BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037B15

Length=647
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AFY26882.1|  catalase                                                291   1e-96   Ipomoea batatas [batate]
sp|P07145.1|CATA_IPOBA  RecName: Full=Catalase                          290   5e-92   Ipomoea batatas [batate]
gb|ADB03784.1|  catalase                                                290   6e-92   Ipomoea batatas [batate]
ref|XP_009624788.1|  PREDICTED: catalase isozyme 3                      244   3e-74   Nicotiana tomentosiformis
ref|XP_010907090.1|  PREDICTED: catalase isozyme 1-like                 239   3e-72   Elaeis guineensis
gb|ABY19573.1|  catalase                                                232   3e-72   Manihot esculenta [manioc]
dbj|BAH20283.1|  AT1G20620                                              228   3e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009794469.1|  PREDICTED: catalase isozyme 3                      239   4e-72   Nicotiana sylvestris
gb|AGC65520.1|  catalase                                                238   5e-72   Eriobotrya japonica [loquat]
gb|AAX84671.1|  catalase CAT2                                           231   5e-72   Manihot esculenta [manioc]
ref|XP_006473789.1|  PREDICTED: catalase-like isoform X1                238   5e-72   Citrus sinensis [apfelsine]
ref|XP_008237987.1|  PREDICTED: catalase isozyme 1                      238   6e-72   Prunus mume [ume]
ref|XP_006435361.1|  hypothetical protein CICLE_v10000948mg             238   7e-72   Citrus clementina [clementine]
emb|CAD42908.1|  catalase                                               238   8e-72   Prunus persica
ref|XP_007209948.1|  hypothetical protein PRUPE_ppa004776mg             238   8e-72   Prunus persica
gb|AFR42410.1|  catalase                                                226   9e-72   Eperua falcata
emb|CAB56850.1|  catalase                                               235   1e-71   Prunus persica
ref|NP_001289779.1|  catalase isozyme 1                                 237   1e-71   Nelumbo nucifera [Indian lotus]
gb|ABR15776.1|  catalase                                                231   2e-71   Litchi
gb|KJB57963.1|  hypothetical protein B456_009G187600                    236   6e-71   Gossypium raimondii
ref|XP_010061172.1|  PREDICTED: catalase isozyme 3-like                 235   6e-71   Eucalyptus grandis [rose gum]
ref|XP_008348924.1|  PREDICTED: catalase isozyme 1                      235   6e-71   
sp|P49317.1|CATA3_NICPL  RecName: Full=Catalase isozyme 3               235   7e-71   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
sp|Q9AXH0.1|CATA_AVIMR  RecName: Full=Catalase                          235   7e-71   Avicennia marina
ref|XP_010536470.1|  PREDICTED: catalase-2-like                         235   8e-71   Tarenaya hassleriana [spider flower]
ref|XP_008365915.1|  PREDICTED: catalase isozyme 1                      235   8e-71   
ref|XP_009413057.1|  PREDICTED: catalase isozyme 2-like                 235   1e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009600533.1|  PREDICTED: catalase isozyme 3-like                 234   1e-70   Nicotiana tomentosiformis
ref|XP_008237989.1|  PREDICTED: catalase isozyme 1-like                 234   1e-70   Prunus mume [ume]
ref|XP_011041225.1|  PREDICTED: catalase isozyme 1                      234   2e-70   Populus euphratica
ref|XP_002306976.2|  catalase family protein                            234   2e-70   
ref|XP_010918244.1|  PREDICTED: catalase isozyme 1                      234   2e-70   Elaeis guineensis
ref|XP_010061175.1|  PREDICTED: catalase-like                           234   3e-70   Eucalyptus grandis [rose gum]
dbj|BAF91369.1|  catalase                                               234   3e-70   Capsicum annuum
ref|XP_010242894.1|  PREDICTED: catalase isozyme 1-like isoform X1      234   3e-70   Nelumbo nucifera [Indian lotus]
gb|AFR42412.1|  catalase                                                222   3e-70   Eperua falcata
gb|AAM97542.1|  catalase 3                                              233   4e-70   Capsicum annuum
gb|KJB14249.1|  hypothetical protein B456_002G115900                    229   4e-70   Gossypium raimondii
gb|AAB88173.1|  catalase                                                228   4e-70   Glycine max [soybeans]
ref|XP_009773579.1|  PREDICTED: catalase isozyme 3-like                 233   5e-70   Nicotiana sylvestris
gb|AIS20825.1|  CAT                                                     233   5e-70   Pyrus x bretschneideri [bai li]
ref|XP_009400996.1|  PREDICTED: catalase isozyme 2                      233   6e-70   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07287.1|  unnamed protein product                                233   7e-70   Coffea canephora [robusta coffee]
ref|XP_008373403.1|  PREDICTED: catalase isozyme 1                      233   8e-70   
sp|Q9M5L6.1|CATA_CAPAN  RecName: Full=Catalase; AltName: Full=CaCat1    232   1e-69   Capsicum annuum
emb|CAD42909.1|  catalase                                               232   1e-69   Prunus persica
ref|XP_008802866.1|  PREDICTED: catalase isozyme 1                      232   1e-69   Phoenix dactylifera
ref|XP_007210576.1|  hypothetical protein PRUPE_ppa004763mg             232   1e-69   Prunus persica
ref|XP_010061174.1|  PREDICTED: catalase isozyme 3-like isoform X2      232   1e-69   Eucalyptus grandis [rose gum]
gb|AIX10947.1|  putative catalase                                       232   1e-69   Gardenia jasminoides
emb|CAI43948.1|  catalase                                               232   2e-69   Populus deltoides
ref|XP_002301920.1|  catalase family protein                            232   2e-69   Populus trichocarpa [western balsam poplar]
gb|KCW68095.1|  hypothetical protein EUGRSUZ_F01777                     234   2e-69   Eucalyptus grandis [rose gum]
ref|XP_008789355.1|  PREDICTED: catalase isozyme 1-like                 231   2e-69   Phoenix dactylifera
ref|XP_010498496.1|  PREDICTED: catalase-3                              231   2e-69   Camelina sativa [gold-of-pleasure]
gb|AEQ30070.1|  catalase                                                231   2e-69   Litchi chinensis [litchi]
ref|XP_009110221.1|  PREDICTED: catalase-3                              231   2e-69   Brassica rapa
gb|ACJ11733.1|  catalase                                                231   3e-69   Gossypium hirsutum [American cotton]
ref|XP_011034872.1|  PREDICTED: catalase isozyme 1-like                 231   3e-69   Populus euphratica
gb|AAA57551.1|  catalase                                                228   3e-69   Nicotiana sylvestris
ref|NP_001031072.3|  catalase 3                                         227   5e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44175.1|  hypothetical protein AALP_AA1G224300                    230   5e-69   Arabis alpina [alpine rockcress]
emb|CDP07288.1|  unnamed protein product                                230   5e-69   Coffea canephora [robusta coffee]
gb|ACJ76836.3|  catalase                                                230   5e-69   Dimocarpus longan [longan]
ref|XP_011074091.1|  PREDICTED: catalase isozyme 3 isoform X2           230   6e-69   
emb|CDY31488.1|  BnaC05g15970D                                          231   6e-69   Brassica napus [oilseed rape]
gb|AJE26131.1|  catalase                                                230   6e-69   Salix matsudana [tortured willow]
emb|CDY33636.1|  BnaC08g19360D                                          230   6e-69   Brassica napus [oilseed rape]
ref|XP_011074092.1|  PREDICTED: catalase isozyme 3 isoform X3           230   6e-69   Sesamum indicum [beniseed]
emb|CDY29519.1|  BnaA06g14510D                                          230   6e-69   Brassica napus [oilseed rape]
ref|XP_009103334.1|  PREDICTED: catalase-3-like                         230   6e-69   Brassica rapa
gb|AGE15298.2|  catalase 1                                              229   1e-68   Eriobotrya japonica [loquat]
ref|XP_009149539.1|  PREDICTED: catalase-3                              231   1e-68   Brassica rapa
emb|CAC04509.1|  catalase                                               223   1e-68   Digitalis lanata [Grecian foxglove]
gb|KHG25152.1|  Catalase isozyme 1                                      229   1e-68   Gossypium arboreum [tree cotton]
sp|O24339.1|CATA_SOLAP  RecName: Full=Catalase                          229   1e-68   Soldanella alpina
sp|P55311.1|CATA_SOLME  RecName: Full=Catalase                          229   1e-68   Solanum melongena [aubergine]
gb|ADC95629.1|  catalase                                                229   1e-68   Bruguiera gymnorhiza [Burma mangrove]
ref|XP_006828714.1|  hypothetical protein AMTR_s00001p00022550          229   1e-68   Amborella trichopoda
ref|NP_001268098.1|  catalase                                           229   1e-68   Vitis vinifera
ref|XP_003631925.1|  PREDICTED: catalase isozyme 1-like                 229   1e-68   Vitis vinifera
ref|XP_009590727.1|  PREDICTED: catalase isozyme 1                      229   2e-68   Nicotiana tomentosiformis
gb|ACJ73905.1|  CAT1                                                    219   2e-68   Solanum nigrum
gb|KJB14250.1|  hypothetical protein B456_002G115900                    229   2e-68   Gossypium raimondii
gb|AET97564.1|  catalase                                                229   2e-68   Ziziphus jujuba [Chinese jujube]
emb|CDY01364.1|  BnaA07g11370D                                          231   2e-68   
dbj|BAH20307.1|  AT1G20620                                              228   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54297.1|  peroxisomal catalase                                    229   2e-68   Phaseolus vulgaris [French bean]
dbj|BAJ33995.1|  unnamed protein product                                229   2e-68   Eutrema halophilum
ref|XP_006412153.1|  hypothetical protein EUTSA_v10024932mg             229   2e-68   Eutrema salsugineum [saltwater cress]
sp|P49319.2|CATA1_TOBAC  RecName: Full=Catalase isozyme 1; AltNam...    229   2e-68   Nicotiana tabacum [American tobacco]
ref|NP_001237571.1|  catalase-4                                         229   2e-68   Glycine max [soybeans]
ref|XP_009792372.1|  PREDICTED: catalase isozyme 1                      229   2e-68   Nicotiana sylvestris
ref|XP_007136018.1|  hypothetical protein PHAVU_009G011100g             229   2e-68   Phaseolus vulgaris [French bean]
gb|AHF27428.1|  catalase                                                224   2e-68   Cucurbita moschata [ayote]
gb|AAR84578.1|  catalase 1a                                             228   3e-68   Lotus japonicus
ref|XP_010530333.1|  PREDICTED: catalase-2                              228   3e-68   Tarenaya hassleriana [spider flower]
emb|CDY31878.1|  BnaC07g15280D                                          228   3e-68   Brassica napus [oilseed rape]
ref|NP_564120.1|  catalase 3                                            228   4e-68   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC79443.1|  catalase                                               228   4e-68   Acacia ampliceps
gb|AIA61608.1|  catalase                                                228   4e-68   Gynostemma pentaphyllum [jiaogulan]
ref|XP_006435363.1|  hypothetical protein CICLE_v10000951mg             228   4e-68   Citrus clementina [clementine]
gb|AAM65021.1|  unknown                                                 228   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010663966.1|  PREDICTED: catalase isozyme 1                      228   4e-68   Vitis vinifera
ref|NP_001240021.1|  catalase                                           228   4e-68   Glycine max [soybeans]
ref|XP_006473794.1|  PREDICTED: catalase isozyme 1-like isoform X4      228   4e-68   Citrus sinensis [apfelsine]
ref|XP_006473791.1|  PREDICTED: catalase isozyme 1-like isoform X1      228   5e-68   
gb|ACV30589.1|  catalase                                                218   6e-68   Carica papaya [mamon]
ref|XP_006828715.1|  hypothetical protein AMTR_s00001p00024160          228   7e-68   Amborella trichopoda
ref|XP_004238430.1|  PREDICTED: catalase isozyme 3                      227   7e-68   Solanum lycopersicum
dbj|BAQ21275.1|  catalase                                               227   8e-68   Citrus tamurana
ref|XP_007160597.1|  hypothetical protein PHAVU_001G001000g             227   9e-68   Phaseolus vulgaris [French bean]
gb|ABM47415.1|  catalase                                                227   1e-67   Prunus avium [gean]
ref|XP_007018034.1|  Catalase 2                                         227   1e-67   
ref|XP_008452956.1|  PREDICTED: catalase isozyme 1                      227   1e-67   Cucumis melo [Oriental melon]
gb|AAF19965.1|AF207906_1  catalase 1                                    227   1e-67   Zantedeschia aethiopica [arum-lily]
gb|AAG43363.1|AF151368_1  catalase                                      227   1e-67   Hevea brasiliensis [jebe]
gb|AAD50974.1|AF170272_1  catalase CAT1                                 227   1e-67   Manihot esculenta [manioc]
ref|NP_001291326.1|  catalase isozyme 1                                 227   1e-67   Sesamum indicum [beniseed]
sp|P17598.2|CATA1_GOSHI  RecName: Full=Catalase isozyme 1               227   1e-67   Gossypium hirsutum [American cotton]
gb|ACL27272.1|  catalase                                                226   1e-67   Nicotiana benthamiana
gb|AFU48609.1|  catalase 1                                              226   2e-67   Nicotiana benthamiana
ref|NP_001237556.1|  catalase-1/2                                       226   2e-67   Glycine max [soybeans]
emb|CCP37650.1|  catalase-1                                             226   2e-67   Nicotiana tabacum [American tobacco]
ref|XP_006306495.1|  hypothetical protein CARUB_v10012481mg             226   2e-67   Capsella rubella
sp|P49316.1|CATA2_NICPL  RecName: Full=Catalase isozyme 2               226   2e-67   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|ACV92695.1|  catalase                                                226   2e-67   Brassica oleracea
gb|AFU90822.1|  catalase                                                226   3e-67   Populus tomentosa [Chinese white poplar]
ref|XP_002867092.1|  hypothetical protein ARALYDRAFT_491144             226   3e-67   
gb|AAB62892.1|  catalase-1                                              226   3e-67   Nicotiana glutinosa
ref|XP_006283612.1|  hypothetical protein CARUB_v10004668mg             226   3e-67   Capsella rubella
emb|CDX76313.1|  BnaA08g10870D                                          225   4e-67   
gb|AFU90823.1|  catalase                                                224   4e-67   Populus x beijingensis
ref|XP_010941422.1|  PREDICTED: catalase isozyme B                      225   4e-67   Elaeis guineensis
gb|AAB71764.1|  catalase 1                                              225   4e-67   Nicotiana tabacum [American tobacco]
emb|CAA64220.1|  catalase                                               225   4e-67   Arabidopsis thaliana [mouse-ear cress]
gb|AAZ29552.1|  catalase-C                                              226   4e-67   Oryza sativa Indica Group [Indian rice]
gb|AAB86582.2|  catalase                                                225   4e-67   Raphanus sativus
gb|AAF71742.1|AF248491_1  catalase                                      225   4e-67   Raphanus sativus
sp|Q01297.2|CATA1_RICCO  RecName: Full=Catalase isozyme 1               225   5e-67   Ricinus communis
sp|P45739.1|CATA_HELAN  RecName: Full=Catalase                          225   5e-67   Helianthus annuus
gb|AAK96854.1|  catalase                                                225   5e-67   Arabidopsis thaliana [mouse-ear cress]
prf||2104177A  catalase                                                 225   5e-67
ref|XP_006342134.1|  PREDICTED: catalase isozyme 3-like                 225   5e-67   Solanum tuberosum [potatoes]
sp|P49315.1|CATA1_NICPL  RecName: Full=Catalase isozyme 1               225   5e-67   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011074090.1|  PREDICTED: catalase isoform X1                     226   5e-67   Sesamum indicum [beniseed]
prf||1906388A  catalase                                                 225   5e-67
gb|AAD30292.1|AF139539_1  catalase 3                                    225   5e-67   Raphanus sativus
ref|NP_195235.1|  catalase 2                                            225   5e-67   Arabidopsis thaliana [mouse-ear cress]
emb|CAA45564.1|  catalase                                               225   5e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523643.1|  PREDICTED: catalase-2-like                         225   6e-67   Tarenaya hassleriana [spider flower]
