+G
Sbjct  372  FTNGEAVSDAVADLSPLLAITLVLGGIQPVLTGVAVGCGWQQFVAYVNVGSYYIVGVPLG  431

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF+FNLGAKGIW G+IGGT +QT ILLWVTIRTDW KEVE A+KRLN+WD K++PLL
Sbjct  432  VVLGFFFNLGAKGIWGGLIGGTALQTTILLWVTIRTDWTKEVEEAQKRLNKWDEKKQPLL  491



>gb|EMS63520.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=403

 Score =   161 bits (407),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  276  FTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W D K++PL
Sbjct  336  IVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPL  395

Query  393  L  391
            L
Sbjct  396  L  396



>gb|EMT13254.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=403

 Score =   160 bits (406),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+ E+V+DAV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  276  FTESEIVSDAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             VLGF FNLG KGIW GMIGGT MQT ILLWVTIRTDW KEVE A KRLN+W D K++PL
Sbjct  336  IVLGFVFNLGVKGIWGGMIGGTTMQTAILLWVTIRTDWSKEVEEAHKRLNKWDDTKKQPL  395

Query  393  L  391
            L
Sbjct  396  L  396



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   162 bits (411),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA+AVSDLCPLL++TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G
Sbjct  391  FTSGEAVANAVSDLCPLLSITLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYILGIPLG  450

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGF F+LGAKGIW GMIGGT+MQT+ILLWVT RT+W KEVE A KRLN+W+ K EPLL
Sbjct  451  ALLGFKFDLGAKGIWSGMIGGTMMQTLILLWVTYRTNWNKEVEEATKRLNKWEDKPEPLL  510



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+ AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY VGVP+G
Sbjct  373  FTDGETVSRAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKTVAYINVGCYYFVGVPLG  432

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQWD K++PLL
Sbjct  433  FLLGFKFHLGAKGIWSGMLGGTCMQTLILFWITFRTDWNKEVEQAKKRLNQWDDKKQPLL  492

Query  390  PKT  382
              T
Sbjct  493  AST  495



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  387  FTEGEVVATAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGLPLG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF+ GAKGIW GM+GGT MQT+IL+WVT RTDW KEVE A KRL+ W+ K+EP+L
Sbjct  447  SLLGFYFDFGAKGIWLGMLGGTAMQTVILIWVTFRTDWNKEVEEAAKRLSIWEDKKEPVL  506



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVP+G
Sbjct  392  FTGGEVVAQAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPLG  451

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD K+E +L
Sbjct  452  ALLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWDDKKESIL  511

Query  390  PK  385
             +
Sbjct  512  EE  513



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  385  FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++ ++
Sbjct  445  ALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVV  504

Query  390  PK  385
            P+
Sbjct  505  PE  506



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   162 bits (409),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  385  FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++ ++
Sbjct  445  ALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVV  504

Query  390  PK  385
            P+
Sbjct  505  PE  506



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  398  FTEGETVAKAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  457

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE AKKRL++W+ K+EPLL
Sbjct  458  CVLGFKFGLGAKGIWSGMIGGTLMQTVILLWVTFTTDWNKEVETAKKRLDRWEDKKEPLL  517



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  385  FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYFN GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++ ++
Sbjct  445  ALFGFYFNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQEVV  504

Query  390  PK  385
            P+
Sbjct  505  PE  506



>emb|CAN73203.1| hypothetical protein VITISV_008169 [Vitis vinifera]
Length=265

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  144  FTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLG  203

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R  +WD K++PLL
Sbjct  204  SLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERXEKWDDKKQPLL  263



>emb|CDP11781.1| unnamed protein product [Coffea canephora]
Length=427

 Score =   160 bits (405),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 91/117 (78%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVADAVSDL PLLA+T+VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  311  FTEGEVVADAVSDLSPLLAVTVVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLVGIPLG  370

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            +VLGFYF LGAKG+W GM+GGT+MQTIILLWVTIRTDW+KEVE A +RL++W+  ++
Sbjct  371  SVLGFYFQLGAKGLWSGMLGGTIMQTIILLWVTIRTDWIKEVEAALRRLDKWEVLKD  427



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA AVSDLCPLLA++L+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VGVPVG
Sbjct  392  FTGGEVVAAAVSDLCPLLAISLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGVPVG  451

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF+F LGAKGIW GM+GGTVMQTIIL+W+T RTDW KEVE A+ RL +WD K+E +L
Sbjct  452  VLLGFHFKLGAKGIWSGMLGGTVMQTIILIWITARTDWNKEVESAQYRLKKWDDKKEAIL  511

Query  390  PK  385
             +
Sbjct  512  EE  513



>ref|XP_006406244.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
 gb|ESQ47697.1| hypothetical protein EUTSA_v10020869mg [Eutrema salsugineum]
Length=397

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY +G+P+G
Sbjct  276  FTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYFIGIPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
            A+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ W  K+
Sbjct  336  ALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDIWSNKK  391



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDG VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  389  FTDGPVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  448

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            A+LGFYF LGAKGIW GMIGGT MQT+IL+WVT RTDW KEVE + KRLN+WD K+E
Sbjct  449  ALLGFYFKLGAKGIWVGMIGGTFMQTVILIWVTYRTDWNKEVEESMKRLNKWDDKQE  505



>ref|XP_010233179.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brachypodium 
distachyon]
Length=402

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYYVVGVP+G
Sbjct  276  FTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQQFVAYVNIGCYYVVGVPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  336  LVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  395



>gb|ACL53378.1| unknown [Zea mays]
 tpg|DAA40988.1| TPA: LOW QUALITY PROTEIN: putative MATE efflux family protein 
[Zea mays]
Length=462

 Score =   160 bits (406),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G
Sbjct  341  FTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPLG  400

Query  570  aVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
              LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++WD K++PL
Sbjct  401  VFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKWDDKKQPL  460

Query  393  L  391
            L
Sbjct  461  L  461



>ref|XP_008670448.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Zea mays]
 gb|ACL54543.1| unknown [Zea mays]
Length=512

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G
Sbjct  391  FTGGEAVARAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPLG  450

Query  570  aVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
              LGFY +LGAKGIW GM IGGT+MQT+ILLWVT RTDW KEVE A+ RL++WD K++PL
Sbjct  451  VFLGFYLDLGAKGIWSGMVIGGTMMQTLILLWVTFRTDWTKEVENARARLDKWDDKKQPL  510

Query  393  L  391
            L
Sbjct  511  L  511



>gb|AAR00628.1| putative MATE family protein [Oryza sativa Japonica Group]
 gb|EEE59381.1| hypothetical protein OsJ_11497 [Oryza sativa Japonica Group]
Length=401

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY VG+P+G
Sbjct  276  FTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYYFVGIPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+ K++PLL
Sbjct  336  FLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLL  395

Query  390  PKT  382
              T
Sbjct  396  AGT  398



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+G
Sbjct  385  FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W  K++ ++
Sbjct  445  ALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVV  504

Query  390  PK  385
            P+
Sbjct  505  PE  506



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   160 bits (405),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE+V++AV+DLCPLLA TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYYVVGVP+G
Sbjct  368  FTEGEIVSNAVADLCPLLATTLILNGIQPVLTGVAVGCGWQQFVAYVNIGCYYVVGVPLG  427

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F LG KGIW GMIGGTVMQT+ILLWVTIRTDW KEVE A+KRL++W+  +EPLL
Sbjct  428  LVLGFVFKLGVKGIWGGMIGGTVMQTVILLWVTIRTDWNKEVEEAQKRLSKWEGSKEPLL  487



>dbj|BAM34459.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana alata]
 dbj|BAM34460.1| multidrug and toxic compound extrusion-type transporter, partial 
[Nicotiana langsdorffii]
Length=164

 Score =   152 bits (384),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/113 (81%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY VG+PVG
Sbjct  50   FTEGEVVAKEVSELCPYLAVTLILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYGVGIPVG  109

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEVE AKKRL++W+
Sbjct  110  CLLGFKFDLGAKGIWTGMIGGTMMQTIILLWVTFRTDWNKEVESAKKRLDKWE  162



>emb|CBI28938.3| unnamed protein product [Vitis vinifera]
Length=434

 Score =   159 bits (403),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  313  FTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLG  372

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  373  SLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  432



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY +G+P+G
Sbjct  384  FTDGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYFIGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
            A+LGFYFN GAKGIW GMIGGT++QT+IL WVT RTDWVKEVE A KRL+ W  K+
Sbjct  444  ALLGFYFNFGAKGIWTGMIGGTLIQTVILAWVTFRTDWVKEVEEASKRLDIWSNKK  499



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+DAV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  368  FTEGERVSDAVADLCPLLAITIILNGIQPVLSGVAVGCGWQQFVAYVNVGCYYIVGVPLG  427

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRLN+W D K+EPL
Sbjct  428  VLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKKEPL  487

Query  393  L  391
            L
Sbjct  488  L  488



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVSDLCPLLAL+++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G
Sbjct  396  FTDGEEVAAAVSDLCPLLALSIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLG  455

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            +VLGFYF L AKGIW GM+GGTV+QTIIL+WVT  TDW KEVE A KRLN+W+ K EPL+
Sbjct  456  SVLGFYFKLSAKGIWLGMLGGTVLQTIILVWVTFGTDWNKEVEEAAKRLNKWEDKTEPLV  515



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  386  FTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+RL +WD K++PLL
Sbjct  446  SLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERLEKWDDKKQPLL  505



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/121 (79%), Positives = 110/121 (91%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVGVP+G
Sbjct  372  FTEGEVVSNAVADLCPLLAITIILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYVVGVPLG  431

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
            A+LGF F LG KGIW GMIGGTVMQT ILLWVT+RTDW KEVE A+KRLN+W D K EPL
Sbjct  432  ALLGFVFKLGVKGIWGGMIGGTVMQTAILLWVTLRTDWSKEVEEAQKRLNKWEDKKTEPL  491

Query  393  L  391
            L
Sbjct  492  L  492



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  386  FTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LGAKGIW GM+GGT+MQT IL+WVT RT+W KEVE AK+R+ +WD K++PLL
Sbjct  446  SLLGFYFKLGAKGIWLGMLGGTLMQTFILIWVTARTNWNKEVEKAKERMEKWDDKKQPLL  505



>ref|NP_001050520.1| Os03g0570800 [Oryza sativa Japonica Group]
 gb|ABF97202.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12434.1| Os03g0570800 [Oryza sativa Japonica Group]
 dbj|BAG95165.1| unnamed protein product [Oryza sativa Japonica Group]
Length=500

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY VG+P+G
Sbjct  375  FTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYYFVGIPLG  434

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+ K++PLL
Sbjct  435  FLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLL  494

Query  390  PKT  382
              T
Sbjct  495  AGT  497



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  386  FTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  446  SLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  505



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA A SDL P LA TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G
Sbjct  378  FTEGEVVAKAASDLSPFLAATLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYLLGIPLG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN WD KR+P L
Sbjct  438  VLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWDKEVENAKNRLNTWDDKRQPPL  497

Query  390  PK  385
            P+
Sbjct  498  PE  499



>gb|EEC75604.1| hypothetical protein OsI_12313 [Oryza sativa Indica Group]
Length=500

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY VG+P+G
Sbjct  375  FTEGETVARAVSDLCPFLAATLILNGIQPVLSGVAVGCGWQKIVAYINVGCYYFVGIPLG  434

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE AKKRLNQW+ K++PLL
Sbjct  435  FLLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWNKEVEEAKKRLNQWEDKKQPLL  494

Query  390  PKT  382
              T
Sbjct  495  AGT  497



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY++GVPVG
Sbjct  378  FTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPVG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ WD KR+PLL
Sbjct  438  VLLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWDEKRQPLL  497



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+G
Sbjct  385  FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFY+N GAKGIW GMIGGT+ QT IL WVT RTDW KEVE A KR+++W  K++ ++
Sbjct  445  ALFGFYYNFGAKGIWTGMIGGTITQTFILAWVTFRTDWTKEVEEASKRMDKWSNKKQEVV  504

Query  390  PK  385
            P+
Sbjct  505  PE  506



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY+VGVP+G
Sbjct  400  FTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVACYYIVGVPLG  459

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGF FNLGAKGIW GMIGGT+MQT+IL+WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  460  ALLGFKFNLGAKGIWSGMIGGTLMQTLILIWVTFRTDWNKEVNEAIKRLNKWEDKKKPLL  519



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   157 bits (398),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYYV+G+P+G
Sbjct  317  FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYVIGIPLG  376

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KR+++W  +++ ++
Sbjct  377  ALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWNKEVEEASKRMDKWSNQKQEVV  436

Query  390  PK  385
            P+
Sbjct  437  PE  438



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G
Sbjct  391  FTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLG  450

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            AVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+W+ + E L+
Sbjct  451  AVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWEDRTETLI  510

Query  390  PK  385
             +
Sbjct  511  KE  512



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCP+LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  422  FTGGETVAQAVSDLCPVLAITLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLG  481

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LGAKGIW GM+GGT+MQT+IL+WVT RT+W KEVE A++RL +WD K++PLL
Sbjct  482  SLLGFYFKLGAKGIWLGMLGGTLMQTLILIWVTTRTNWNKEVEKARERLEKWDDKKQPLL  541



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ VADAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  386  FTEGKEVADAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KEVE A KRL++W  K++ ++
Sbjct  446  ALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEVEEASKRLDKWSNKKQDVV  505

Query  390  PK  385
             +
Sbjct  506  SE  507



>ref|XP_006858199.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
 gb|ERN19666.1| hypothetical protein AMTR_s00062p00172410 [Amborella trichopoda]
Length=461

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVV++ VSDLCPLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VGVP G
Sbjct  339  FTGGEVVSNRVSDLCPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYFVGVPFG  398

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGFYFNLGA GIW GMIGGT+MQTIIL WVT+RTDW KEVE A++RLN+W  K+  L
Sbjct  399  CLLGFYFNLGAMGIWSGMIGGTLMQTIILTWVTLRTDWSKEVETAQQRLNKWGDKQPAL  457



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLLAL++ LNGVQPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G
Sbjct  389  FTEGEDVAAAVSDLCPLLALSITLNGVQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLG  448

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            AVLGFYF LGAKGIW GM+GG +MQTIILLWVT RTDW KEVE + KRLN+W+ + E L+
Sbjct  449  AVLGFYFKLGAKGIWLGMLGGVIMQTIILLWVTFRTDWNKEVEESNKRLNKWEDRTETLI  508

Query  390  PK  385
             +
Sbjct  509  KE  510



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  378  FTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF ++LGAKGIW GMIGGTVMQT IL+W T RTDW KEVE AK+RL++W+  +EPL 
Sbjct  438  CLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRTDWNKEVEKAKERLDKWENVKEPLS  497

Query  390  PK  385
             K
Sbjct  498  KK  499



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVGVPVG
Sbjct  392  FTDGERVANAVSDLCPLLAITLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPVG  451

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RT+W KEVE A KRL  WD K+EPLL
Sbjct  452  VLLGFKFDLGAKGIWSGMIGGTTVQTLILIWVTYRTNWNKEVEEAMKRLETWDEKKEPLL  511



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  399  FTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  458

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W+ K++PLL
Sbjct  459  VLLGFKFNLGAKGIWSGMIGGTFMQTLILIWVTFRTDWNKEVDEAIKRLNKWEDKKQPLL  518



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VN+GCYYV+G+P+G
Sbjct  396  FTEGKEVSDAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNIGCYYVIGIPLG  455

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++W  K++ ++
Sbjct  456  ALFGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWTKEEEEASKRMDKWSNKKQEVV  515

Query  390  PK  385
            P+
Sbjct  516  PE  517



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   158 bits (400),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  397  FTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  456

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PL 
Sbjct  457  CVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  516



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  378  FTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF ++LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PL 
Sbjct  438  CVLGFKYDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLF  497



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AV+DLCPLLA+TL+LNGVQPVLSGVAVGCGWQ+FVA +NVGCYY+VG+P+G
Sbjct  388  FTGGETVAKAVADLCPLLAVTLLLNGVQPVLSGVAVGCGWQSFVACINVGCYYMVGIPIG  447

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FNLG KGIW GMIGGT+MQT+ILLWVT RTDW KEVE A+KRL++W+   EPLL
Sbjct  448  CLLGFKFNLGVKGIWSGMIGGTMMQTLILLWVTFRTDWNKEVEKARKRLDKWEEITEPLL  507

Query  390  PK  385
             +
Sbjct  508  KE  509



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 92/117 (79%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VADAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  383  FTEGEYVADAVSDLCPLLAITVVLNGIQPVLSGVAVGCGWQVFVAYVNVGCYYFVGIPLG  442

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            A+LGF F+LGAKGIW GMIGGT+MQTIILLWV  RTDW +EVE A KRLN+W+ K +
Sbjct  443  ALLGFKFDLGAKGIWSGMIGGTLMQTIILLWVACRTDWKREVEEAAKRLNKWEDKHK  499



>ref|XP_002518492.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43879.1| multidrug resistance pump, putative [Ricinus communis]
Length=497

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGEVV+ AVS+L P LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G
Sbjct  376  FTDGEVVSKAVSELSPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLG  435

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEVE A++RLN W+ K+EPLL
Sbjct  436  VLLGFKFDLGAKGIWSGMIGGTFLQTLILIWVTYRTDWNKEVEKARQRLNSWEDKKEPLL  495



>ref|XP_011047998.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=405

 Score =   156 bits (394),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G
Sbjct  284  FTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLG  343

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  344  VLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  403



>gb|AHI48506.1| multidrug and toxic extrusion transporter [Vaccinium corymbosum]
Length=537

 Score =   158 bits (399),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 92/123 (75%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  402  FTSGETVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYFVGLPIG  461

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGAKGIW GMIGGTV+QT IL+W T +TDW+KEVE AKKRL++WD   +PLL
Sbjct  462  CVLGFKFDLGAKGIWSGMIGGTVLQTAILIWTTYQTDWIKEVEKAKKRLDKWDDINQPLL  521

Query  390  PKT  382
              +
Sbjct  522  KAS  524



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLLAL++VLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G
Sbjct  396  FTEGEEVAAAVSDLCPLLALSIVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYYGIGIPLG  455

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            AV+GFYF   AKGIW GM+GGTV+QT+IL+WVT RTDW KEV  A++RLNQW+  +EPLL
Sbjct  456  AVMGFYFKFNAKGIWLGMLGGTVLQTLILMWVTFRTDWNKEVVEAERRLNQWEDVKEPLL  515



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   157 bits (397),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  375  FTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYIVGVPLG  434

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFY+  GAKGIW GM+GGT MQTIIL+WVT RTDW KEVE + KRLN+WD K+E  L
Sbjct  435  VLLGFYYKFGAKGIWLGMMGGTCMQTIILIWVTFRTDWNKEVEESMKRLNKWDVKQESTL  494



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   157 bits (396),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLA+T++LNG+QPVLSGVAVGCGWQ FVAYVNV CYY+VG+P+G
Sbjct  369  FTEGETVAHAVSELTPLLAITIILNGIQPVLSGVAVGCGWQAFVAYVNVACYYIVGIPLG  428

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGF FNLGAKGIW GMIGGT MQT+IL+WVT RTDW KEV+ A KRLN+W+ +++PLL
Sbjct  429  ALLGFKFNLGAKGIWSGMIGGTFMQTVILIWVTFRTDWNKEVDEAIKRLNKWEDEKQPLL  488



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   157 bits (396),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  397  FTEGETVAKAVSDLCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  456

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF  +LGAKGIW GMIGGT+MQT+ILLWVT  TDW KEVE+A++RL++W+ K++PLL
Sbjct  457  CVLGFKNDLGAKGIWSGMIGGTMMQTLILLWVTFTTDWNKEVEIARRRLDRWEDKKQPLL  516



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  391  FTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPIG  450

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT MQT+IL+WVT RTDW KEVE AK RL++W+ K++PLL
Sbjct  451  CILGFKFDLGAKGIWSGMLGGTTMQTLILIWVTYRTDWNKEVEKAKGRLDKWEDKKKPLL  510