gb|AAD17935.1|  catalase                                                225   6e-67   Brassica juncea [brown mustard]
gb|KFK30147.1|  catalase                                                225   7e-67   Arabis alpina [alpine rockcress]
emb|CDY40645.1|  BnaA03g53180D                                          224   7e-67   Brassica napus [oilseed rape]
ref|XP_010094556.1|  Catalase isozyme 1                                 225   7e-67   Morus notabilis
gb|AAD30291.2|AF139538_1  catalase 2                                    225   7e-67   Raphanus sativus
ref|XP_009138342.1|  PREDICTED: catalase-2                              225   7e-67   Brassica rapa
dbj|BAA34205.1|  catalase                                               225   7e-67   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048861.1|  Os03g0131200                                       224   9e-67   
gb|KGN55499.1|  hypothetical protein Csa_4G658590                       224   9e-67   Cucumis sativus [cucumbers]
sp|P48350.1|CATA1_CUCPE  RecName: Full=Catalase isozyme 1               224   1e-66   Cucurbita pepo
gb|AAD17936.1|  catalase                                                224   1e-66   Brassica juncea [brown mustard]
gb|ACA50528.1|  putative catalase 2                                     224   1e-66   Brassica napus [oilseed rape]
ref|XP_010536468.1|  PREDICTED: catalase-3-like                         224   1e-66   Tarenaya hassleriana [spider flower]
sp|P32290.1|CATA_VIGRR  RecName: Full=Catalase                          224   1e-66   Vigna radiata var. radiata [golden gram]
gb|AAC48918.1|  salicylic acid binding catalase                         224   2e-66   Nicotiana tabacum [American tobacco]
ref|XP_009106100.1|  PREDICTED: catalase-2                              224   2e-66   Brassica rapa
gb|AHF27433.1|  catalase                                                224   2e-66   Cucurbita maxima [Boston marrow]
gb|AHF27430.1|  catalase                                                224   2e-66   Cucurbita moschata [ayote]
ref|XP_006382992.1|  hypothetical protein POPTR_0005s10340g             224   2e-66   
ref|XP_009794245.1|  PREDICTED: catalase isozyme 1                      224   2e-66   Nicotiana sylvestris
emb|CDP01803.1|  unnamed protein product                                224   2e-66   Coffea canephora [robusta coffee]
ref|XP_004500876.1|  PREDICTED: catalase-4-like isoform X1              224   2e-66   
emb|CDY17510.1|  BnaC03g65530D                                          223   2e-66   Brassica napus [oilseed rape]
ref|NP_001235974.1|  catalase-3                                         224   2e-66   Glycine max [soybeans]
ref|XP_002306427.1|  hypothetical protein POPTR_0005s10340g             224   2e-66   Populus trichocarpa [western balsam poplar]
emb|CDX72514.1|  BnaC07g45360D                                          223   2e-66   
gb|EYU30275.1|  hypothetical protein MIMGU_mgv1a005250mg                224   2e-66   Erythranthe guttata [common monkey flower]
gb|ACJ22771.1|  catalase 1                                              224   2e-66   Jatropha curcas
gb|AAC49807.1|  catalase 3                                              223   2e-66   Arabidopsis thaliana [mouse-ear cress]
sp|P30567.1|CATA2_GOSHI  RecName: Full=Catalase isozyme 2               223   2e-66   Gossypium hirsutum [American cotton]
sp|P49318.1|CATA2_RICCO  RecName: Full=Catalase isozyme 2               223   2e-66   Ricinus communis
gb|KHG12976.1|  Catalase isozyme 2                                      223   2e-66   Gossypium arboreum [tree cotton]
ref|XP_004500877.1|  PREDICTED: catalase-4-like isoform X2              223   2e-66   Cicer arietinum [garbanzo]
gb|ACJ73906.1|  CAT2                                                    218   2e-66   Solanum nigrum
ref|NP_001234827.1|  catalase isozyme 1                                 223   3e-66   Solanum lycopersicum
gb|ABQ44283.1|  catalase                                                219   3e-66   Saccharum hybrid cultivar NCo 376
gb|ACB11496.1|  catalase                                                223   3e-66   Pinus sylvestris [Scotch pine]
gb|AAD37788.1|AF149283_1  catalase 1                                    221   3e-66   Phaseolus vulgaris [French bean]
ref|XP_010437527.1|  PREDICTED: catalase-2                              223   3e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010432341.1|  PREDICTED: catalase-2-like                         223   3e-66   Camelina sativa [gold-of-pleasure]
gb|AFW69584.1|  catalase1                                               219   3e-66   
ref|XP_009597278.1|  PREDICTED: catalase isozyme 1                      223   3e-66   Nicotiana tomentosiformis
dbj|BAJ87148.1|  predicted protein                                      218   4e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAR14052.2|  catalase                                                222   4e-66   Solanum tuberosum [potatoes]
ref|XP_011022275.1|  PREDICTED: catalase-like                           222   5e-66   Populus euphratica
emb|CDY52649.1|  BnaAnng11640D                                          221   5e-66   Brassica napus [oilseed rape]
ref|NP_001234186.1|  catalase isozyme 2                                 223   6e-66   
ref|XP_010934843.1|  PREDICTED: catalase isozyme 2                      222   7e-66   
ref|XP_007046520.1|  Catalase 2                                         222   7e-66   Theobroma cacao [chocolate]
ref|XP_011022153.1|  PREDICTED: catalase-2-like isoform X2              222   8e-66   Populus euphratica
ref|XP_006656514.1|  PREDICTED: catalase isozyme B-like                 222   9e-66   Oryza brachyantha
ref|XP_008791900.1|  PREDICTED: catalase isozyme 2                      222   1e-65   Phoenix dactylifera
ref|XP_006649332.1|  PREDICTED: catalase-1-like                         222   1e-65   Oryza brachyantha
ref|XP_011022152.1|  PREDICTED: catalase-2-like isoform X1              222   1e-65   Populus euphratica
gb|AAO17721.1|  catalase                                                222   1e-65   Hypericum perforatum
pir||S40265  catalase (EC 1.11.1.6) - eggplant                          222   1e-65
sp|A2YH64.2|CATA2_ORYSI  RecName: Full=Catalase isozyme B; Short=...    221   1e-65   Oryza sativa Indica Group [Indian rice]
gb|AAY59707.1|  catalase                                                221   1e-65   Oryza sativa Indica Group [Indian rice]
gb|AAC19397.1|  leaf catalase                                           221   2e-65   Mesembryanthemum crystallinum
gb|KDP43757.1|  hypothetical protein JCGZ_22384                         221   2e-65   Jatropha curcas
ref|XP_010446982.1|  PREDICTED: catalase-2-like                         221   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_008464839.1|  PREDICTED: catalase isozyme 3                      221   2e-65   Cucumis melo [Oriental melon]
ref|XP_006340832.1|  PREDICTED: catalase isozyme 2                      221   2e-65   Solanum tuberosum [potatoes]
emb|CAG23920.1|  catalase                                               221   2e-65   Festuca arundinacea [tall fescue]
gb|ABK24453.1|  unknown                                                 221   2e-65   Picea sitchensis
ref|XP_008452957.1|  PREDICTED: catalase isozyme 1-like                 221   2e-65   Cucumis melo [Oriental melon]
gb|ABC01913.1|  catalase isozyme 1-like protein                         221   2e-65   Solanum tuberosum [potatoes]
gb|ADZ45555.1|  catalase                                                221   3e-65   Vigna radiata [mung bean]
gb|AAF79625.1|AC027665_26  F5M15.5                                      227   3e-65   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA05494.1|  catalase                                               220   3e-65   Oryza sativa Japonica Group [Japonica rice]
dbj|BAA34204.1|  catalase                                               220   4e-65   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058635.1|  Os06g0727200                                       220   4e-65   
sp|Q43206.1|CATA1_WHEAT  RecName: Full=Catalase-1                       220   4e-65   Triticum aestivum [Canadian hard winter wheat]
gb|EMT05040.1|  Catalase-1                                              221   4e-65   
sp|P48352.1|CATA3_CUCPE  RecName: Full=Catalase isozyme 3               220   4e-65   Cucurbita pepo
ref|XP_004144240.1|  PREDICTED: catalase isozyme 3-like                 220   5e-65   
gb|AHF27429.1|  catalase                                                219   5e-65   Cucurbita moschata [ayote]
ref|XP_010534184.1|  PREDICTED: catalase isozyme 3-like                 220   5e-65   Tarenaya hassleriana [spider flower]
gb|AHF27432.1|  catalase                                                219   5e-65   Cucurbita maxima [Boston marrow]
gb|ADM96039.1|  catalase                                                220   5e-65   Cucumis sativus [cucumbers]
gb|AAM97541.1|  catalase 2                                              219   6e-65   Capsicum annuum
ref|XP_004158284.1|  PREDICTED: catalase isozyme 3-like                 220   6e-65   
gb|AAC17729.1|  catalase 1                                              217   6e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009108683.1|  PREDICTED: catalase-2-like isoform X2              220   6e-65   
gb|AHF21552.1|  catalase                                                219   7e-65   Hylocereus undatus [dragon fruit]
ref|NP_001274863.1|  catalase isozyme 1                                 219   7e-65   Solanum tuberosum [potatoes]
gb|ADZ45556.1|  catalase                                                219   7e-65   Vigna radiata [mung bean]
emb|CAA42720.1|  catalase-1                                             219   8e-65   Zea mays [maize]
gb|KJB17473.1|  hypothetical protein B456_003G002800                    219   8e-65   Gossypium raimondii
ref|NP_001241808.1|  catalase isozyme B                                 219   8e-65   Zea mays [maize]
sp|P49284.1|CATA1_SOLTU  RecName: Full=Catalase isozyme 1               219   9e-65   Solanum tuberosum [potatoes]
ref|XP_003558892.1|  PREDICTED: catalase-1                              219   9e-65   Brachypodium distachyon [annual false brome]
gb|AIU99479.1|  catalase                                                219   9e-65   Saccharum arundinaceum
sp|P48351.1|CATA2_CUCPE  RecName: Full=Catalase isozyme 2               219   1e-64   Cucurbita pepo
gb|AAD17933.1|  catalase                                                219   1e-64   Brassica juncea [brown mustard]
gb|AAR97905.1|  catalase                                                219   1e-64   Solanum tuberosum [potatoes]
sp|P55312.1|CATA2_SOLTU  RecName: Full=Catalase isozyme 2               219   1e-64   Solanum tuberosum [potatoes]
emb|CAA85470.1|  catalase                                               219   1e-64   Solanum tuberosum [potatoes]
gb|AFN81243.1|  catalase 1                                              219   1e-64   Brassica rapa subsp. pekinensis [bai cai]
dbj|BAJ90861.1|  predicted protein                                      219   2e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX69111.1|  BnaC01g03420D                                          218   2e-64   
gb|AFR53082.1|  CAT                                                     218   2e-64   Anthurium andraeanum [flamingo-lily]
gb|ACL35349.1|  catalase                                                218   2e-64   Picea glauca
ref|XP_002510677.1|  catalase, putative                                 225   2e-64   
ref|XP_002890395.1|  F5M15.5                                            225   2e-64   
gb|AIU99481.1|  catalase                                                218   2e-64   Saccharum spontaneum [fodder cane]
gb|AIU99488.1|  catalase                                                218   3e-64   Saccharum hybrid cultivar ROC22
gb|AIM43584.1|  catalase                                                218   3e-64   Saccharum hybrid cultivar Yacheng05-179
gb|AIU99484.1|  catalase                                                218   3e-64   Saccharum arundinaceum
gb|AIU99485.1|  catalase                                                218   3e-64   Saccharum spontaneum [fodder cane]
ref|XP_004985840.1|  PREDICTED: catalase-1-like                         218   4e-64   Setaria italica
dbj|BAJ88747.1|  predicted protein                                      219   4e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002437631.1|  hypothetical protein SORBIDRAFT_10g030840          218   4e-64   
sp|P55307.1|CATA1_HORVU  RecName: Full=Catalase isozyme 1               218   5e-64   Hordeum vulgare [barley]
ref|XP_003563243.1|  PREDICTED: catalase isozyme 1                      218   5e-64   Brachypodium distachyon [annual false brome]
ref|NP_001105415.1|  catalase isozyme 1                                 218   5e-64   
ref|XP_010692546.1|  PREDICTED: catalase                                217   5e-64   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN36234.1|  unknown                                                 213   6e-64   Zea mays [maize]
emb|CDP01802.1|  unnamed protein product                                216   6e-64   Coffea canephora [robusta coffee]
gb|AIZ77475.1|  catalase                                                217   7e-64   Triticum aestivum [Canadian hard winter wheat]
gb|KGN55500.1|  hypothetical protein Csa_4G658600                       214   9e-64   Cucumis sativus [cucumbers]
gb|AAK67359.2|AF390210_1  catalase                                      217   9e-64   Suaeda salsa
gb|AIU99480.1|  catalase                                                216   1e-63   Saccharum spontaneum [fodder cane]
gb|AIP93616.1|  CAT1                                                    216   1e-63   Bassia scoparia [burning bush]
gb|EYU36566.1|  hypothetical protein MIMGU_mgv1a005245mg                216   1e-63   Erythranthe guttata [common monkey flower]
gb|EPS69543.1|  catalase                                                216   2e-63   Genlisea aurea
ref|NP_564121.1|  catalase 1                                            216   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AAC17731.1|  catalase 1                                              216   2e-63   Arabidopsis thaliana [mouse-ear cress]
gb|AHA50082.1|  catalase                                                216   2e-63   
gb|KEH36312.1|  catalase heme-binding enzyme                            216   2e-63   
ref|XP_010063132.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    216   2e-63   
ref|XP_002521709.1|  catalase, putative                                 215   4e-63   
gb|AIU99486.1|  catalase                                                215   4e-63   
gb|AIU99482.1|  catalase                                                215   4e-63   
ref|XP_004966515.1|  PREDICTED: catalase isozyme 1-like                 216   4e-63   
gb|AIU99487.1|  catalase                                                214   7e-63   
ref|XP_006412154.1|  hypothetical protein EUTSA_v10024932mg             215   8e-63   
gb|ADU56199.1|  catalase                                                214   8e-63   
gb|AAF61732.1|AF243517_1  catalase 2                                    214   9e-63   
gb|KFK44176.1|  hypothetical protein AALP_AA1G224400                    214   1e-62   
ref|XP_009103333.1|  PREDICTED: catalase-1                              214   1e-62   
gb|AHB72694.1|  catalase                                                214   1e-62   
emb|CDY31877.1|  BnaC07g15270D                                          213   2e-62   
emb|CDY01363.1|  BnaA07g11360D                                          213   2e-62   
gb|AAB07026.1|  catalase 1                                              213   2e-62   
sp|P18122.1|CATA1_MAIZE  RecName: Full=Catalase isozyme 1               213   2e-62   
gb|ADU56198.1|  catalase                                                213   3e-62   
gb|AIU99483.1|  catalase                                                213   3e-62   
gb|AAG61140.2|AF332973_1  catalase 2                                    213   3e-62   
sp|P55313.1|CATA2_WHEAT  RecName: Full=Catalase                         213   3e-62   
tpg|DAA43177.1|  TPA: catalase2                                         213   4e-62   
sp|P12365.3|CATA2_MAIZE  RecName: Full=Catalase isozyme 2               212   6e-62   
ref|NP_001105310.1|  catalase isozyme 2                                 212   6e-62   
prf||1803522A  catalase                                                 212   6e-62
ref|XP_004145541.1|  PREDICTED: catalase isozyme 1-like                 218   7e-62   
ref|XP_004300681.1|  PREDICTED: catalase isozyme 1                      212   7e-62   