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+DAVSDLCPLLA+T+VLNG+QPVLSGVAVGCGWQT+VA VN+GCYYV+G+P+G
Sbjct  385  FTEGKEVSDAVSDLCPLLAVTIVLNGIQPVLSGVAVGCGWQTYVAKVNIGCYYVIGIPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGFY+N GAKGIW GMIGGTV+QT IL WVT RTDW KE E A KR+++W  +++ ++
Sbjct  445  ALLGFYYNFGAKGIWTGMIGGTVIQTFILAWVTFRTDWSKEAEEASKRMDKWSNQKQEVV  504

Query  390  PK  385
            P+
Sbjct  505  PE  506



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  379  FTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLG  438

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW KEVE AKKRL++W+  + PL
Sbjct  439  CLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKEVECAKKRLDKWENLKGPL  497



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G
Sbjct  378  FTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLLGIPLG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT++QT+ILLWVT+RTDW KEVE AK RLN WD KR+P L
Sbjct  438  VLLGFKFDLGAKGIWSGMLGGTLLQTMILLWVTLRTDWNKEVENAKNRLNTWDDKRQPPL  497

Query  390  PK  385
             +
Sbjct  498  QE  499



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ VA AVSDLCPLLALTLVLNG+QPVLSG+AVGCGWQTFVA VNVGCYY+VG+P+G
Sbjct  383  FTEGKDVAAAVSDLCPLLALTLVLNGIQPVLSGMAVGCGWQTFVAKVNVGCYYIVGIPLG  442

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            A+ GFYF  GAKGIW GMI GTVMQTIIL WVT  TDW KEV++A KRL+QW  ++EPL
Sbjct  443  ALFGFYFKFGAKGIWTGMICGTVMQTIILAWVTFSTDWNKEVDLATKRLDQWSDRKEPL  501



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G
Sbjct  379  FTGGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLG  438

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGTV+QT+ILLWVT RTDW KEVEVAK RL+ WD +R+PLL
Sbjct  439  VLLGFTFDLGAKGIWSGMLGGTVLQTLILLWVTWRTDWNKEVEVAKNRLSSWDDRRQPLL  498



>ref|XP_004164859.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=398

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  278  FTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCYYIVGVPLG  337

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD   +P++
Sbjct  338  SLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWDDTAKPIV  397



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY+VGVP+G
Sbjct  394  FTEGEKVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIVGVPLG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GTVMQT+IL WVT RTDWVKEVE A KRL++W  K+  ++
Sbjct  454  ALFGFYFKFDAKGIWTGMICGTVMQTVILAWVTFRTDWVKEVEEASKRLDKWSNKKLEVV  513

Query  390  PK  385
            P+
Sbjct  514  PE  515



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVSDLCPLLALTLVLNGVQPVL+GVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  393  FTDGEAVAAAVSDLCPLLALTLVLNGVQPVLTGVAVGCGWQAFVAYVNIGCYYIVGVPLG  452

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEV+ A KRL++WD   +P++
Sbjct  453  SLLGFYFNFGAKGIWVGLMGGTFMQTVILVWVTWRTDWNKEVDEAIKRLSKWDDTAKPVV  512



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/119 (77%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP G
Sbjct  399  FTEGEAVAAAVSDLCPFLAFTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLVGVPFG  458

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            A+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEVE A KRLN+W   +EPL
Sbjct  459  ALLGFYFKCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVEEAAKRLNKWGKVKEPL  517



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 110/122 (90%), Gaps = 2/122 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  375  FTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLG  434

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR--EP  397
            A+LGF F LG KGIW GMIGGT MQT ILLWVT+RTDW KEVE A+KRL++W+ K+  EP
Sbjct  435  AILGFVFKLGVKGIWGGMIGGTCMQTAILLWVTLRTDWNKEVEEAQKRLHKWEDKKTTEP  494

Query  396  LL  391
            LL
Sbjct  495  LL  496



>ref|NP_001147791.1| transparent testa 12 protein [Zea mays]
 gb|ACF88403.1| unknown [Zea mays]
 gb|ACG28718.1| transparent testa 12 protein [Zea mays]
 gb|ACG37262.1| transparent testa 12 protein [Zea mays]
 tpg|DAA62912.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 106/121 (88%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVSDLCPLLA TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVGVP+G
Sbjct  390  FTGGEAVARAVSDLCPLLAATLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGVPLG  449

Query  570  aVLGFYFNLGAKGIWCGM-IGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
              LGFY +LGAKG+W GM IGGT+ QT+ILLWVT+RTDW KEVE AK RL++WD K++PL
Sbjct  450  VFLGFYLDLGAKGVWSGMVIGGTLTQTLILLWVTVRTDWNKEVENAKARLDKWDDKKQPL  509

Query  393  L  391
            L
Sbjct  510  L  510



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA A SDL P LA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY++GVPVG
Sbjct  378  FTEGEVVAKAASDLSPFLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPVG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGAKGIW GM+GGTV+QTIIL+WVT+RTDW KEVE AK RL+ WD K +PLL
Sbjct  438  VVLGFTFDLGAKGIWSGMLGGTVLQTIILVWVTLRTDWDKEVESAKNRLSSWDEKGQPLL  497



>gb|KCW76952.1| hypothetical protein EUGRSUZ_D01312 [Eucalyptus grandis]
Length=397

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  276  FTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPIG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  336  CILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  395



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ +VAYVN+GCYYVVG+P+G
Sbjct  395  FTGGETVANAVSDLCPFLAVTLLLNGLQPVLSGVAVGCGWQAYVAYVNIGCYYVVGIPIG  454

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FNLG KGIW GMIGGT MQT+ILLWVT RTDW KEVE A KRL  WD  +EPLL
Sbjct  455  CLLGFKFNLGVKGIWTGMIGGTAMQTLILLWVTFRTDWNKEVEKAGKRLAMWDDIKEPLL  514

Query  390  PKT*KRSIHETK  355
                 + + E K
Sbjct  515  KY--HKEVEEIK  524



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  373  FTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLG  432

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W D K+EPL
Sbjct  433  VLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPL  492

Query  393  L  391
            L
Sbjct  493  L  493



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 108/121 (89%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  373  FTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLG  432

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             +LGF F LG KGIW GM+GGT MQT IL+WVT+RTDW  EVE A+KRLN+W D K+EPL
Sbjct  433  VLLGFVFKLGVKGIWGGMLGGTCMQTAILVWVTLRTDWNNEVEEAQKRLNKWEDKKKEPL  492

Query  393  L  391
            L
Sbjct  493  L  493



>ref|XP_010054588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
Length=422

 Score =   154 bits (388),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA+AVS+LCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  301  FTEGETVANAVSELCPYLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPIG  360

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GMIGGT +QT+IL+WVT R DW KEVE AK RL++W+ K++PLL
Sbjct  361  CILGFKFDLGAKGIWSGMIGGTALQTLILIWVTYRADWNKEVEKAKGRLDKWEDKKKPLL  420



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 94/124 (76%), Positives = 108/124 (87%), Gaps = 4/124 (3%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGCGWQTFvayvnvgcyyvvgv  580
            FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGCGWQ FVAYVNVGCYY+VGV
Sbjct  368  FTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGCGWQQFVAYVNVGCYYIVGV  427

Query  579  pvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKR  403
            P+G +LGF FN G KG+W GMIGGT MQT ILLWVTIRTDW KEVE A+KRLN+W D K+
Sbjct  428  PLGVLLGFVFNFGVKGLWGGMIGGTAMQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKK  487

Query  402  EPLL  391
            EPLL
Sbjct  488  EPLL  491



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY+VG+P+G
Sbjct  399  FTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVACYYIVGIPLG  458

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGF F+LGAKGIW GMIGGT +QT+IL+WVT RTDW KEV  A KRLN+W+ K++PLL
Sbjct  459  ALLGFKFDLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVYEATKRLNKWEDKKQPLL  518



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVSDLCPLLA+TL+LNG+QPVL+GVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  393  FTDGEAVAAAVSDLCPLLAITLILNGIQPVLTGVAVGCGWQAFVAYVNIGCYYIVGVPLG  452

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYFN GAKGIW G++GGT MQT+IL+WVT RTDW KEVE A KRL++WD   +P++
Sbjct  453  SLLGFYFNFGAKGIWVGLMGGTFMQTLILVWVTWRTDWNKEVEEAIKRLSKWDDTAKPIV  512



>ref|NP_001142368.1| uncharacterized protein LOC100274540 [Zea mays]
 gb|ACF88316.1| unknown [Zea mays]
Length=448

 Score =   154 bits (389),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 109/122 (89%), Gaps = 2/122 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  320  FTEGEVVSNAVADLCPLLAVTLVLNGIQPVLSGVAVGCGWQQFVAYVNIGCYYIVGVPLG  379

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR--EP  397
            AVLGF F LG KGIW GMIGGT MQT IL+WVT+RTDW KEVE A+ RL++W+A +  EP
Sbjct  380  AVLGFVFKLGVKGIWAGMIGGTCMQTAILVWVTLRTDWNKEVEEAQNRLHKWEANKTTEP  439

Query  396  LL  391
            LL
Sbjct  440  LL  441



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE+VA  VS+LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  379  FTEGEIVAKEVSELCPFLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLG  438

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+LGAKGIW GMIGGTVMQT+ILLWVT RTDW K+VE AKKRL++W+  + PL
Sbjct  439  CLLGFKFDLGAKGIWTGMIGGTVMQTVILLWVTFRTDWNKKVECAKKRLDKWENLKGPL  497



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+P+G
Sbjct  384  FTDGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
             VLGF F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  444  CVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  501



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY +G+P+G
Sbjct  383  FTDGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYVNVGCYYGIGIPLG  442

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
             VLGF F LG +GIW GMIGGT++QT+ILLW+T+RTDW KEV  AKKRLN+W  K+EP
Sbjct  443  CVLGFTFGLGVQGIWSGMIGGTMLQTLILLWITLRTDWNKEVNTAKKRLNKWGYKKEP  500



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA A SDL P LA+T++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++GVP+G
Sbjct  380  FTEGEVVAKAASDLSPFLAVTIILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYLIGVPLG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LG KGIW GM+GGTV+QT+ILLWVT RTDW  EVEVAK RL+ WD KR+PLL
Sbjct  440  VLLGFTFDLGVKGIWSGMLGGTVLQTLILLWVTWRTDWNTEVEVAKNRLSSWDDKRQPLL  499



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLL+LT++LNG+QPVLSGVAVGCGWQTFVAYVNV CYY+VGVP+G
Sbjct  400  FTEGETVAHAVSELAPLLSLTIILNGIQPVLSGVAVGCGWQTFVAYVNVTCYYLVGVPLG  459

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FN GAKGIW GMIGGT+MQT+ILLWVT RTDW KEV+ A KRL++W+ K++ LL
Sbjct  460  ILLGFKFNFGAKGIWSGMIGGTLMQTVILLWVTFRTDWNKEVDQALKRLDKWEDKKQHLL  519



>emb|CDP04390.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   153 bits (387),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ +VAYVNVGCYYVVG+P+G
Sbjct  313  FTSGGTVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAYVAYVNVGCYYVVGIPLG  372

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF + LGAKGIW GMIGGT+MQT+IL+W T RTDW KEVE A++RL  WD K+EPLL
Sbjct  373  CLLGFKYKLGAKGIWSGMIGGTMMQTLILVWSTFRTDWNKEVEKARERLRTWDDKKEPLL  432



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   154 bits (389),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LALTL+LNG+QP+LSGVAVGCGWQ FVAYVNVGCYY+VGVP G
Sbjct  398  FTEGEAVAAAVSDLCPFLALTLLLNGIQPILSGVAVGCGWQAFVAYVNVGCYYLVGVPFG  457

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGFYF  GAKGIW GM+ GT+MQT+IL+WVT RTDW KEVE A KRLN+W+  +E L
Sbjct  458  VLLGFYFKYGAKGIWLGMMAGTLMQTVILIWVTYRTDWKKEVEEAAKRLNKWEEVKEQL  516



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ  VAYVNVGCYYVVG+P G
Sbjct  394  FTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQASVAYVNVGCYYVVGIPFG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++W+ KR+P L
Sbjct  454  CLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKEVEKAKSRLHKWEDKRKPSL  513



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA+AVSDLCP LA+TL+L+GVQP+ SGVAVGCGWQ FVAYVNVGC Y VG+PVG
Sbjct  383  FTEGETVANAVSDLCPFLAVTLILSGVQPIFSGVAVGCGWQAFVAYVNVGCNYAVGIPVG  442

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W   +EPL
Sbjct  443  CLLGFRFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWGNVKEPL  501



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLLA ++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP G
Sbjct  404  FTEGETVARAVSDLCPLLAASIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPAG  463

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F LG KGIWCG+I GTV QT+ILL VT RTDW KEVE AKKRL++W+ K EPLL
Sbjct  464  CLLGFKFGLGVKGIWCGLIAGTVNQTLILLVVTFRTDWNKEVEEAKKRLDKWEEKEEPLL  523



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  388  FTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  447

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  448  CLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  388  FTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  447

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  448  CLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  507



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  390  FTEGEDVSQAVSRLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  449

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + PLL
Sbjct  450  CLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAPLL  509



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDL PLLAL +VLNGVQPVLSGVAVGCGWQTFVAYVNVGCYY +G+P+G
Sbjct  398  FTEGEEVAAAVSDLSPLLALAIVLNGVQPVLSGVAVGCGWQTFVAYVNVGCYYGLGIPLG  457

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            AVLGFYF  GAKGIW GM+GGTV+QTIIL+WVT RTDW  EV  + KRLN+W+ K E LL
Sbjct  458  AVLGFYFKFGAKGIWLGMLGGTVLQTIILMWVTFRTDWNNEVVESNKRLNKWEGKTESLL  517



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 109/122 (89%), Gaps = 2/122 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  365  FTEGEVVSNAVADLCPLLAITLVLNGIQPVLSGVAVGCGWQEFVAYVNVGCYYIVGVPLG  424

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAK-REP  397
            A+LGF F LG KGIW GMIGGT MQT IL+W T+RTDW KEVE A+KRLN+W D+K  EP
Sbjct  425  AILGFVFKLGVKGIWSGMIGGTFMQTAILVWATLRTDWNKEVEEAQKRLNKWADSKTTEP  484

Query  396  LL  391
            LL
Sbjct  485  LL  486



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/124 (75%), Positives = 108/124 (87%), Gaps = 4/124 (3%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLS---GVAVGCGWQTFvayvnvgcyyvvgv  580
            FT+GE V+DAV+DLCPLLA+T++LNG+QPVLS   GVAVGCGWQ FVAYVNVGCYY+VGV
Sbjct  368  FTEGERVSDAVADLCPLLAITIILNGIQPVLSEISGVAVGCGWQQFVAYVNVGCYYIVGV  427

Query  579  pvgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKR  403
            P+G +LGF FN G KG+W GMIGGT +QT ILLWVTIRTDW KEVE A+KRLN+W D K+
Sbjct  428  PLGVLLGFVFNFGVKGLWGGMIGGTAIQTAILLWVTIRTDWSKEVEEAQKRLNKWDDTKK  487

Query  402  EPLL  391
            EPLL
Sbjct  488  EPLL  491



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 108/124 (87%), Gaps = 4/124 (3%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVV++AV+DLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  367  FTEGEVVSNAVADLCPLLAITLILNGIQPVLSGVAVGCGWQEFVAYVNIGCYYIVGVPLG  426

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR----  403
            A+LGF F  G KGIW GMIGGT MQT ILLW T+RTDW KEVE A+KRL++W+ ++    
Sbjct  427  AILGFVFKFGVKGIWSGMIGGTFMQTAILLWATLRTDWNKEVEEAQKRLHKWEDQKTTTT  486

Query  402  EPLL  391
            EPLL
Sbjct  487  EPLL  490



>dbj|BAH20308.1| AT1G61890 [Arabidopsis thaliana]
Length=294

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG
Sbjct  173  FTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVG  232

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL
Sbjct  233  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLL  292

Query  390  PK  385
             +
Sbjct  293  KQ  294



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   152 bits (385),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 107/120 (89%), Gaps = 1/120 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  392  FTEGEDVSRAVSQLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  451

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+WVKEVE A+KRLN+W+ ++ PLL
Sbjct  452  CLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWVKEVEEAQKRLNKWE-EKSPLL  510



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G+V+A+A SDL PLLA++L+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  378  FTGGQVIAEAASDLAPLLAISLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             VLGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W +  ++PL
Sbjct  438  IVLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMWQNNSKKPL  497

Query  393  L  391
             
Sbjct  498  F  498



>emb|CBI23253.3| unnamed protein product [Vitis vinifera]
Length=221

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G
Sbjct  99   FTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQAFVAYINVGCYYVVGIPLG  158

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPL  394
             VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W+ K  EPL
Sbjct  159  CVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPL  218

Query  393  L  391
            L
Sbjct  219  L  219



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA A SDL P LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G
Sbjct  380  FTEGEVVAKAASDLSPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYLIGIPLG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGTV+QT+ILL VT RTDW KEVE AK RL+ WD K EPLL
Sbjct  440  VLLGFTFDLGAKGIWSGMLGGTVLQTLILLGVTWRTDWNKEVEGAKNRLSTWDDKSEPLL  499

Query  390  PK  385
             K
Sbjct  500  QK  501



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G VVA+AVSDL P+LA++LVLNG+QPVLSGVAVGCGWQ FVAYVNVG YY +G+P+G
Sbjct  386  FTGGTVVAEAVSDLAPILAISLVLNGIQPVLSGVAVGCGWQAFVAYVNVGSYYFLGIPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
            AVLGF F LGAKGIW GM+GGT +QTIIL+WVT+RTDW KEVE+A+ RLN+W+ K+E
Sbjct  446  AVLGFVFKLGAKGIWSGMLGGTALQTIILIWVTVRTDWNKEVEIARGRLNRWEDKKE  502



>ref|XP_002886501.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62760.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG
Sbjct  380  FTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTFDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>emb|CDY47166.1| BnaA01g22920D [Brassica napus]
Length=501

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG
Sbjct  380  FTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  378  FTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF ++LGAKGIW GMIGGTVMQT IL+W T R DW KEVE AKK L++W+  +E L
Sbjct  438  CLLGFKYDLGAKGIWTGMIGGTVMQTFILIWFTFRADWNKEVEKAKKHLDKWENVKETL  496



>ref|XP_009105791.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   152 bits (383),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>emb|CDY71092.1| BnaAnng36070D [Brassica napus]
Length=130

 Score =   143 bits (360),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  11   FTEGEKVSAAVSDLCPLLAVTLILNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  70

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W  K+  ++
Sbjct  71   ALFGFYFKYDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDIWSNKKAEVI  130



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA  VS LCP LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  379  FTEGEVVAKEVSSLCPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLG  438

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+ GAKGIW GMIGGTVMQTIILLWVT  TDW KEVE A+KRL++W+  + PL
Sbjct  439  CLLGFKFDFGAKGIWTGMIGGTVMQTIILLWVTFSTDWNKEVESARKRLDKWENLKGPL  497



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA+AVS+LCPLLA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  389  FTGGETVANAVSELCPLLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFG  448

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
             ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KEVE AK RL++W+ KR
Sbjct  449  CLIGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWKKEVEKAKSRLHKWEDKR  504



>gb|KDP20758.1| hypothetical protein JCGZ_21229 [Jatropha curcas]
Length=506

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLA+ L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+PVG
Sbjct  385  FTEGETVAKAVSELSPLLAVALLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLVGIPVG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             VLGF F+ GAKGIW GMIGGTVMQTIILLWVT RTDW+KEVE AK RL++WD  ++ L
Sbjct  445  CVLGFKFDFGAKGIWSGMIGGTVMQTIILLWVTFRTDWIKEVEKAKMRLDKWDDDKQTL  503



>emb|CDY25329.1| BnaC01g29980D [Brassica napus]
Length=501

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD  +VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPIVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_009357445.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=508

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  387  FTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPCG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEVE AK R+ +WD K++PLL
Sbjct  447  CVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVENAKSRVEKWDDKKQPLL  506



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE+VA+AVSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  378  FTEGEIVANAVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPLG  437

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF ++LGAKGIW GMIGGT+MQT IL+W T R DW KEVE AKK L++W+  +E L
Sbjct  438  CLLGFKYDLGAKGIWTGMIGGTIMQTFILIWFTFRADWNKEVEKAKKHLDKWENVKETL  496