ref|XP_010692544.1|  PREDICTED: catalase-like                           211   9e-62   
emb|CAE82295.1|  catalase                                               211   1e-61   
gb|AAF61733.1|AF243518_1  catalase 3                                    211   2e-61   
ref|XP_006416378.1|  hypothetical protein EUTSA_v10007472mg             210   2e-61   
tpg|DAA43178.1|  TPA: catalase2                                         211   3e-61   
gb|ADN94253.1|  catalase                                                210   3e-61   
ref|XP_002963086.1|  hypothetical protein SELMODRAFT_438313             209   4e-61   
gb|AAL00886.1|  catalase                                                204   4e-61   
gb|ABB72796.1|  catalase isozyme 1-like protein                         210   4e-61   
gb|AAF61734.1|AF243519_1  catalase 4                                    209   6e-61   
ref|XP_009392261.1|  PREDICTED: catalase isozyme A-like isoform X2      209   6e-61   
gb|KHG21219.1|  Catalase isozyme 1                                      207   7e-61   
gb|ABV55108.1|  catalase 2                                              209   1e-60   
gb|AAC19398.1|  root catalase                                           208   1e-60   
ref|XP_009398521.1|  PREDICTED: catalase isozyme A                      208   2e-60   
gb|ACH63223.1|  catalase                                                208   2e-60   
ref|XP_002980247.1|  hypothetical protein SELMODRAFT_178171             207   2e-60   
ref|NP_001031073.1|  catalase 3                                         207   3e-60   
gb|ADK25939.1|  catalase                                                200   3e-60   
gb|ABY21704.1|  catalase-1 precursor                                    207   3e-60   
dbj|BAH37035.1|  catalase 1                                             206   7e-60   
ref|XP_002961779.1|  hypothetical protein SELMODRAFT_140901             206   8e-60   
emb|CAA10286.1|  catalase                                               195   8e-60   
dbj|BAA34714.1|  catalase                                               206   1e-59   
gb|AFD29285.1|  catalase                                                205   2e-59   
gb|KDO85095.1|  hypothetical protein CISIN_1g044386mg                   206   5e-59   
dbj|BAD07937.1|  catalase catA-like protein                             194   7e-59   
ref|XP_010061173.1|  PREDICTED: catalase isozyme 2-like isoform X1      204   8e-59   
gb|ACL81498.1|  catalase                                                202   3e-58   
sp|P25890.1|CATA_PEA  RecName: Full=Catalase                            202   4e-58   
emb|CDY29518.1|  BnaA06g14520D                                          201   6e-58   
emb|CDY31490.1|  BnaC05g15990D                                          201   6e-58   
ref|XP_009149540.1|  PREDICTED: catalase-1                              201   6e-58   
gb|AJF34884.1|  catalase                                                201   6e-58   
gb|AFI48111.1|  catalase isozyme B                                      189   2e-57   
gb|ABY68162.1|  catalase                                                189   3e-57   
gb|ABY68159.1|  catalase                                                188   4e-57   
ref|XP_010498497.1|  PREDICTED: catalase-1-like                         199   4e-57   
gb|ABY68158.1|  catalase                                                188   4e-57   
gb|ABY68164.1|  catalase                                                188   4e-57   
gb|AFI48054.1|  catalase isozyme B                                      187   1e-56   
gb|ABY68160.1|  catalase                                                187   1e-56   
ref|XP_001779509.1|  predicted protein                                  198   1e-56   
ref|XP_010459749.1|  PREDICTED: catalase-1-like                         197   2e-56   
gb|ABY68161.1|  catalase                                                186   2e-56   
ref|XP_010477308.1|  PREDICTED: catalase-1                              197   4e-56   
gb|AFI48068.1|  catalase isozyme B                                      186   5e-56   
gb|AFI48101.1|  catalase isozyme B                                      185   6e-56   
dbj|BAH56915.1|  AT1G20620                                              195   1e-55   
ref|XP_009108684.1|  PREDICTED: catalase-2-like isoform X3              194   2e-55   
gb|AFI48131.1|  catalase isozyme B                                      184   3e-55   
gb|AAC17730.1|  catalase 2                                              192   3e-55   
ref|XP_010105996.1|  Catalase isozyme 1                                 191   3e-55   
gb|AAX88799.1|  catalase                                                194   3e-55   
dbj|BAJ92414.1|  predicted protein                                      194   4e-55   
gb|ADY02963.1|  catalase                                                194   6e-55   
emb|CAH61266.1|  catalase                                               193   7e-55   
dbj|BAH19523.1|  AT4G35090                                              193   8e-55   
gb|EMS51034.1|  Catalase isozyme 2                                      194   8e-55   
gb|AFI48098.1|  catalase isozyme B                                      182   8e-55   
ref|NP_001031791.1|  catalase 2                                         193   8e-55   
ref|XP_006382986.1|  hypothetical protein POPTR_0005s10340g             194   9e-55   
sp|P55308.1|CATA2_HORVU  RecName: Full=Catalase isozyme 2               193   1e-54   
ref|XP_001752315.1|  predicted protein                                  192   1e-54   
ref|NP_001045673.1|  Os02g0115700                                       192   2e-54   
gb|EAZ21490.1|  hypothetical protein OsJ_05114                          192   3e-54   
gb|ABN71233.2|  catalase                                                192   3e-54   
gb|AFI48130.1|  catalase isozyme B                                      181   3e-54   
ref|XP_008778560.1|  PREDICTED: catalase isozyme 2-like                 191   4e-54   
emb|CBI29556.3|  unnamed protein product                                179   1e-53   
ref|XP_001784759.1|  predicted protein                                  190   1e-53   
gb|ABK24449.1|  unknown                                                 190   1e-53   
gb|EMS61345.1|  Catalase isozyme 1                                      191   2e-53   
gb|EMT06167.1|  Catalase isozyme 2                                      192   3e-53   
ref|XP_008812256.1|  PREDICTED: catalase isozyme B                      189   3e-53   
ref|XP_003573241.1|  PREDICTED: catalase isozyme 2                      189   4e-53   
ref|XP_004952158.1|  PREDICTED: catalase isozyme 3-like isoform X2      189   4e-53   
gb|ADQ28492.1|  catalase                                                188   5e-53   
ref|XP_005645077.1|  catalase                                           186   4e-52   
gb|AGI65617.1|  catalase                                                185   6e-52   
ref|XP_002453177.1|  hypothetical protein SORBIDRAFT_04g001130          184   1e-51   
gb|ABR16304.1|  unknown                                                 183   4e-51   
gb|ABK24543.1|  unknown                                                 183   5e-51   
gb|AGT16203.1|  catalase                                                182   7e-51   
gb|AFK46618.1|  unknown                                                 171   1e-50   
sp|P55310.1|CATA_SECCE  RecName: Full=Catalase                          182   1e-50   
ref|XP_006646781.1|  PREDICTED: LOW QUALITY PROTEIN: catalase iso...    182   1e-50   
pir||CSRZ  catalase (EC 1.11.1.6) catA - rice                           182   1e-50
gb|AII23739.1|  catalase                                                182   1e-50   
emb|CAA43814.1|  catalase                                               182   1e-50   
dbj|BAD94702.1|  catalase                                               168   2e-49   
gb|ABK41476.1|  catalase                                                179   2e-49   
ref|XP_005847557.1|  hypothetical protein CHLNCDRAFT_57817              176   1e-48   
gb|KIY96954.1|  catalase                                                172   5e-48   
gb|AGT16188.1|  catalase                                                173   2e-47   
gb|AGT16054.1|  catalase                                                173   3e-47   
gb|AGT15888.1|  catalase                                                173   3e-47   
gb|AGT16310.1|  catalase                                                173   3e-47   
sp|P18123.2|CATA3_MAIZE  RecName: Full=Catalase isozyme 3               173   3e-47   
gb|ABY68163.1|  catalase                                                162   3e-47   
gb|AFW66787.1|  catalase3                                               173   3e-47   
gb|AID50071.1|  catalase                                                163   4e-47   
gb|AHZ13843.1|  catalase                                                172   7e-47   
gb|KCW70315.1|  hypothetical protein EUGRSUZ_F03557                     171   2e-46   
gb|AFW66785.1|  catalase3 isoform 1                                     172   2e-46   
ref|XP_002950455.1|  catalase                                           166   9e-45   
gb|EMS35721.1|  Catalase isozyme 1                                      161   2e-44   
gb|AEY70510.1|  catalase                                                159   1e-43   
ref|XP_004952157.1|  PREDICTED: catalase isozyme 3-like isoform X1      163   1e-43   
ref|XP_001696763.1|  catalase/peroxidase                                163   2e-43   
ref|XP_011396830.1|  Catalase isozyme 2                                 162   2e-43   
ref|NP_001105416.1|  catalase isozyme 3                                 161   6e-43   
gb|AAA33441.1|  catalase isozyme 3 (EC 1.11.1.6)                        161   8e-43   
ref|XP_005708279.1|  catalase                                           160   2e-42   
emb|CAA73663.1|  catalase                                               159   3e-42   
gb|AAB70006.1|  catalase                                                159   3e-42   
gb|AFW66789.1|  catalase3                                               152   4e-41   
gb|AFW66788.1|  catalase3                                               152   1e-39   
pir||A55092  catalase (EC 1.11.1.6) CAT-2 - maize (fragment)            150   6e-39
ref|XP_006382990.1|  hypothetical protein POPTR_0005s10340g             149   2e-38   
gb|ABS72010.1|  putative catalase                                       138   5e-38   
gb|KJB10391.1|  hypothetical protein B456_001G198700                    147   6e-38   
ref|XP_002963084.1|  hypothetical protein SELMODRAFT_404656             140   7e-38   
ref|XP_009108682.1|  PREDICTED: catalase-2-like isoform X1              146   2e-37   
ref|XP_008365914.1|  PREDICTED: catalase isozyme 3-like                 137   3e-37   
gb|AAR84577.1|  catalase 1b                                             145   3e-37   
gb|ABB88582.1|  catalase                                                144   7e-37   
ref|XP_008348923.1|  PREDICTED: catalase isozyme 3-like                 135   2e-36   
ref|XP_009392260.1|  PREDICTED: catalase isozyme A-like isoform X1      141   1e-35   
emb|CAA42026.1|  catalase                                               132   2e-35   
gb|KJB17474.1|  hypothetical protein B456_003G002800                    139   7e-35   
gb|KDD77132.1|  catalase                                                137   3e-34   
ref|XP_002980252.1|  hypothetical protein SELMODRAFT_112333             121   4e-31   
gb|AAO16182.1|  catalase-1                                              121   5e-31   
emb|CDY43951.1|  BnaC04g21590D                                          122   2e-30   
emb|CDY31866.1|  BnaC07g15160D                                          122   2e-30   
ref|XP_005536240.1|  catalase                                           125   6e-30   
gb|AAP57673.1|  catalase                                                120   2e-29   
gb|AFH53190.1|  catalase                                                116   5e-28   
gb|AFH53189.1|  catalase                                                116   6e-28   
gb|AFH53187.1|  catalase                                                116   6e-28   
gb|ABB51561.1|  truncated catalase 2                                    119   7e-28   
gb|AGS17821.1|  catalase 2                                              115   4e-27   
ref|XP_005712277.1|  unnamed protein product                            117   6e-27   
ref|XP_006435362.1|  hypothetical protein CICLE_v10000948mg             112   1e-25   
ref|XP_010242895.1|  PREDICTED: catalase isozyme 1-like isoform X2      112   1e-25   
ref|XP_008348922.1|  PREDICTED: catalase isozyme 1-like                 110   5e-25   
ref|XP_008382478.1|  PREDICTED: catalase isozyme 1-like                 110   6e-25   
emb|CDP22058.1|  unnamed protein product                                104   4e-24   
gb|AFN85536.1|  catalase                                                100   7e-24   
ref|XP_006382987.1|  hypothetical protein POPTR_0005s10340g             107   1e-23   
gb|KJE89728.1|  catalase isozyme 2                                      107   2e-23   
ref|XP_004366029.2|  catalase isozyme 2                                 107   2e-23   
gb|ABR25882.1|  catalase isozyme b                                    98.6    6e-23   
gb|AAY34915.1|  catalase                                              97.1    2e-22   
gb|ACU23083.1|  unknown                                                 101   2e-22   
ref|NP_973873.1|  catalase 3                                            101   1e-21   
gb|KCW70319.1|  hypothetical protein EUGRSUZ_F03561                   99.0    5e-21   
ref|XP_005644653.1|  catalase-domain-containing protein               99.8    1e-20   
gb|KEH36313.1|  catalase heme-binding enzyme                          96.7    6e-20   
ref|XP_005647994.1|  catalase-domain-containing protein               96.7    1e-19   
ref|XP_002963082.1|  hypothetical protein SELMODRAFT_79329            90.1    1e-19   
gb|AEA86295.1|  putative catalase                                     91.3    4e-19   
gb|ABS89000.1|  catalase                                              89.4    2e-18   
gb|AFA36510.1|  catalase                                              88.6    9e-18   
gb|AAR25790.1|  catalase                                              85.5    1e-17   
ref|XP_005642928.1|  catalase                                         90.1    2e-17   
emb|CCQ26769.2|  perixode catalase                                    82.8    4e-17   
ref|WP_043830984.1|  catalase                                         88.6    8e-17   
ref|WP_044037961.1|  catalase                                         86.3    5e-16   
ref|WP_026826608.1|  catalase                                         85.9    6e-16   
gb|ADR01107.1|  catalase 3                                            84.7    6e-16   
ref|WP_037277190.1|  catalase                                         85.9    7e-16   
gb|AHB35639.1|  catalase                                              82.4    7e-16   
ref|WP_015881004.1|  catalase                                         85.1    1e-15   
ref|WP_016429054.1|  hypothetical protein                             84.7    2e-15   
ref|WP_029723487.1|  catalase                                         84.7    2e-15   
ref|WP_034418237.1|  catalase                                         84.0    3e-15   
ref|XP_006306503.1|  hypothetical protein CARUB_v10012491mg           80.5    4e-15   
ref|WP_033543820.1|  catalase                                         83.2    5e-15   
ref|WP_026673818.1|  catalase                                         83.2    5e-15   
ref|WP_003355010.1|  catalase                                         82.4    1e-14   
ref|WP_031421259.1|  catalase                                         82.0    1e-14   
ref|WP_006679508.1|  catalase                                         81.6    2e-14   
gb|ACJ71245.1|  catalase 2                                            80.5    2e-14   
ref|WP_032664185.1|  catalase                                         80.9    3e-14   
ref|WP_026688518.1|  catalase                                         80.9    4e-14   
gb|ACY30463.1|  catalase                                              79.3    4e-14   
ref|WP_024631056.1|  MULTISPECIES: catalase                           80.5    4e-14   
ref|WP_031254620.1|  catalase                                         80.5    5e-14   
ref|WP_027476258.1|  catalase                                         80.1    5e-14   
ref|WP_032632526.1|  catalase                                         80.1    6e-14   
ref|WP_032884665.1|  catalase                                         80.1    6e-14   



>gb|AFY26882.1| catalase, partial [Ipomoea batatas]
Length=173

 Score =   291 bits (744),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNYMLLPVNA KC +HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP
Sbjct  31   DTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  90

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
            LRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWIS
Sbjct  91   LRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWIS  150

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YLTQADRSLGQKVASRLNIRPTM
Sbjct  151  YLTQADRSLGQKVASRLNIRPTM  173



>sp|P07145.1|CATA_IPOBA RecName: Full=Catalase [Ipomoea batatas]
 emb|CAA29063.1| unnamed protein product [Ipomoea batatas]
Length=492

 Score =   290 bits (742),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNYMLLPVNA KC +HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP
Sbjct  350  DTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
            LRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWIS
Sbjct  410  LRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YLTQADRSLGQKVASRLNIRPTM
Sbjct  470  YLTQADRSLGQKVASRLNIRPTM  492



>gb|ADB03784.1| catalase [Ipomoea batatas]
Length=492

 Score =   290 bits (742),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 137/143 (96%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNYMLLPVNA KC +HNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP
Sbjct  350  DTHRHRLGPNYMLLPVNAPKCAHHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
            LRIVTG+RDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVK+LSEPRVTHEIRSTWIS
Sbjct  410  LRIVTGQRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKALSEPRVTHEIRSTWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YLTQADRSLGQKVASRLNIRPTM
Sbjct  470  YLTQADRSLGQKVASRLNIRPTM  492



>ref|XP_009624788.1| PREDICTED: catalase isozyme 3 [Nicotiana tomentosiformis]
Length=492

 Score =   244 bits (623),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
            LR++TG+RDKC++EKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  LRVLTGKRDKCIVEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLNIRPTM
Sbjct  470  YWSQADKSLGQKIASRLNIRPTM  492



>ref|XP_010907090.1| PREDICTED: catalase isozyme 1-like [Elaeis guineensis]
Length=492

 Score =   239 bits (609),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+TGRR+KCVI KENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT+EIR+ WIS
Sbjct  410  FRILTGRREKCVIHKENNFKQPGERYRSWAPDRQERFICRWVEALSDPRVTYEIRTIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q DRSLGQK+A+RLN++P+M
Sbjct  470  YWSQCDRSLGQKIATRLNVKPSM  492



>gb|ABY19573.1| catalase [Manihot esculenta]
Length=261

 Score =   232 bits (591),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY +LPVNA KC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P
Sbjct  119  DTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLP  178

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+S
Sbjct  179  HAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVS  238

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+ASRLN+RP  
Sbjct  239  YWSQCDKSLGQKLASRLNVRPNF  261