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 104/119 (87%), Gaps = 2/119 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G+V+A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  382  FTGGQVIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW--DAKRE  400
             +LGFYFNL AKGIW GM+GGT MQTIILLWVT RTDW KEVE AK RLN W  ++K++
Sbjct  442  ILLGFYFNLEAKGIWLGMLGGTAMQTIILLWVTFRTDWEKEVEQAKSRLNMWQNNSKKQ  500



>emb|CBI23254.3| unnamed protein product [Vitis vinifera]
Length=435

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  313  FTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  372

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPL  394
             VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++W+ K  +PL
Sbjct  373  CVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPL  432

Query  393  L  391
            L
Sbjct  433  L  433



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/120 (77%), Positives = 106/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLL+L+L+LNG+QPVLSGVAVGCGWQ FVAYVNV CYY VG+P+G
Sbjct  382  FTEGEAVAAAVSDLCPLLSLSLLLNGIQPVLSGVAVGCGWQAFVAYVNVACYYGVGIPLG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            AVLGFYF  GAKGIW GM+GGT MQT+IL+WVT RTDW KEV+ A KRLN+W+ K+EPLL
Sbjct  442  AVLGFYFQFGAKGIWLGMLGGTTMQTVILMWVTFRTDWNKEVQEADKRLNKWEDKKEPLL  501



>ref|XP_009137220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=507

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYVVG+P+G
Sbjct  387  FTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVVGIPIG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  447  CVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>emb|CDX98711.1| BnaA03g44960D [Brassica napus]
Length=507

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYVVG+P+G
Sbjct  387  FTSDAEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVVGIPIG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  447  CVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  387  FTDGETVSAAVSDLCPLLAITLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W  K+  ++
Sbjct  447  ALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDIWSNKKLEVV  506

Query  390  PK  385
            P+
Sbjct  507  PE  508



>gb|KEH36840.1| MATE efflux family protein [Medicago truncatula]
Length=495

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA+AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ  VAY+NVGCYY VGVPVG
Sbjct  382  FTEGETVANAVSDLCPYLAVTLILNGIQPVLSGVAVGCGWQAIVAYINVGCYYGVGVPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             VLGF FNLG KGIW GMIGGTV+QT+ILLW+T RTDW+KEV  AKKRL++W+
Sbjct  442  CVLGFKFNLGVKGIWSGMIGGTVLQTLILLWITFRTDWIKEVNTAKKRLDKWE  494



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  400  FTDGEDVATAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  459

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+ K  PLL
Sbjct  460  CLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWEDK-TPLL  518

Query  390  PK  385
             +
Sbjct  519  SE  520



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVS LCPLLA++L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  394  FTGGEAVAQAVSGLCPLLAISLMLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGVPLG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF  GAKGIW G++GGT+MQTIIL+ V +RTDW KEVE A +RL+QW+ K+EPLL
Sbjct  454  SLLGFYFKHGAKGIWLGLLGGTLMQTIILIVVMVRTDWNKEVEKALERLDQWEDKKEPLL  513

Query  390  PK  385
             +
Sbjct  514  KE  515



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 106/122 (87%), Gaps = 1/122 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  400  FTDGEDVAAAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  459

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+ K  PLL
Sbjct  460  CLLGFYFDLGAAGIWSGMIGGTLMQTLILMWVTFRTNWNREVEEAMKRLNKWEDK-TPLL  518

Query  390  PK  385
             +
Sbjct  519  SE  520



>emb|CDY07257.1| BnaC04g19140D [Brassica napus]
Length=327

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD  VVA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  206  FTDSPVVAEAVADLSPFLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  265

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT++TDW KEVE +  RL+QW+  REPLL
Sbjct  266  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVVVTLKTDWDKEVEKSSSRLDQWEESREPLL  325

Query  390  PK  385
             +
Sbjct  326  KQ  327



>emb|CDX76391.1| BnaA08g10090D [Brassica napus]
Length=502

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+PVG
Sbjct  382  FTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  442  CILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VADAVS+L P LA +LVLNG+QPVLSGVAVGCGWQTFVAYVNVGCYY++G+P+G
Sbjct  391  FTEGETVADAVSELTPYLAASLVLNGIQPVLSGVAVGCGWQTFVAYVNVGCYYLIGIPLG  450

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF  GAKGIW G+I G  +QT+ILLW T RTDW KEVE+A+KRL  WD +++PLL
Sbjct  451  ALFGFYFKYGAKGIWIGIISGVFLQTLILLWTTFRTDWNKEVEIAQKRLATWDDQKQPLL  510



>ref|XP_009108539.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108540.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
 ref|XP_009108541.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=502

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+PVG
Sbjct  382  FTSDPEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  442  CILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>ref|NP_564787.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAK17168.1|AF325100_1 unknown protein [Arabidopsis thaliana]
 gb|AAC28507.1| EST gb|T04691 comes from this gene [Arabidopsis thaliana]
 gb|AAL14417.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
 gb|AEE33899.1| MATE efflux family protein [Arabidopsis thaliana]
Length=501

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG
Sbjct  380  FTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT+RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTLRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  387  FTGGATVAKEVSDLCPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPL  394
             VLGF F+LGAKGIW GMIGGTVMQT+IL+W+T RTDW KEVE AK+RL++W+ K  +PL
Sbjct  447  CVLGFKFDLGAKGIWSGMIGGTVMQTLILVWITYRTDWSKEVEKAKQRLDKWEDKEDQPL  506

Query  393  L  391
            L
Sbjct  507  L  507



>emb|CDX94061.1| BnaC07g36950D [Brassica napus]
Length=507

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYVVG+P+G
Sbjct  387  FTSDVEVAKAVSELCPFLAVTILLNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVVGIPIG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEV+ A+KRL+ WD K+EPLL
Sbjct  447  CVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVKKARKRLDMWDDKKEPLL  506



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G VVA AVSDLCPLLALT++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VGVP+G
Sbjct  375  FTEGLVVAAAVSDLCPLLALTILLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYIVGVPLG  434

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             +LGFY+  GAKGIW GM+GGT +QTIIL+WVT  TDW KEVE + KRLN+WD K+E
Sbjct  435  VLLGFYYKFGAKGIWLGMMGGTCIQTIILIWVTFGTDWNKEVEESMKRLNKWDDKQE  491



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 105/120 (88%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  400  FTEGETVAHAVSELTPLLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  459

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FNLGAKGIW GMIGGT +QT+IL+WVT RTDW KEV+ A KRLN+W+  ++ LL
Sbjct  460  VLLGFKFNLGAKGIWSGMIGGTFIQTLILIWVTFRTDWNKEVDEAIKRLNKWEDNKKALL  519



>emb|CAN82750.1| hypothetical protein VITISV_014577 [Vitis vinifera]
Length=398

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 92/121 (76%), Positives = 104/121 (86%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VA  VSDLCP LA+TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G
Sbjct  276  FTGGATVAKEVSDLCPFLAITLILNGVQPVLSGVAVGCGWQAFVAYINVGCYYVVGIPLG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W D + EPL
Sbjct  336  CVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDXEDEPL  395

Query  393  L  391
            L
Sbjct  396  L  396



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  390  FTEGEEVSAAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  449

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GT++QT+IL W+T RTDW KEVE + KRL++W  K+  ++
Sbjct  450  ALFGFYFKFDAKGIWTGMICGTLIQTVILAWITFRTDWTKEVEESAKRLDKWSNKKPEVV  509

Query  390  PK  385
            P+
Sbjct  510  PE  511



>gb|AAK82541.1| At1g61890/F8K4_9 [Arabidopsis thaliana]
Length=501

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG
Sbjct  380  FTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTI+L+ VT+RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIVLVIVTLRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_010665570.1| PREDICTED: protein TRANSPARENT TESTA 12 [Beta vulgaris subsp. 
vulgaris]
Length=508

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 104/120 (87%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  V++AV+DL P LA++++LNG+QPVLSGVAVGCGWQ+FVAYVNV CYYVVG+PVG
Sbjct  388  FTGGTEVSEAVADLSPFLAISILLNGIQPVLSGVAVGCGWQSFVAYVNVACYYVVGIPVG  447

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF LG KGIW GMIGGTV+QT+ILLWVT RTDW KEVE A  RL++W+A +EPLL
Sbjct  448  VLLGFYFKLGVKGIWGGMIGGTVIQTVILLWVTFRTDWQKEVEKAASRLDKWEAVKEPLL  507



>ref|XP_002867813.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44072.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=507

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYYVVG+PVG
Sbjct  387  FTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYVVGIPVG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+  AKGIW GMIGGT MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  447  CILGFAFDFQAKGIWTGMIGGTFMQTLILLYVTYRTDWDKEVETARKRLDMWDDKKEPL  505



>ref|XP_009113112.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=501

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FILGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>emb|CDY12916.1| BnaA09g13580D [Brassica napus]
Length=501

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY VG+P+G
Sbjct  372  FTEGETVARAVSELSPLLAATLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYFVGIPLG  431

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT+MQT IL+WVT RTDW KEVE A +RL++W+  ++PLL
Sbjct  432  ILLGFKFDLGAKGIWGGMLGGTLMQTFILIWVTFRTDWNKEVEQAMRRLDKWEDNKQPLL  491

Query  390  PK  385
              
Sbjct  492  SN  493



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVSDLCPLLA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  392  FTEGENVSAAVSDLCPLLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  451

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W  K+  ++
Sbjct  452  ALFGFYFKFDAKGIWTGMICGTIIQTVILAWVTFRTDWTKEVEEASKRLDVWSNKKTEVV  511

Query  390  PK  385
            P+
Sbjct  512  PE  513



>emb|CDY19507.1| BnaC09g13960D [Brassica napus]
Length=501

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPEVAEAVADLSPFLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_008384070.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=508

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVS L P LA+TLVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  387  FTSGETVAKAVSHLTPYLAVTLVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPCG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGA+GIW GMIGGT+MQT+ILLWVT RTDW KEV+ AK R+ +WD K +PLL
Sbjct  447  CVLGFVFDLGAEGIWSGMIGGTLMQTLILLWVTFRTDWDKEVDNAKSRVEKWDDKEQPLL  506