>dbj|BAH20283.1| AT1G20620 [Arabidopsis thaliana]
Length=145

 Score =   228 bits (580),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP
Sbjct  3    DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  62

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  63   TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  122

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  123  YWSQADRSLGQKLASRLNVRPSI  145



>ref|XP_009794469.1| PREDICTED: catalase isozyme 3 [Nicotiana sylvestris]
 emb|CCP37652.1| catalase-3 [Nicotiana tabacum]
Length=492

 Score =   239 bits (609),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PRVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD++LGQK+ASRLN+RPTM
Sbjct  470  YWSQADKTLGQKIASRLNVRPTM  492



>gb|AGC65520.1| catalase [Eriobotrya japonica]
 gb|AGC65522.1| catalase [Eriobotrya japonica]
 gb|AGC65523.1| catalase [Eriobotrya japonica]
 gb|AGC65524.1| catalase [Eriobotrya japonica]
 gb|AGE15297.2| catalase 2 [Eriobotrya japonica]
Length=492

 Score =   238 bits (608),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN YDG+MNF+HRDEEVDYFPS++   R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYQPARHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVT+EIRS WIS
Sbjct  410  SNIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS GQK+A+RLN+RP++
Sbjct  470  YWSQADRSFGQKLATRLNVRPSI  492



>gb|AAX84671.1| catalase CAT2, partial [Manihot esculenta]
Length=270

 Score =   231 bits (590),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY +LPVNA KC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P
Sbjct  128  DTQRHRLGPNYKMLPVNAPKCNYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERTPLP  187

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++GRR+KCVIEKENNFKQPGDRYRSW PDRQ+RF+ R V +LS+PR+THEIRS W+S
Sbjct  188  HAIISGRREKCVIEKENNFKQPGDRYRSWTPDRQERFLCRLVNALSDPRITHEIRSIWVS  247

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+ASRLN+RP  
Sbjct  248  YWSQCDKSLGQKLASRLNVRPNF  270



>ref|XP_006473789.1| PREDICTED: catalase-like isoform X1 [Citrus sinensis]
Length=477

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P
Sbjct  335  DTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIP  394

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+S
Sbjct  395  SDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVS  454

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  455  YWSQADRSLGQKLASRLNVRPSI  477



>ref|XP_008237987.1| PREDICTED: catalase isozyme 1 [Prunus mume]
Length=492

 Score =   238 bits (607),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  RNAERFP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRNAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006435361.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
 ref|XP_006473790.1| PREDICTED: catalase-like isoform X2 [Citrus sinensis]
 gb|ESR48601.1| hypothetical protein CICLE_v10000948mg [Citrus clementina]
Length=493

 Score =   238 bits (607),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC + NN YDG+MNF+HRDEEVDYFPS++D TR+AER+P P
Sbjct  351  DTQRHRLGPNYLMLPVNAPKCPHRNNHYDGFMNFMHRDEEVDYFPSRYDPTRHAERYPIP  410

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+K  IEKENNFKQPG+RYRSWAPDRQ+RF+NRW+K+L +PRVTHE+RS W+S
Sbjct  411  SDVITGRREKACIEKENNFKQPGERYRSWAPDRQERFLNRWIKALCDPRVTHEVRSIWVS  470

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  471  YWSQADRSLGQKLASRLNVRPSI  493



>emb|CAD42908.1| catalase [Prunus persica]
Length=492

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WIS
Sbjct  410  PNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_007209948.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
 gb|EMJ11147.1| hypothetical protein PRUPE_ppa004776mg [Prunus persica]
Length=492

 Score =   238 bits (606),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WIS
Sbjct  410  PNILSGKREKCIIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AFR42410.1| catalase, partial [Eperua falcata]
Length=135

 Score =   226 bits (576),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = -2

Query  622  PNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRR  443
            PN++ LPVNA KC +HNN YDG+MNF+HRDEE+DYFPS+FD  R+A+RFP P  IVTG+R
Sbjct  1    PNHLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAKRFPIPPAIVTGKR  60

Query  442  DKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRS  263
            ++C+IEKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRS
Sbjct  61   ERCIIEKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRS  120

Query  262  LGQKVASRLNIRPTM  218
            LGQKVAS LN+RP++
Sbjct  121  LGQKVASHLNMRPSI  135



>emb|CAB56850.1| catalase [Prunus persica]
Length=423

 Score =   235 bits (600),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P
Sbjct  281  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIP  340

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI+RWV +LS+PRVTHEIRS WIS
Sbjct  341  SNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIHRWVDALSDPRVTHEIRSVWIS  400

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  401  YWSQADKSLGQKLASRLNVRPSI  423



>ref|NP_001289779.1| catalase isozyme 1 [Nelumbo nucifera]
 gb|ADY11209.1| catalase [Nelumbo nucifera]
Length=492

 Score =   237 bits (604),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCAHHNNHHEGFMNFLHREEEVNYFPSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WIS
Sbjct  410  PQICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFIKRWIDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN++P+M
Sbjct  470  YWSQADKSLGQKLASRLNVKPSM  492



>gb|ABR15776.1| catalase [Litchi chinensis]
Length=291

 Score =   231 bits (588),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P
Sbjct  149  DTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIP  208

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+S
Sbjct  209  GRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVS  268

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP +
Sbjct  269  YWSQADKSLGQKIASRLNVRPNI  291



>gb|KJB57963.1| hypothetical protein B456_009G187600 [Gossypium raimondii]
Length=492

 Score =   236 bits (601),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEE++YFPS++D +R+AERFP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPSRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFINRWV ++S+PRVTHEIRS WI+
Sbjct  410  PALCTGKREKCIIEKENNFKQPGERYRSWAPDRQERFINRWVDAMSDPRVTHEIRSIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010061172.1| PREDICTED: catalase isozyme 3-like [Eucalyptus grandis]
 gb|KCW68094.1| hypothetical protein EUGRSUZ_F01776 [Eucalyptus grandis]
Length=492

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LPVNA KC +HNN +DG+MN +HRDEE++YFPSKFD  R+AER+P P
Sbjct  350  DTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNIMHRDEEINYFPSKFDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +IVTG+R+K +IEKENNFKQPG+RYRSWAPDRQ+RFINRW+K+L+EPRVTHE RS WIS
Sbjct  410  SQIVTGKREKVIIEKENNFKQPGERYRSWAPDRQERFINRWIKALTEPRVTHEHRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQAD+SLGQK+ASRL+ RP+M
Sbjct  470  YWTQADKSLGQKLASRLSARPSM  492



>ref|XP_008348924.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   235 bits (600),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>sp|P49317.1|CATA3_NICPL RecName: Full=Catalase isozyme 3 [Nicotiana plumbaginifolia]
 emb|CAA85426.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D  RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P
Sbjct  350  DAQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TG+RDKC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS W S
Sbjct  410  PCVLTGKRDKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWFS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD++LGQK+ASRLN+RPTM
Sbjct  470  YWSQADKTLGQKIASRLNVRPTM  492



>sp|Q9AXH0.1|CATA_AVIMR RecName: Full=Catalase [Avicennia marina]
 gb|AAK06839.1|AF328861_1 catalase [Avicennia marina]
 gb|AAP13538.1| catalase [Avicennia marina]
Length=492

 Score =   235 bits (600),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLPVNA KC YHNN YDG+MNF+HRDEEVDYFPSK+D TR+AER P P
Sbjct  350  DTQRHRLGPNYLLLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSKYDPTRHAERHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRRD+ VIEKE+NFKQ GDRYRSWAPDRQ+RF+ RWV +LS+PR+T EIRS W+S
Sbjct  410  NAVITGRRDRRVIEKEDNFKQAGDRYRSWAPDRQERFLRRWVDALSDPRLTLEIRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+S GQK+ASRLN+RPTM
Sbjct  470  YWSQADKSFGQKLASRLNVRPTM  492



>ref|XP_010536470.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   235 bits (600),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AERFP+P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCVHHNNHHDGFMNFMHRDEEVNYFPSRFDPVRHAERFPSP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV++LS+ R THEIRS WIS
Sbjct  410  PAICSGRREKCIIEKENNFKQPGERYRSWAPDRQERFLKRWVEALSDKRCTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP+ 
Sbjct  470  YWSQADKSLGQKLASRLNVRPSF  492



>ref|XP_008365915.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   235 bits (599),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSEPRVTHEIRS WIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSEPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_009413057.1| PREDICTED: catalase isozyme 2-like [Musa acuminata subsp. malaccensis]
Length=492

 Score =   235 bits (599),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +VTGRR+K +I KENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVTHEIR  WIS
Sbjct  410  SSVVTGRREKSIINKENNFKQPGERYRSWAPDRQERFVHRWVDALSDPRVTHEIRDIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+A+RLN++PTM
Sbjct  470  YWSQCDKSLGQKIATRLNVKPTM  492



>ref|XP_009600533.1| PREDICTED: catalase isozyme 3-like [Nicotiana tomentosiformis]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G MNF+HRDEEV+YFPS+FD  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEI + WIS
Sbjct  410  PRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIHTIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLG+K+ASRLN+RPTM
Sbjct  470  YWSQADKSLGEKIASRLNVRPTM  492



>ref|XP_008237989.1| PREDICTED: catalase isozyme 1-like [Prunus mume]
Length=492

 Score =   234 bits (598),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I+ G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  SNILYGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011041225.1| PREDICTED: catalase isozyme 1 [Populus euphratica]
Length=492

 Score =   234 bits (597),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WIS
Sbjct  410  SAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSEPRVTHEVRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RP++
Sbjct  470  YWSQADKSLGQKLASHLNVRPSI  492



>ref|XP_002306976.2| catalase family protein [Populus trichocarpa]
 gb|EEE93972.2| catalase family protein [Populus trichocarpa]
Length=492

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+ D +R+AERFP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRHDPSRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LSEPRVTHE+RS WIS
Sbjct  410  SAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFVRRWVDALSEPRVTHEVRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RP++
Sbjct  470  YWSQADKSLGQKLASHLNVRPSV  492



>ref|XP_010918244.1| PREDICTED: catalase isozyme 1 [Elaeis guineensis]
Length=492

 Score =   234 bits (596),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+TGRR+KCVI KENNFKQPG+RYRSW P+RQ+RFI RWV++LS+PRVTHEI+S WIS
Sbjct  410  SRILTGRREKCVIHKENNFKQPGERYRSWDPNRQERFIRRWVEALSDPRVTHEIQSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+A+RLN++P M
Sbjct  470  YWSQCDKSLGQKIATRLNVKPCM  492



>ref|XP_010061175.1| PREDICTED: catalase-like [Eucalyptus grandis]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WIS
Sbjct  410  PPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQAD+SLGQK+AS LN+RP+M
Sbjct  470  YWTQADKSLGQKIASCLNVRPSM  492



>dbj|BAF91369.1| catalase [Capsicum annuum]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PRVTHEIRS WIS
Sbjct  410  SCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_010242894.1| PREDICTED: catalase isozyme 1-like isoform X1 [Nelumbo nucifera]
Length=492

 Score =   234 bits (596),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI TG+R+KCVIEKENNFKQPG+RYRS+ PDRQ+RFI RW  +LS+PRVTHEIRS WIS
Sbjct  410  PRICTGKREKCVIEKENNFKQPGERYRSFDPDRQERFIKRWFDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+A+RLN++P+M
Sbjct  470  YWSQADKSLGQKLATRLNVKPSM  492



>gb|AFR42412.1| catalase, partial [Eperua falcata]
Length=131

 Score =   222 bits (566),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = -2

Query  607  LPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTPLRIVTGRRDKCVI  428
            LPVNA KC +HNN YDG+MNF+HRDEE+DYFPS+FD  R+AERFP P  IVTG+R++C+I
Sbjct  2    LPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRFDPVRHAERFPIPPAIVTGKRERCII  61

Query  427  EKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWISYLTQADRSLGQKV  248
            EKEN+FKQPG+RYRSWAPDRQDRF+ RWV+ L++PRVTHEIRS WISYL+QADRSLGQKV
Sbjct  62   EKENDFKQPGERYRSWAPDRQDRFVRRWVEVLADPRVTHEIRSIWISYLSQADRSLGQKV  121

Query  247  ASRLNIRPTM  218
            AS LN+RP++
Sbjct  122  ASHLNMRPSI  131



>gb|AAM97542.1| catalase 3 [Capsicum annuum]
Length=492

 Score =   233 bits (595),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++ G+RD+C+I+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LSEPRVTHEIR+ W+S
Sbjct  410  PRVLNGKRDRCIIQKENNFKQPGERYRSWAPDRQERFICRWVDALSEPRVTHEIRTIWLS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN++PTM
Sbjct  470  YWSQADKSLGQKLASRLNVKPTM  492



>gb|KJB14249.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=344

 Score =   229 bits (584),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P
Sbjct  202  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  261

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  262  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWIS  321

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+S+GQK+ASRLN+RP++
Sbjct  322  YWSQADKSVGQKLASRLNVRPSI  344



>gb|AAB88173.1| catalase, partial [Glycine max]
Length=308

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  166  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIP  225

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WIS
Sbjct  226  PAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWIS  285

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRL++RP +
Sbjct  286  YWSQADRSLGQKIASRLSMRPNI  308



>ref|XP_009773579.1| PREDICTED: catalase isozyme 3-like [Nicotiana sylvestris]
Length=492

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G MNF++RDEEV+YFPS+FD  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGVMNFMYRDEEVNYFPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+TG+RD+C+IEKENNFKQPG+RYRSW+PDRQ+RFI RW+ +LS+PRVTHEIR  WIS
Sbjct  410  PRILTGKRDRCIIEKENNFKQPGERYRSWSPDRQERFICRWINALSDPRVTHEIRIIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLG+K+ASRLN+RPTM
Sbjct  470  YWSQADKSLGEKIASRLNVRPTM  492



>gb|AIS20825.1| CAT [Pyrus x bretschneideri]
Length=492

 Score =   233 bits (594),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>ref|XP_009400996.1| PREDICTED: catalase isozyme 2 [Musa acuminata subsp. malaccensis]
Length=492

 Score =   233 bits (593),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN YDG+MNF+HRDEEVDYFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG+R+KC+I KENNFKQPG+RYRS++PDRQ+RFI RWV++LS+P+VTHEIRS WIS
Sbjct  410  TRVLTGKREKCMISKENNFKQPGERYRSFSPDRQERFIRRWVEALSDPKVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SL QK+A+RL+++P+M
Sbjct  470  YWSQCDKSLSQKLATRLSVKPSM  492



>emb|CDP07287.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   233 bits (593),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+RDKCVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+ RVTHEIRS WIS
Sbjct  410  PPVLSGKRDKCVIQKENNFKQPGERYRSWAPDRQERFICRWVDALSDARVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+A+RLN+RPTM
Sbjct  470  YWSQADKSLGQKIATRLNVRPTM  492



>ref|XP_008373403.1| PREDICTED: catalase isozyme 1 [Malus domestica]
Length=492

 Score =   233 bits (593),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV +LS+PRVT+EIRS WIS
Sbjct  410  SNICTGKREKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS GQK+ASRLN+RP++
Sbjct  470  YWSQADRSFGQKLASRLNVRPSI  492



>sp|Q9M5L6.1|CATA_CAPAN RecName: Full=Catalase; AltName: Full=CaCat1 [Capsicum annuum]
 gb|AAF34718.1|AF227952_1 catalase [Capsicum annuum]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+KCVI KENNFKQ G+RYRSWAPDRQDR+IN+WV+SLS+PR THEIRS WIS
Sbjct  410  SCVLTGRREKCVIPKENNFKQAGERYRSWAPDRQDRYINKWVESLSDPRATHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>emb|CAD42909.1| catalase [Prunus persica]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  SNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ SRLN+RP++
Sbjct  470  YWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_008802866.1| PREDICTED: catalase isozyme 1 [Phoenix dactylifera]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+KCVI KENNFKQPG+RYRSWAPDRQ RFI RWV++LS+PRVT+EIRS WIS
Sbjct  410  SCVLTGRREKCVIHKENNFKQPGERYRSWAPDRQGRFICRWVEALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q DRSLGQK+A+RLN++P+M
Sbjct  470  YWSQCDRSLGQKIATRLNVKPSM  492



>ref|XP_007210576.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
 gb|EMJ11775.1| hypothetical protein PRUPE_ppa004763mg [Prunus persica]
Length=492

 Score =   232 bits (592),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRHDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  SNILSGKREKCVIEKENNFKQPGERYRSWAPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ SRLN+RP++
Sbjct  470  YWSQADKSLGQKLLSRLNVRPSI  492



>ref|XP_010061174.1| PREDICTED: catalase isozyme 3-like isoform X2 [Eucalyptus grandis]
 gb|KCW68092.1| hypothetical protein EUGRSUZ_F01775 [Eucalyptus grandis]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEE++YFPSKFD  R+AER+P P
Sbjct  350  DTHRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEINYFPSKFDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +IVTG+R++ +IEKENNFKQ G+RYRSWAPDRQ+RFINRW+K+LSEPRVTHE RS WIS
Sbjct  410  SQIVTGKRERVIIEKENNFKQAGERYRSWAPDRQERFINRWIKALSEPRVTHEHRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQAD+S+GQK+AS L+ RP+M
Sbjct  470  YWTQADKSIGQKLASSLSARPSM  492



>gb|AIX10947.1| putative catalase [Gardenia jasminoides]
Length=492

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN YDGYMN +HRDEE+DYFPS++D  R+AER P P
Sbjct  350  DTHRHRLGPNYLQLPVNAPKCAHHNNHYDGYMNIMHRDEEIDYFPSRYDPVRHAERHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TGRR++ VIEKENNFKQP +RYRSWAPDRQ+RF+ RWV +LS+PR+THEIRS WIS
Sbjct  410  TRVLTGRRERRVIEKENNFKQPVERYRSWAPDRQERFVRRWVDALSDPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+A RLN+RPTM
Sbjct  470  YWSQADKSLGQKIAFRLNVRPTM  492



>emb|CAI43948.1| catalase [Populus deltoides]
 gb|ABK96317.1| unknown [Populus trichocarpa x Populus deltoides]
Length=492

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_002301920.1| catalase family protein [Populus trichocarpa]
 gb|ABK96479.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEE81193.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   232 bits (591),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|KCW68095.1| hypothetical protein EUGRSUZ_F01777 [Eucalyptus grandis]
Length=584

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G MNF+HRDEEV+YFPS+FD+ R+AE+FP P
Sbjct  442  DTQRHRLGPNYLQLPVNAPKCTHHNNHHEGLMNFMHRDEEVNYFPSRFDSVRHAEKFPIP  501

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ G+RD+C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PRVT EIRS WIS
Sbjct  502  PPVLNGKRDRCMIEKENNFKQPGERYRSWAPDRQERFIGRWVEALSDPRVTQEIRSIWIS  561

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQAD+SLGQK+AS LN+RP+M
Sbjct  562  YWTQADKSLGQKIASCLNVRPSM  584



>ref|XP_008789355.1| PREDICTED: catalase isozyme 1-like [Phoenix dactylifera]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHDGFMNFLHRDEEVNYFPSRYDPVRHAERCPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+TGRR+KCVI+KENNFKQPG+RYRSW PDRQ RFI RWV++LS+PRVTHEI+S WIS
Sbjct  410  SRILTGRREKCVIQKENNFKQPGERYRSWDPDRQGRFIRRWVEALSDPRVTHEIQSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLG+K+A+RLN++P+M
Sbjct  470  YWSQCDKSLGRKIATRLNVKPSM  492



>ref|XP_010498496.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010459748.1| PREDICTED: catalase-3 [Camelina sativa]
 ref|XP_010477307.1| PREDICTED: catalase-3 [Camelina sativa]
Length=492

 Score =   231 bits (590),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  410  TKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>gb|AEQ30070.1| catalase, partial [Litchi chinensis]
Length=487

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P
Sbjct  345  DTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIP  404

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT EIRS W+S
Sbjct  405  GRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFEIRSIWVS  464

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP +
Sbjct  465  YWSQADKSLGQKIASRLNVRPNI  487



>ref|XP_009110221.1| PREDICTED: catalase-3 [Brassica rapa]
 gb|AFN81244.1| catalase 2 [Brassica rapa subsp. pekinensis]
 emb|CDX96630.1| BnaA08g21730D [Brassica napus]
Length=492

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  410  TKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>gb|ACJ11733.1| catalase [Gossypium hirsutum]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++LS+PRVTHEIRS WIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_011034872.1| PREDICTED: catalase isozyme 1-like [Populus euphratica]
Length=492

 Score =   231 bits (589),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAA57551.1| catalase, partial [Nicotiana sylvestris]
Length=383

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P
Sbjct  241  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIP  300

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WIS
Sbjct  301  SRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  360

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  361  YLSQADKSCGQKVASRLTLKPTM  383



>ref|NP_001031072.3| catalase 3 [Arabidopsis thaliana]
 gb|AEE29996.1| catalase 3 [Arabidopsis thaliana]
Length=377

 Score =   227 bits (579),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP
Sbjct  235  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  294

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  295  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  354

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  355  YWSQADRSLGQKLASRLNVRPSI  377



>gb|KFK44175.1| hypothetical protein AALP_AA1G224300 [Arabis alpina]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPVP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KCVI+KENNFKQPGDRYRSWAPDRQDRFI RWV+ LSEPR+THEIR  WIS
Sbjct  410  SKSYTGIRTKCVIKKENNFKQPGDRYRSWAPDRQDRFIKRWVEILSEPRLTHEIRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>emb|CDP07288.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 105/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNYM LPVNA KC +HNN YDG+MNF+HRDEEVDYFPS+FD  R+A R P P
Sbjct  350  DTQRHRLGPNYMQLPVNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRFDPVRHAARHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ G+RD+CVI KENNFKQ G+RYRSWAPDRQ+RFI RWV  LS+ RVTHEIRS WIS
Sbjct  410  STVLRGKRDRCVIPKENNFKQAGERYRSWAPDRQERFICRWVDILSDARVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+A+RLN+RPTM
Sbjct  470  YWSQADKSLGQKMATRLNVRPTM  492



>gb|ACJ76836.3| catalase [Dimocarpus longan]
Length=492

 Score =   230 bits (587),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN YDG+MNF+HRDEEVDYFPSKF N  NAE+FP P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCPHHNNHYDGFMNFMHRDEEVDYFPSKFTNVANAEKFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI +G+R+K  IEKENNFK PGDRYRSWAPDRQ+RFI R V  LS+PRVT E+RS W+S
Sbjct  410  SRICSGKREKACIEKENNFKLPGDRYRSWAPDRQERFIKRVVDGLSDPRVTFELRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP +
Sbjct  470  YWSQADKSLGQKIASRLNVRPNI  492



>ref|XP_011074091.1| PREDICTED: catalase isozyme 3 isoform X2 [Sesamum indicum]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+S
Sbjct  410  PVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP M
Sbjct  470  YWSQADKSLGQKLASRLNVRPAM  492



>emb|CDY31488.1| BnaC05g15970D [Brassica napus]
Length=500

 Score =   231 bits (588),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  358  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  417

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  418  NKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  477

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  478  YWSQADRSLGQKLASRLNVRPSI  500



>gb|AJE26131.1| catalase [Salix matsudana]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PR THEIRS WIS
Sbjct  410  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRATHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY33636.1| BnaC08g19360D [Brassica napus]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  410  NKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_011074092.1| PREDICTED: catalase isozyme 3 isoform X3 [Sesamum indicum]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D +R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPSRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+R K  IEKENNFKQPGDRYRSWAPDRQ+RFI RWV++LS+PR+THEIRS W+S
Sbjct  410  PVVLSGKRGKICIEKENNFKQPGDRYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RPTM
Sbjct  470  YWSQADKSLGQKLASHLNVRPTM  492



>emb|CDY29519.1| BnaA06g14510D [Brassica napus]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  410  NKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009103334.1| PREDICTED: catalase-3-like [Brassica rapa]
 gb|AAB53101.2| catalase [Brassica napus]
 gb|AET08935.1| catalase [Brassica napus]
Length=492

 Score =   230 bits (587),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  410  NKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>gb|AGE15298.2| catalase 1 [Eriobotrya japonica]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++   R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYQPARHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I+TG+RDKCVIEKENNFKQPG+RYRSWAPDRQ+RF++RWV  LSE RVT+EIRS WIS
Sbjct  410  SSIITGKRDKCVIEKENNFKQPGERYRSWAPDRQERFLHRWVDVLSESRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS GQK+A+RLN+RP++
Sbjct  470  YWSQADRSFGQKLATRLNVRPSI  492