>ref|XP_006391952.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
 dbj|BAJ34317.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ29238.1| hypothetical protein EUTSA_v10023417mg [Eutrema salsugineum]
Length=501

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPAVAKAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEVE A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVEKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   149 bits (377),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 91/119 (76%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCP LALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP G
Sbjct  399  FTEGEAVAAAVSDLCPFLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLVGVPFG  458

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            A+LGFYF  GAKGIW GM+ GT+MQTIIL+WVT RTDW KEV  A KRLN+W   +E L
Sbjct  459  ALLGFYFPCGAKGIWLGMMAGTLMQTIILIWVTYRTDWKKEVVEAAKRLNKWGEVKETL  517



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 89/120 (74%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVS L PLLA TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  398  FTEGEDVSRAVSQLTPLLAFTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  457

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIWCGMIGGT+MQT+IL+WVT RT+W KEVE A KRLN+W+ K  P+L
Sbjct  458  CLLGFYFDLGAAGIWCGMIGGTLMQTLILVWVTFRTNWNKEVEEALKRLNKWEDK-SPIL  516



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 87/119 (73%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVS+LCPLLA++LVLNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  385  FTEGETVAKAVSELCPLLAVSLVLNGIQPVLSGVAVGCGWQKFVAYVNVGCYYVVGIPIG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+LGA+GIW GM+GGT MQTIILLWVT   DW  EVE A+ RL++W+  +EPL
Sbjct  445  CLLGFKFHLGAQGIWSGMLGGTTMQTIILLWVTFHADWNAEVEKARMRLDKWEDSKEPL  503



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYV+G+P+G
Sbjct  390  FTDGETVANAVSHLTPYLAITLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVLGIPIG  449

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
             +LGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW KEVE A  RL +W+ K+ P
Sbjct  450  CLLGFKFDLGAEGIWSGMIGGTFMQTIILLWVTFRTDWNKEVETAGNRLKKWEDKKLP  507



>gb|ACF85024.1| unknown [Zea mays]
Length=186

 Score =   142 bits (358),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+ AV+ L PLLA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G
Sbjct  67   FTEGDDVSRAVAQLSPLLAVTLILNGIQPVLSGVAVGCGWQALVAYVNVGCYYIVGIPLG  126

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  127  CLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  185



>gb|AFW68307.1| putative MATE efflux family protein [Zea mays]
Length=401

 Score =   147 bits (372),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCGWQTFvayvnvgcyyvvgvp  577
            FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCGWQ FVAYVNVGCYY+VG+P
Sbjct  276  FTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIP  335

Query  576  vgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            +G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + P
Sbjct  336  LGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAP  395

Query  396  LL  391
            LL
Sbjct  396  LL  397



>ref|XP_010434104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=508

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY+VG+PVG
Sbjct  388  FTSDIHVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYIVGIPVG  447

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD K+EP
Sbjct  448  CILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  407  FTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFG  466

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  467  CILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  407  FTSGETVAKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFG  466

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGA+GIW GMIGGT++QT+ILLWVT RTDW KEV+ AK R+ +WD K++PLL
Sbjct  467  CILGFRFDLGAEGIWVGMIGGTLIQTLILLWVTFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>gb|AAM62936.1| unknown [Arabidopsis thaliana]
Length=507

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYYVVG+PVG
Sbjct  387  FTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYVVGIPVG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  447  CILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  505



>ref|XP_006651562.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=539

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 105/122 (86%), Gaps = 1/122 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA AVS L PLL LTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  419  FTDGEDVAAAVSKLTPLLGLTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  478

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W +EVE A KRLN+W+ K  PLL
Sbjct  479  CLLGFYFDLGAAGIWSGMIGGTLMQTLILVWVTFRTNWNREVEEAMKRLNKWEDK-TPLL  537

Query  390  PK  385
             +
Sbjct  538  SE  539



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V++AVS L P LA++++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G
Sbjct  385  FTEGETVSNAVSALSPYLAVSIILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIIGIPLG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+ GA+GIW GMIGGT +QT+ILLWVT RTDW KEVE  K RL++WD K+EPLL
Sbjct  445  CVLGFKFDFGAQGIWSGMIGGTFIQTLILLWVTFRTDWKKEVENVKNRLDRWDDKKEPLL  504

Query  390  PK  385
             +
Sbjct  505  TE  506



>emb|CDY34833.1| BnaA09g47590D [Brassica napus]
Length=459

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G
Sbjct  338  FTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIG  397

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+  + PLL
Sbjct  398  YVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWEGSQAPLL  457

Query  390  PK  385
             +
Sbjct  458  KQ  459



>gb|KFK37989.1| hypothetical protein AALP_AA3G055600 [Arabis alpina]
Length=501

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T++LNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPAVAEAVADLSPYLAITIILNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VTIRTDW KEV  A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTIRTDWDKEVAKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|NP_567640.1| MATE efflux family protein [Arabidopsis thaliana]
 ref|NP_974588.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AAL06895.1| AT4g21910/T8O5_120 [Arabidopsis thaliana]
 gb|AAM91351.1| At4g21910/T8O5_120 [Arabidopsis thaliana]
 dbj|BAH19610.1| AT4G21910 [Arabidopsis thaliana]
 gb|AEE84526.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84527.1| MATE efflux family protein [Arabidopsis thaliana]
Length=507

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYYVVG+PVG
Sbjct  387  FTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYVVGIPVG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  447  CILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  505



>dbj|BAH19969.1| AT4G21910 [Arabidopsis thaliana]
Length=509

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYYVVG+PVG
Sbjct  389  FTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYVVGIPVG  448

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  449  CILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  507



>ref|NP_974587.1| MATE efflux family protein [Arabidopsis thaliana]
 gb|AEE84525.1| MATE efflux family protein [Arabidopsis thaliana]
Length=509

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+   VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYYVVG+PVG
Sbjct  389  FTEDADVAKAVSDLCPFLAITIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYVVGIPVG  448

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  449  CILGFTFDFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDLWDDKKEPL  507



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQ--PVLSGVAVGCGWQTFvayvnvgcyyvvgvp  577
            FT+GE V+ AVS L PLLA TL+LNG+Q  PVLSGVAVGCGWQ FVAYVNVGCYY+VG+P
Sbjct  388  FTEGEDVSQAVSRLTPLLAFTLILNGIQLQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIP  447

Query  576  vgaVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
            +G +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+WD  + P
Sbjct  448  LGCLLGFYFDLGAAGIWSGMIGGTLMQTLILIWVTFRTNWNKEVEEAQKRLNKWDDGKAP  507

Query  396  LL  391
            LL
Sbjct  508  LL  509



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVSDLCP LA+TLVLNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  385  FTEGEEVSAAVSDLCPFLAVTLVLNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPIG  444

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
             + GFYF   AKGIW GMIGGT++QT+IL+WV +RTDW KEVE A KRL++W  K+
Sbjct  445  TLFGFYFEYDAKGIWTGMIGGTLIQTVILVWVILRTDWTKEVEKASKRLDKWSNKK  500



>emb|CBI23251.3| unnamed protein product [Vitis vinifera]
Length=431

 Score =   147 bits (371),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  311  FTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  370

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  WD      L
Sbjct  371  ALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWDTNNSASL  430



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA+A   +CP LA+TL+LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY VG+PVG
Sbjct  382  FTKGETVANAQYLICPFLAVTLILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYGVGIPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF F+LGAKGIW GMIGGTVMQTIILLW T RTDW KEVE A+ RL++W+  +EPL
Sbjct  442  CLLGFKFDLGAKGIWTGMIGGTVMQTIILLWFTYRTDWNKEVEKARTRLDKWENVKEPL  500



>ref|XP_010430214.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010430215.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=501

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_009118179.1| PREDICTED: protein TRANSPARENT TESTA 12 [Brassica rapa]
Length=504

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV++L P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G
Sbjct  383  FTDSPAVAEAVAELSPYLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIG  442

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL+QW+  + PLL
Sbjct  443  YVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDQWEDSQAPLL  502

Query  390  PK  385
             +
Sbjct  503  KQ  504



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 105/125 (84%), Gaps = 5/125 (4%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA+AVSDLCPLLA+TL+LNGVQPVLSGVAVGCGWQ  VAYVNVGCYYVVG+P G
Sbjct  394  FTGGETVANAVSDLCPLLAVTLILNGVQPVLSGVAVGCGWQASVAYVNVGCYYVVGIPFG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKE-----VEVAKKRLNQWDAK  406
             ++GF F+LG KGIW GMIGGT++QT+ILLWVT RTDW KE     VE AK RL++W+ K
Sbjct  454  CLMGFKFDLGVKGIWSGMIGGTLLQTLILLWVTFRTDWRKEMFQFQVEKAKSRLHKWEDK  513

Query  405  REPLL  391
            R+P L
Sbjct  514  RKPSL  518



>ref|XP_010418166.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_006282889.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
 gb|EOA15787.1| hypothetical protein CARUB_v10007133mg [Capsella rubella]
Length=504

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY+VG+PVG
Sbjct  384  FTSDVDVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYIVGIPVG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
             +LGF FN  AKGIW GMIGG++MQT+ILL+VT RTDW KEVE AKKRL+ WD K+EP
Sbjct  444  CILGFTFNFQAKGIWTGMIGGSLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDEKKEP  501



>ref|XP_006302163.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
 gb|EOA35061.1| hypothetical protein CARUB_v10020177mg [Capsella rubella]
Length=501

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+PVG
Sbjct  380  FTDSPAVAEAVADLSPFLAVTIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPVG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_010473410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=501

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV+DL P LA+T+VLNG+QPVLSGVAVGCGWQ FVAYVN+GCYYVVG+P+G
Sbjct  380  FTDSPAVAEAVADLSPFLAITIVLNGIQPVLSGVAVGCGWQAFVAYVNIGCYYVVGIPIG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIIL+ VT RTDW KEV  A  RL+QW+  REPLL
Sbjct  440  FVLGFTYDMGAKGIWTGMIGGTLMQTIILVIVTFRTDWDKEVAKASSRLDQWEESREPLL  499