>ref|XP_009149539.1| PREDICTED: catalase-3 [Brassica rapa]
Length=543

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  401  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  460

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  461  NKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  520

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  521  YWSQADRSLGQKLASRLNVRPSI  543



>emb|CAC04509.1| catalase [Digitalis lanata]
Length=265

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  123  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAERFPHP  182

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               + G+RD+  IEKENNFKQPG++YRS+ PDRQ+RFI RWV +LS+PR+THEIRS W+S
Sbjct  183  PVALNGKRDRICIEKENNFKQPGEKYRSFPPDRQERFIKRWVDALSDPRLTHEIRSIWVS  242

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQAD+SLGQK+ASRLNIRPTM
Sbjct  243  YWTQADKSLGQKLASRLNIRPTM  265



>gb|KHG25152.1| Catalase isozyme 1 [Gossypium arboreum]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV++ S+PRVTHEIRS WIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVEAFSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>sp|O24339.1|CATA_SOLAP RecName: Full=Catalase [Soldanella alpina]
 emb|CAB16749.1| catalase [Soldanella alpina]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G MNF+HRDEEV+YFPS+FD  R+AER P P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGLMNFMHRDEEVNYFPSRFDPVRHAERHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TG+RD+C+IEKENNFKQPG+RYR++APDRQ+RF+ RWV +LS+PRVTHEIRS WIS
Sbjct  410  PPVLTGKRDRCMIEKENNFKQPGERYRTFAPDRQERFVCRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQAD+SLGQK+ASRLN+RPTM
Sbjct  470  YWTQADKSLGQKLASRLNVRPTM  492



>sp|P55311.1|CATA_SOLME RecName: Full=Catalase [Solanum melongena]
 emb|CAA50644.1| catalase [Solanum melongena]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WIS
Sbjct  410  SCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLLVKPTM  492



>gb|ADC95629.1| catalase [Bruguiera gymnorhiza]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN +DG+MNF+HRDEEV+Y PS+FD  R+AERFP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYLPSRFDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TGRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RF +RWV++LS+PRVTHEI S WIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAPDRQERFTHRWVEALSDPRVTHEICSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQ D+ LGQK+A+RLN+RP++
Sbjct  470  YWTQCDKFLGQKLATRLNVRPSI  492



>ref|XP_006828714.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
 gb|ERM96130.1| hypothetical protein AMTR_s00001p00022550 [Amborella trichopoda]
Length=492

 Score =   229 bits (585),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN YDG+MNF HRDEEVDYFPS+FD  R+AER P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAERCPLP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             ++V+G+R++CVIEKENNFKQPGDRYRS+APDRQ+RF+ R V +LS+ RVTHEIRS WIS
Sbjct  410  PQLVSGKRERCVIEKENNFKQPGDRYRSFAPDRQERFVKRIVDALSDTRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+A+RLNI+P M
Sbjct  470  YWSQCDKSLGQKIATRLNIKPHM  492



>ref|NP_001268098.1| catalase [Vitis vinifera]
 gb|AAL83720.1|AF236127_1 catalase [Vitis vinifera]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WIS
Sbjct  410  STICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRP  224
            Y +QADRSLGQK+ASRLN++P
Sbjct  470  YWSQADRSLGQKLASRLNVKP  490



>ref|XP_003631925.1| PREDICTED: catalase isozyme 1-like [Vitis vinifera]
Length=492

 Score =   229 bits (584),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG MNF+HRDEEVDYFPS+FD  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAFHNNHHDGSMNFMHRDEEVDYFPSRFDPVRHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I  G+R+K VIEKENNFKQPG+RYRS+APDRQ+RFINRWV++LS+PRVT+EIRS WIS
Sbjct  410  STICHGKREKVVIEKENNFKQPGERYRSFAPDRQERFINRWVETLSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRP  224
            Y +QADRSLGQK+ASRLN++P
Sbjct  470  YWSQADRSLGQKLASRLNVKP  490



>ref|XP_009590727.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WIS
Sbjct  410  SRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>gb|ACJ73905.1| CAT1 [Solanum nigrum]
Length=168

 Score =   219 bits (558),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P
Sbjct  26   DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEIYPIP  85

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             ++ +G+R+KC+I+KENNFKQ G+RYR++ PDRQ+RF+ RWV+ LS+PR+T+EIRS WIS
Sbjct  86   SKVCSGKREKCIIQKENNFKQAGERYRTFTPDRQERFVRRWVEPLSDPRITYEIRSIWIS  145

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  146  YWSQADKSLGQKLASRLNVRPSI  168



>gb|KJB14250.1| hypothetical protein B456_002G115900 [Gossypium raimondii]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+S+GQK+ASRLN+RP++
Sbjct  470  YWSQADKSVGQKLASRLNVRPSI  492



>gb|AET97564.1| catalase [Ziziphus jujuba]
Length=492

 Score =   229 bits (584),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I  G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RW+ +LS+PRVTHEIRS WIS
Sbjct  410  SAIFNGKREKCIIEKENNFKQPGERYRSWAPDRQERFIRRWIDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY01364.1| BnaA07g11370D [Brassica napus]
Length=556

 Score =   231 bits (588),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  414  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  473

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  474  NKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  533

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  534  YWSQADRSLGQKLASRLNVRPSI  556



>dbj|BAH20307.1| AT1G20620 [Arabidopsis thaliana]
Length=458

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP
Sbjct  316  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  375

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  376  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  435

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  436  YWSQADRSLGQKLASRLNVRPSI  458



>gb|AGV54297.1| peroxisomal catalase [Phaseolus vulgaris]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP +
Sbjct  470  YWSQADRSLGQKIASHLNMRPNI  492



>dbj|BAJ33995.1| unnamed protein product [Thellungiella halophila]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006412153.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
 gb|ESQ53606.1| hypothetical protein EUTSA_v10024932mg [Eutrema salsugineum]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRS+AP+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFAPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>sp|P49319.2|CATA1_TOBAC RecName: Full=Catalase isozyme 1; AltName: Full=Salicylic acid-binding 
protein; Short=SABP [Nicotiana tabacum]
 gb|AAA57552.1| catalase [Nicotiana tabacum]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WIS
Sbjct  410  SRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTLKPTM  492



>ref|NP_001237571.1| catalase-4 [Glycine max]
 sp|O48561.1|CATA4_SOYBN RecName: Full=Catalase-4 [Glycine max]
 gb|AAB88172.1| catalase [Glycine max]
 gb|KHN33801.1| Catalase-4 [Glycine soja]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFARRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS L+ RP +
Sbjct  470  YWSQADRSLGQKIASHLSTRPNI  492



>ref|XP_009792372.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WIS
Sbjct  410  SRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTLKPTM  492



>ref|XP_007136018.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
 gb|ESW08012.1| hypothetical protein PHAVU_009G011100g [Phaseolus vulgaris]
Length=492

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D+ R+AE FP P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDSVRHAESFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KC IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP +
Sbjct  470  YWSQADRSLGQKIASHLNMRPNI  492



>gb|AHF27428.1| catalase, partial [Cucurbita moschata]
 gb|AHF27431.1| catalase, partial [Cucurbita maxima]
Length=344

 Score =   224 bits (572),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P
Sbjct  202  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHP  261

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WIS
Sbjct  262  PAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWIS  321

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP++
Sbjct  322  YWSQADRSLGQKLASHLNVRPSI  344



>gb|AAR84578.1| catalase 1a [Lotus japonicus]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG R++C IEKENNFKQPG+RYRS+APDRQDRF+ RWV +LS+PRVTHEIRSTWIS
Sbjct  410  PAICTGSRERCAIEKENNFKQPGERYRSFAPDRQDRFVRRWVDALSDPRVTHEIRSTWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP++
Sbjct  470  YWSQADRSLGQKIASHLNLRPSI  492



>ref|XP_010530333.1| PREDICTED: catalase-2 [Tarenaya hassleriana]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR++C+IEKENNFKQPG+RYRS+ PDRQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  PVICSGRRERCIIEKENNFKQPGERYRSFTPDRQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADQSLGQKLASRLNVRPSI  492



>emb|CDY31878.1| BnaC07g15280D [Brassica napus]
Length=492

 Score =   228 bits (582),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKAPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQPGDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  410  NKSYTGIRTKCIIKKENNFKQPGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>ref|NP_564120.1| catalase 3 [Arabidopsis thaliana]
 sp|Q42547.3|CATA3_ARATH RecName: Full=Catalase-3 [Arabidopsis thaliana]
 gb|AAL08303.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AAL24212.1| At1g20620/F5M15_4 [Arabidopsis thaliana]
 gb|AEE29995.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   228 bits (582),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  410  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>dbj|BAC79443.1| catalase [Acacia ampliceps]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNY+ LPVNA KC +HNN YDG MNF+HRDEEVDYFPS++D  R+AE+FP P
Sbjct  350  DTQRHRIGPNYLQLPVNAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRYDTARHAEKFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               + GRRD+ +IEKENNFKQPGD YR+WAPDRQ+RFI RW+  LS+P+VTHE+RS WIS
Sbjct  410  PVNLIGRRDRRIIEKENNFKQPGDLYRTWAPDRQERFIRRWIGVLSDPKVTHEVRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QADRSLGQKVAS LN+RP++
Sbjct  470  YLSQADRSLGQKVASHLNMRPSI  492



>gb|AIA61608.1| catalase [Gynostemma pentaphyllum]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R++CVI+KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVCTGKRERCVIDKENNFKQPGERYRSWAPDRQERFIRRWVNALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS+GQK+AS LN+RP++
Sbjct  470  YWSQADRSVGQKLASHLNMRPSI  492



>ref|XP_006435363.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|ESR48603.1| hypothetical protein CICLE_v10000951mg [Citrus clementina]
 gb|KDO85096.1| hypothetical protein CISIN_1g042356mg [Citrus sinensis]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC  HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WIS
Sbjct  410  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QA +SLGQK+ASRLN+RP +
Sbjct  470  YWSQACKSLGQKLASRLNVRPNI  492



>gb|AAM65021.1| unknown [Arabidopsis thaliana]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  410  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_010663966.1| PREDICTED: catalase isozyme 1 [Vitis vinifera]
 emb|CBI40714.3| unnamed protein product [Vitis vinifera]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I+TGRR+KC+I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WIS
Sbjct  410  PAILTGRREKCIIPKENNFKQPGERYRSFAPDRQERFIQRWVDALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|NP_001240021.1| catalase [Glycine max]
 dbj|BAG09375.1| peroxisomal catalase [Glycine max]
 gb|KHN20113.1| Catalase-4 [Glycine soja]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAETFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KC IEKENNFKQPG+RYRSWAPDRQDRF  RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAICSGRREKCGIEKENNFKQPGERYRSWAPDRQDRFNRRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRL++RP +
Sbjct  470  YWSQADRSLGQKIASRLSMRPNI  492



>ref|XP_006473794.1| PREDICTED: catalase isozyme 1-like isoform X4 [Citrus sinensis]
Length=492

 Score =   228 bits (581),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC  HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WIS
Sbjct  410  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QA +SLGQK+ASRLN+RP +
Sbjct  470  YWSQACKSLGQKLASRLNVRPNI  492



>ref|XP_006473791.1| PREDICTED: catalase isozyme 1-like isoform X1 [Citrus sinensis]
 ref|XP_006473792.1| PREDICTED: catalase isozyme 1-like isoform X2 [Citrus sinensis]
 ref|XP_006473793.1| PREDICTED: catalase isozyme 1-like isoform X3 [Citrus sinensis]
Length=512

 Score =   228 bits (582),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC  HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP
Sbjct  370  DTQRHRLGPNYLQLPVNAPKCAQHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  429

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIR  WIS
Sbjct  430  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRHIWIS  489

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QA +SLGQK+ASRLN+RP +
Sbjct  490  YWSQACKSLGQKLASRLNVRPNI  512



>gb|ACV30589.1| catalase [Carica papaya]
Length=170

 Score =   218 bits (554),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 98/144 (68%), Positives = 124/144 (86%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPN+M LPVNA KC + NN +DGYMNF+HRDEEV+Y PSKFD   NAER+P P
Sbjct  27   DTQRHRLGPNFMQLPVNAPKCAHRNNHFDGYMNFMHRDEEVNYHPSKFDPVTNAERYPIP  86