Query  390  PK  385
             +
Sbjct  500  KQ  501



>ref|XP_002274027.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=504

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 90/120 (75%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VADAVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  384  FTSGTTVADAVSDLAPFLAVSIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+LGF F+LG KGIW GMIGGTVMQT+ILLWVT RTDW KEVE AK RL  WD      L
Sbjct  444  ALLGFKFDLGVKGIWSGMIGGTVMQTLILLWVTYRTDWNKEVEKAKSRLETWDTNNSASL  503



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE +A+A SDL PLLAL+L+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  387  FTSGETIAEAASDLAPLLALSLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQW-DAKREPL  394
             +LGF F L AKGIW GM+GGT MQTIILLWVT RT+W +EVE AK RLN W D  ++PL
Sbjct  447  VILGFNFKLEAKGIWLGMLGGTAMQTIILLWVTFRTNWEQEVEKAKSRLNMWQDQSKKPL  506

Query  393  L  391
            L
Sbjct  507  L  507



>emb|CDX94063.1| BnaC07g36970D [Brassica napus]
Length=507

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYV+G+P+G
Sbjct  387  FTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVIGIPIG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+  L
Sbjct  447  CVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKNSL  505



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 103/121 (85%), Gaps = 1/121 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VA  VSDLCP L +TL+LNGVQPVLSGVAVGCGWQ FVAY+NVGCYYVVG+P+G
Sbjct  386  FTGGATVAKEVSDLCPFLVITLILNGVQPVLSGVAVGCGWQAFVAYINVGCYYVVGIPLG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR-EPL  394
             VLGF F+LGAKGIW GMIGGTVMQT+IL+WVT RTDW KEV  AK+RL++W+ K  EPL
Sbjct  446  CVLGFKFDLGAKGIWSGMIGGTVMQTLILVWVTYRTDWSKEVGKAKQRLDKWEDKEDEPL  505

Query  393  L  391
            L
Sbjct  506  L  506



>ref|XP_002464323.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
 gb|EER91321.1| hypothetical protein SORBIDRAFT_01g016140 [Sorghum bicolor]
Length=501

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 2/120 (2%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLLA TL+LNG+QPVLSGVAVG  WQ  VAY+NVGCYY VG+P+G
Sbjct  379  FTEGETVARAVSDLCPLLAATLILNGIQPVLSGVAVG--WQKLVAYINVGCYYFVGIPLG  436

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF F+LGAKGIW GM+GGT MQT+IL W+T RTDW KEVE A+KRLNQW+  ++PLL
Sbjct  437  ILLGFKFHLGAKGIWTGMLGGTCMQTLILFWITFRTDWDKEVEEARKRLNQWEDNKQPLL  496



>emb|CDY27431.1| BnaC03g64710D [Brassica napus]
Length=507

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYVVG+P+G
Sbjct  387  FTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVVGIPIG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD K++
Sbjct  447  CVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_006413712.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413713.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 ref|XP_006413714.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 dbj|BAJ34508.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ55165.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55166.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
 gb|ESQ55167.1| hypothetical protein EUTSA_v10024978mg [Eutrema salsugineum]
Length=502

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VG+PVG
Sbjct  382  FTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGIPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT +TDW KEVE A+KRL+ WD K+E L
Sbjct  442  CILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYQTDWDKEVEKARKRLDMWDDKKESL  500



>emb|CDY27434.1| BnaC03g64740D [Brassica napus]
Length=502

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 88/119 (74%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+PVG
Sbjct  382  FTSDPEVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LG  FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+EPL
Sbjct  442  CILGSTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKEPL  500



>ref|XP_009108536.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brassica 
rapa]
 ref|XP_009108538.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Brassica 
rapa]
Length=507

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 102/117 (87%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYYVVG+P+G
Sbjct  387  FTSDADVAKAVSDLCPYLAVTVILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYVVGIPIG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD K++
Sbjct  447  CVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKAKKRLDMWDDKKD  503



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   147 bits (370),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 102/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+ AVSDLCPLLALTLVLNG+QPVLSGVAVGCGWQ FVA VNVGCYY++G+P+G
Sbjct  390  FTEGKKVSVAVSDLCPLLALTLVLNGIQPVLSGVAVGCGWQAFVAKVNVGCYYIIGIPLG  449

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             + GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL++W  K+  ++
Sbjct  450  VIFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDKWSNKKLEVV  509

Query  390  PK  385
            P+
Sbjct  510  PE  511



>ref|XP_011463308.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=186

 Score =   140 bits (352),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 96/119 (81%), Positives = 106/119 (89%), Gaps = 1/119 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA AVSDL PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VGVP+G
Sbjct  67   FTEGEVVAAAVSDLTPLLALTLLLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYLVGVPLG  126

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGFYFN GAKGIW GM+ GT+MQTIILLW+TIRTDW KEVE A +RLN WD K EPL
Sbjct  127  VLLGFYFNFGAKGIWLGMMAGTLMQTIILLWITIRTDWKKEVEEAARRLNNWDVK-EPL  184



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  407  FTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFG  466

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  467  CVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  526



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  410  FTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFG  469

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  470  CVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  529



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  417  FTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFG  476

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  477  CVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  536



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   146 bits (369),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE V  AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P G
Sbjct  414  FTSGETVXKAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPFG  473

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+LGA+GIW GMIGGT++QT+ILLW+T RTDW KEV+ AK R+ +WD K++PLL
Sbjct  474  CVLGFRFDLGAEGIWVGMIGGTLIQTLILLWITFRTDWNKEVDKAKNRVEKWDDKKQPLL  533



>emb|CDY34637.1| BnaC08g41960D [Brassica napus]
Length=459

 Score =   145 bits (367),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY VG+P+G
Sbjct  338  FTDSPAVAEAVAELSPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYYFVGIPIG  397

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GAKGIW GMIGGT+MQTIILL VTIRTDW KEVE A +RL++W+  + PLL
Sbjct  398  YVLGFTYDMGAKGIWTGMIGGTLMQTIILLIVTIRTDWDKEVETASRRLDKWEDTQAPLL  457

Query  390  PK  385
             +
Sbjct  458  KQ  459



>ref|XP_010448968.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Camelina 
sativa]
 ref|XP_010448969.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Camelina 
sativa]
Length=508

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 102/118 (86%), Gaps = 0/118 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA+AVS+LCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY+VG+PVG
Sbjct  388  FTSDVHVAEAVSELCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYIVGIPVG  447

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RT W KEVE AKKRL+ WD K+EP
Sbjct  448  CILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTAWDKEVEKAKKRLDMWDEKKEP  505



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   146 bits (368),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVS+LCPLLALTL+LNG+QPVLSGVAVGCGWQTFVA VNVGCYY+VG+P+G
Sbjct  384  FTEGEKVSAAVSELCPLLALTLILNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIVGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL++W   +  ++
Sbjct  444  ALFGFYFKFDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDKWSNIKLEVV  503

Query  390  PK  385
            P+
Sbjct  504  PE  505



>dbj|BAD95082.1| hypothetical protein [Arabidopsis thaliana]
Length=219

 Score =   140 bits (353),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 104/122 (85%), Gaps = 1/122 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD   VA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ +VAYVN+GCYY+VG+P+G
Sbjct  99   FTDSPAVAEAVAELSPFLAITIVLNGVQPVLSGVAVGCGWQAYVAYVNIGCYYIVGIPIG  158

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GA+GIW GMIGGT+MQTIIL+ VT RTDWVKEVE A +RL+QW+    PLL
Sbjct  159  YVLGFTYDMGARGIWTGMIGGTLMQTIILVIVTFRTDWVKEVEKASRRLDQWE-DTSPLL  217

Query  390  PK  385
             +
Sbjct  218  KQ  219



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA+AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  390  FTEGETVANAVSHLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  449

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             +LGF F+LGAKGIW GMIGGT+MQTIILLWVT RTDW KEV  A  RL +WD ++E
Sbjct  450  CLLGFKFDLGAKGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEKWDDRQE  506



>emb|CDX98713.1| BnaA03g44980D [Brassica napus]
Length=455

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VG+PVG
Sbjct  336  FTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGIPVG  395

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K  
Sbjct  396  CILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKES  452



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 84/122 (69%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQTFVA VNVGCYY++G+P+G
Sbjct  384  FTEGEKVSAAVSDLCPLLAVTLILNGIQPVLSGVAVGCGWQTFVAKVNVGCYYIIGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A KRL+ W  K+  ++
Sbjct  444  ALFGFYFKYDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASKRLDIWSNKKAEVI  503

Query  390  PK  385
              
Sbjct  504  SN  505



>emb|CDX98712.1| BnaA03g44970D [Brassica napus]
Length=507

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 101/119 (85%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  387  FTSDADVAKAVSDLCPFLAVTVILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPIG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             VLGF FNL AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K+  L
Sbjct  447  CVLGFTFNLQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKKNSL  505



>ref|XP_009137228.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=400

 Score =   144 bits (363),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VG+PVG
Sbjct  281  FTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGIPVG  340

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A+KRL+ WD K  
Sbjct  341  CILGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKARKRLDMWDDKES  397



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V++AVSDL P LA+++VLNG+QPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G
Sbjct  383  FTEGETVSNAVSDLSPYLAISIVLNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIIGIPLG  442

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREP  397
             +LGF F+ GA+GIW GMIGGT +QTIIL+WVT RTDW KEVE A+ RLN ++ K+EP
Sbjct  443  CLLGFKFDFGAQGIWTGMIGGTFIQTIILVWVTYRTDWNKEVEKAQSRLNTYEDKKEP  500



>ref|XP_009135444.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=497

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT  + VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VG+PVG
Sbjct  382  FTADDEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGIPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A KRL+ WD K+
Sbjct  442  CLLGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKANKRLDMWDDKK  497



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GE VA AVS L P LA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  387  FTSGETVAKAVSKLTPYLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  446

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD----AKR  403
             VLGF F+LGA+GIW GMIGGT MQTIILLWVT RTDW+KEV  ++ RL +WD     ++
Sbjct  447  CVLGFKFDLGAQGIWSGMIGGTFMQTIILLWVTFRTDWIKEVGTSRDRLEKWDDSNKQQQ  506

Query  402  EPLL  391
            +PLL
Sbjct  507  QPLL  510



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/130 (67%), Positives = 106/130 (82%), Gaps = 10/130 (8%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVS L PLLA+TL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYY+VG+P+G
Sbjct  391  FTEGEDVSRAVSKLTPLLAVTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYIVGIPLG  450

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEV----------AKKRLN  421
             +LGFYF+LGA GIW GMIGGT MQT+IL+WVT RT+W KEV++          A+KRLN
Sbjct  451  CLLGFYFDLGAAGIWSGMIGGTFMQTLILVWVTYRTNWTKEVQIAITYSNLVEEAQKRLN  510

Query  420  QWDAKREPLL  391
            +W+  + PLL
Sbjct  511  KWNDSKAPLL  520



>emb|CDX79109.1| BnaA01g11760D [Brassica napus]
Length=497

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/116 (75%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT  + VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQTFVAYVNVGCYY+VG+PVG
Sbjct  382  FTADDEVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTFVAYVNVGCYYIVGIPVG  441

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKR  403
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE A KRL+ WD K+
Sbjct  442  CLLGFTFNFQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVEKANKRLDMWDDKK  497



>ref|XP_006282967.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
 gb|EOA15865.1| hypothetical protein CARUB_v10007727mg [Capsella rubella]
Length=505

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 87/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT    VA AVSDLCP LA+T++LNG+QPVLSGVAVGCGWQT+VAYVNVGCYY+VG+PVG
Sbjct  384  FTSDADVAKAVSDLCPFLAVTIILNGIQPVLSGVAVGCGWQTYVAYVNVGCYYIVGIPVG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             +LGF FN  AKGIW GMIGGT+MQT+ILL+VT RTDW KEVE AKKRL+ WD  +E
Sbjct  444  CILGFTFNYQAKGIWTGMIGGTLMQTLILLYVTYRTDWDKEVETAKKRLDMWDDVKE  500



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 96/120 (80%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GEVVA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQT VAY+NVGCYY VGVP+G
Sbjct  376  FTEGEVVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQTLVAYINVGCYYAVGVPLG  435

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            ++LGFYF LG KGIW GMIGGTVMQT+IL W+T RTDW KEVE A KRL++WDA +EP+L
Sbjct  436  SLLGFYFKLGVKGIWLGMIGGTVMQTLILFWITFRTDWNKEVEEATKRLSKWDASKEPIL  495



>ref|XP_006417328.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
 gb|ESQ35681.1| hypothetical protein EUTSA_v10007409mg [Eutrema salsugineum]
Length=507

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTD  VVA+AV++L P LA+T+VLNGVQPVLSGVAVGCGWQ FVAYVN+GCYY+VG+P+G
Sbjct  386  FTDSPVVAEAVAELAPYLAITIVLNGVQPVLSGVAVGCGWQAFVAYVNIGCYYIVGIPIG  445

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF +++GA GIW GMIGGT+MQTIILL VT RTDW KEVE A +RL+QW+  + PLL
Sbjct  446  YVLGFTYDMGAMGIWTGMIGGTLMQTIILLIVTFRTDWDKEVEKASRRLDQWEDTQAPLL  505

Query  390  PK  385
             +
Sbjct  506  KQ  507



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 104/120 (87%), Gaps = 1/120 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            +TDG+ VA AVS L PLLALTL+LNG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  390  YTDGDDVAQAVSKLTPLLALTLILNGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  449

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEV  + KRL++W+ K  PLL
Sbjct  450  CLLGFYFDLGAAGIWSGMIGGTLMQTLILVWVTFRTNWNKEVAESMKRLHKWEGK-TPLL  508



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VADAVS+L P LA++++LNG+QPVL+GVAVGCGWQ FVAYVNVGC+Y VG+P+G
Sbjct  392  FTSGSTVADAVSELSPYLAISVLLNGIQPVLTGVAVGCGWQAFVAYVNVGCFYFVGIPLG  451

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             VLGF F+ GAKGIW GM+GGTV+QT+IL++VT RTDW KEVE  + RL++W+ K+EPLL
Sbjct  452  CVLGFKFDFGAKGIWSGMMGGTVIQTLILMYVTFRTDWTKEVEKTRNRLDRWEDKKEPLL  511



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 101/119 (85%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE VA AVSDLCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+GCYYVVGVP G
Sbjct  394  FTEGEAVAAAVSDLCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIGCYYVVGVPFG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
            A+LGFYF LGAKGIW GM+GGT+MQT+ILLWVTIRTDW KEVE AKKRLN+WD K EPL
Sbjct  454  ALLGFYFKLGAKGIWLGMVGGTLMQTLILLWVTIRTDWNKEVEEAKKRLNKWDVK-EPL  511



>gb|EMT20038.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=456

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 88/120 (73%), Positives = 103/120 (86%), Gaps = 1/120 (1%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            + DGE VA  VS L PLLALT++LNG+QPVLSG+AVGCGWQ FVAYVNVGCYYVVGVP+G
Sbjct  334  YADGEDVAAEVSKLTPLLALTVILNGIQPVLSGMAVGCGWQAFVAYVNVGCYYVVGVPLG  393

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGFYF+LGA GIWCGMIGGT MQT+IL+WVTIRT+W  EV  A KRL++W+ K+ PLL
Sbjct  394  CLLGFYFDLGAAGIWCGMIGGTFMQTVILVWVTIRTNWDSEVAEAMKRLHKWEDKK-PLL  452



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+ AV+ L PLLA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G
Sbjct  394  FTEGDDVSRAVAQLSPLLAVTLILNGIQPVLSGVAVGCGWQALVAYVNVGCYYIVGIPLG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  454  CLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/119 (70%), Positives = 104/119 (87%), Gaps = 0/119 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G+ V+ AV+ L PLLA+TL+LNG+QPVLSGVAVGCGWQ  VAYVNVGCYY+VG+P+G
Sbjct  394  FTEGDDVSRAVAQLSPLLAVTLILNGIQPVLSGVAVGCGWQALVAYVNVGCYYIVGIPLG  453

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPL  394
             +LGFYF+LGA GIW GMIGGT+MQT+IL+WVT RT+W KEVE A+KRLN+W+  + P+
Sbjct  454  CLLGFYFDLGAAGIWSGMIGGTLMQTMILVWVTFRTNWNKEVEEAQKRLNKWEDSKAPV  512



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 101/122 (83%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+GE V+ AVSDLCPLLA+TL+LNG+QPVLSGVAVGCGWQ FVA VNVGCYY++G+P+G
Sbjct  384  FTEGEKVSAAVSDLCPLLAVTLILNGIQPVLSGVAVGCGWQMFVAKVNVGCYYIIGIPLG  443

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
            A+ GFYF   AKGIW GMI GT++QT+IL WVT RTDW KEVE A +RL+ W  K+  ++
Sbjct  444  ALFGFYFKYDAKGIWTGMICGTLIQTVILAWVTFRTDWTKEVEEASRRLDIWSNKKAEVI  503

Query  390  PK  385
             K
Sbjct  504  SK  505



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   144 bits (363),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FTDGE VA+AVS L P LA+TL++NG+QPVLSGVAVGCGWQ FVAYVNVGCYYVVG+P+G
Sbjct  390  FTDGETVANAVSHLTPYLAVTLIINGIQPVLSGVAVGCGWQAFVAYVNVGCYYVVGIPLG  449

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKRE  400
             +LGF F+ GA+GIW GMIGGT+MQTIILLWVT RTDW KEV  A  RL +WD ++E
Sbjct  450  CLLGFKFDFGAEGIWTGMIGGTLMQTIILLWVTFRTDWNKEVGTAINRLEKWDDRKE  506



>ref|XP_006449717.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62957.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=397

 Score =   142 bits (359),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT G  VAD+V++L P LA +++LNGVQPVLSGVAVGCGWQ FVAYVNVGCYY++G+P+G
Sbjct  276  FTGGSTVADSVAELSPFLAFSVILNGVQPVLSGVAVGCGWQAFVAYVNVGCYYLIGIPIG  335

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FNLGAKGIW GMIGGT++QTIIL++VT+RTDW KEVE A+ R+++W  K E LL
Sbjct  336  CLLGFKFNLGAKGIWSGMIGGTLIQTIILVYVTLRTDWNKEVEKARNRMDEWGDKTEQLL  395

Query  390  PK  385
             +
Sbjct  396  KE  397



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G
Sbjct  380  FTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIACYYIVGIPLG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  440  CLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA VNV CYY VG+P+G
Sbjct  380  FTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVACVNVCCYYFVGLPLG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A KR+N+W+
Sbjct  440  VLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAVKRINKWN  492



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 95/113 (84%), Gaps = 0/113 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT+G  VA AVSDLCP LA+TL+LNG+QPVLSGVAVGCGWQ+FVA VNV CYY VG+P+G
Sbjct  380  FTEGATVAAAVSDLCPFLAITLILNGIQPVLSGVAVGCGWQSFVACVNVCCYYFVGLPLG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWD  412
             +LGFYF LGAKGIW GM+ GT +QT IL WVT RTDW KEVE A KR+N+W+
Sbjct  440  VLLGFYFKLGAKGIWLGMLSGTAIQTCILSWVTFRTDWNKEVEEAVKRINKWN  492



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G
Sbjct  380  FTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIACYYIVGIPLG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  440  CLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 108/120 (90%), Gaps = 0/120 (0%)
 Frame = -1

Query  750  FTDGEVVADAVSDLCPLLALTLVLNGVQPVLSGVAVGCGWQTFvayvnvgcyyvvgvpvg  571
            FT GEVVA+AVS+LCPLLALTL+LNGVQPVLSGVAVGCGWQ FVAYVN+ CYY+VG+P+G
Sbjct  380  FTSGEVVANAVSELCPLLALTLLLNGVQPVLSGVAVGCGWQAFVAYVNIACYYIVGIPLG  439

Query  570  aVLGFYFNLGAKGIWCGMIGGTVMQTIILLWVTIRTDWVKEVEVAKKRLNQWDAKREPLL  391
             +LGF FN GAKGIW GMIGGT MQTIILLWVTIRTDW KEVE AK RL++W+ K++PLL
Sbjct  440  CLLGFKFNFGAKGIWSGMIGGTAMQTIILLWVTIRTDWKKEVEKAKMRLDKWEDKQQPLL  499



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1387667965840