Query  466  LRIVTG-RRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
             ++ +  +R+KC+IEK+N+FKQPG+RYR++ PDRQ+RFINRWVK+LSEPR+THEIRS WI
Sbjct  87   TKVYSACKREKCIIEKQNDFKQPGERYRTFEPDRQERFINRWVKALSEPRITHEIRSIWI  146

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
             +L++AD SLG+KVA RLNIRP++
Sbjct  147  DWLSRADESLGRKVAMRLNIRPSI  170



>ref|XP_006828715.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
 gb|ERM96131.1| hypothetical protein AMTR_s00001p00024160 [Amborella trichopoda]
Length=492

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN YDG+MNF HRDEEVDYFPS+FD  R+AE+FP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHYDGFMNFAHRDEEVDYFPSRFDPVRHAEKFPMP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +I +G+R+KC+IEKENNFKQPG+RYRS+A DRQ+RFI RWV +LS+PRVTHEI S WIS
Sbjct  410  PQICSGKREKCMIEKENNFKQPGERYRSFAIDRQERFIKRWVDALSDPRVTHEILSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+A+ LN++P M
Sbjct  470  YWSQCDKSLGQKLATHLNLKPNM  492



>ref|XP_004238430.1| PREDICTED: catalase isozyme 3 [Solanum lycopersicum]
Length=492

 Score =   227 bits (579),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G MNF+HRDEEV+Y PS+ D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGLMNFMHRDEEVNYLPSRLDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG+R+K +IEKENNFKQPG+ YRSWAPDRQ+RF+ RWV +LS+PR THEIRS WIS
Sbjct  410  PRVLTGKREKVIIEKENNFKQPGEHYRSWAPDRQERFLCRWVDALSDPRATHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLNIRPTM
Sbjct  470  YWSQADKSLGQKLASRLNIRPTM  492



>dbj|BAQ21275.1| catalase [Citrus tamurana]
Length=476

 Score =   227 bits (578),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN YDG+MNF+HRDEE+DYFPS++D  R+AE  PTP
Sbjct  334  DTQRHRLGPNYLQLPVNAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPVRHAEMHPTP  393

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I  GRR+KC+I KENNFKQPG+RYRSWAPDRQ+RF+ RWV +LS+PRVTHEIR  WIS
Sbjct  394  PEICGGRREKCIIPKENNFKQPGERYRSWAPDRQERFVCRWVDALSDPRVTHEIRHIWIS  453

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QA +SLGQK+ +RLN+RP++
Sbjct  454  YWSQACKSLGQKLTARLNVRPSI  476



>ref|XP_007160597.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
 gb|ESW32591.1| hypothetical protein PHAVU_001G001000g [Phaseolus vulgaris]
Length=492

 Score =   227 bits (579),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ +P NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P
Sbjct  350  DSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WIS
Sbjct  410  PRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN++P++
Sbjct  470  YWSQADRSLGQKIASHLNLKPSI  492



>gb|ABM47415.1| catalase [Prunus avium]
Length=492

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNYM LPVNA KC +HNN  DG+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYMQLPVNAPKCPHHNNHQDGFMNFMHRDEEVNYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I+TG+R++ VIEKENNFKQPG+RYRSWAPDRQ+RFI R V +LS+PRV+HEIRS WIS
Sbjct  410  SNILTGKRERRVIEKENNFKQPGERYRSWAPDRQERFIRRCVDALSDPRVSHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+A+RLN+RP++
Sbjct  470  YWSQADKSLGQKIATRLNVRPSI  492



>ref|XP_007018034.1| Catalase 2 [Theobroma cacao]
 gb|EOY15259.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEE++YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +GRR+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WI+
Sbjct  410  PAVCSGRREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QA +SLGQK+ASRLN++P +
Sbjct  470  YWSQACKSLGQKLASRLNVKPNI  492



>ref|XP_008452956.1| PREDICTED: catalase isozyme 1 [Cucumis melo]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPARHAERYPHP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS+GQK+AS LN+RP++
Sbjct  470  YWSQADRSVGQKLASHLNVRPSI  492



>gb|AAF19965.1|AF207906_1 catalase 1 [Zantedeschia aethiopica]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEQFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+ G R+KC I+KENNFKQPG++YRSWAPDRQ+RFI RW+ +LS+PRVTHEIR+ WI+
Sbjct  410  PRILNGGREKCCIQKENNFKQPGEKYRSWAPDRQERFIKRWIDALSDPRVTHEIRTIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+ LGQK+ASRLNI+PT+
Sbjct  470  YWSQCDKFLGQKLASRLNIKPTL  492



>gb|AAG43363.1|AF151368_1 catalase [Hevea brasiliensis]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLG NY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+ D  R++ERFP P
Sbjct  350  DTQRHRLGSNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRCDPVRHSERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRRDKCVIEKENNF+QPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+RS WIS
Sbjct  410  STICSGRRDKCVIEKENNFEQPGERYRSWAPDRQERFLNRMVGCLSDPRITHELRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQ DRSLGQK+A RLN+RP++
Sbjct  470  YWTQCDRSLGQKLAFRLNVRPSI  492



>gb|AAD50974.1|AF170272_1 catalase CAT1 [Manihot esculenta]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY +LPVNA KC YHNN YDG+MNF+HRDEEVDYFPS++D  R+AER P P
Sbjct  350  DTQRHRLGPNYKMLPVNAPKCAYHNNHYDGFMNFMHRDEEVDYFPSRYDPVRHAERSPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+ R V +LSEPR+T EIRS W+S
Sbjct  410  NAICSGRREKCVIEKENNFKQPGERYRSWAPDRQERFLCRLVNALSEPRITFEIRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y ++ D SLGQK+ASRLN+RP +
Sbjct  470  YWSKCDASLGQKLASRLNVRPNI  492



>ref|NP_001291326.1| catalase isozyme 1 [Sesamum indicum]
 gb|AFJ42575.1| catalase [Sesamum indicum]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D TR++E +P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPTRHSEMYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+R+K  IEKENNFKQPG+RYRSWAPDRQ+RFI RWV++LS+PR+THEIRS WIS
Sbjct  410  PVVLSGKREKRCIEKENNFKQPGERYRSWAPDRQERFIRRWVEALSDPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RPTM
Sbjct  470  YWSQADKSLGQKLASRLNVRPTM  492



>sp|P17598.2|CATA1_GOSHI RecName: Full=Catalase isozyme 1 [Gossypium hirsutum]
 emb|CAA36380.1| unnamed protein product [Gossypium hirsutum]
Length=492

 Score =   227 bits (578),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEE++YFPS++D  R+AE FP P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEINYFPSRYDPVRHAEMFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TGRR+KC+IEKENNFKQPG+RYRSWA DRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVCTGRREKCIIEKENNFKQPGERYRSWAADRQERFICRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+S+GQK+AS LN+RP++
Sbjct  470  YWSQADKSVGQKLASLLNVRPSI  492



>gb|ACL27272.1| catalase [Nicotiana benthamiana]
Length=492

 Score =   226 bits (577),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  410  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU48609.1| catalase 1, partial [Nicotiana benthamiana]
Length=491

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  349  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  408

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  409  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  468

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  469  YWSQADKSLGQKLASRLNVRPSI  491



>ref|NP_001237556.1| catalase-1/2 [Glycine max]
 sp|P29756.1|CATA1_SOYBN RecName: Full=Catalase-1/2 [Glycine max]
 emb|CAA78056.1| catalase [Glycine max]
 gb|AAB88169.1| catalase [Glycine max]
 gb|AAB88170.1| catalase [Glycine max]
 gb|KHN48523.1| Catalase-1/2 [Glycine soja]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKVPVP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+ G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WIS
Sbjct  410  PRILGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN++P++
Sbjct  470  YWSQADRSLGQKIASHLNLKPSI  492



>emb|CCP37650.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  410  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006306495.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
 gb|EOA39393.1| hypothetical protein CARUB_v10012481mg [Capsella rubella]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  410  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>sp|P49316.1|CATA2_NICPL RecName: Full=Catalase isozyme 2 [Nicotiana plumbaginifolia]
 emb|CAA85425.1| catalase [Nicotiana plumbaginifolia]
Length=492

 Score =   226 bits (577),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++ GRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WIS
Sbjct  410  SRVLNGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTLKPTM  492



>gb|ACV92695.1| catalase [Brassica oleracea]
Length=492

 Score =   226 bits (576),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AFU90822.1| catalase, partial [Populus tomentosa]
Length=487

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  349  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  408

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  409  PAVCSGKREKCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  468

Query  286  YLTQADRSLGQKVASRLNI  230
            Y +QAD+SLGQK+ASRLN+
Sbjct  469  YWSQADKSLGQKLASRLNV  487



>ref|XP_002867092.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43351.1| hypothetical protein ARALYDRAFT_491144 [Arabidopsis lyrata subsp. 
lyrata]
Length=492

 Score =   226 bits (576),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIQRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAB62892.1| catalase-1 [Nicotiana glutinosa]
Length=492

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+THEIRS WIS
Sbjct  410  STMCTGKREKCVILKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_006283612.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
 gb|EOA16510.1| hypothetical protein CARUB_v10004668mg [Capsella rubella]
Length=492

 Score =   226 bits (575),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDX76313.1| BnaA08g10870D [Brassica napus]
Length=477

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  335  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  394

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  395  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWIS  454

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD++LGQK+ASRLN+RP++
Sbjct  455  YWSQADKTLGQKLASRLNVRPSI  477



>gb|AFU90823.1| catalase, partial [Populus x beijingensis]
Length=446

 Score =   224 bits (571),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 122/139 (88%), Gaps = 0/139 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE FP P
Sbjct  308  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAESFPIP  367

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFKQPG+RYRSWAPDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  368  PAVCSGKRERCIIEKENNFKQPGERYRSWAPDRQERFICRWVDALSDPRVTHEIRSIWIS  427

Query  286  YLTQADRSLGQKVASRLNI  230
            Y +QAD+SLGQK+ASRLN+
Sbjct  428  YWSQADKSLGQKLASRLNV  446



>ref|XP_010941422.1| PREDICTED: catalase isozyme B [Elaeis guineensis]
Length=492

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERFPLP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG+R+KCVI KENNFKQPG+RYRS+ P RQ+RF++RWV++LS+ RVTHEIR  WI+
Sbjct  410  PRVLTGKREKCVIGKENNFKQPGERYRSFDPARQERFVHRWVEALSDTRVTHEIRGIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+A+RLN+RP+M
Sbjct  470  YWSQCDKSLGQKLATRLNMRPSM  492



>gb|AAB71764.1| catalase 1 [Nicotiana tabacum]
Length=492

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI+KENNFKQPGDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIR+ WIS
Sbjct  410  STMCTGKREKCVIQKENNFKQPGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRTIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA64220.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAZ29552.1| catalase-C [Oryza sativa Indica Group]
Length=500

 Score =   226 bits (575),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P
Sbjct  358  DTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIP  417

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS PR+THEIRS W+S
Sbjct  418  SATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSGPRLTHEIRSIWLS  477

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRL+ +P+M
Sbjct  478  YWSQADRSLGQKLASRLSAKPSM  500



>gb|AAB86582.2| catalase [Raphanus sativus]
Length=491

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  408

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  409  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  468

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  469  YWSQADKSLGQKLASRLNVRPSI  491



>gb|AAF71742.1|AF248491_1 catalase [Raphanus sativus]
Length=492

 Score =   225 bits (574),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>sp|Q01297.2|CATA1_RICCO RecName: Full=Catalase isozyme 1 [Ricinus communis]
 gb|AAB31537.1| catalase 1 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04697.1| catalase CAT1 [Ricinus communis]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+ D  RNAE FP P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRCDPARNAESFPVP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +G+R+KCVIEKENNFKQPG+RYRSWAPDRQ+RF+NR V  LS+PR+THE+R+ WIS
Sbjct  410  SAICSGKREKCVIEKENNFKQPGERYRSWAPDRQERFLNRLVGGLSDPRITHELRTIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y  Q D+SLGQK+A+RLN++P++
Sbjct  470  YWIQCDKSLGQKLATRLNVKPSI  492



>sp|P45739.1|CATA_HELAN RecName: Full=Catalase [Helianthus annuus]
 gb|AAA69866.1| catalase [Helianthus annuus]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+S
Sbjct  410  PVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRP  224
            Y +QAD+SLGQK+ASRLN++P
Sbjct  470  YWSQADKSLGQKIASRLNVKP  490



>gb|AAK96854.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>prf||2104177A catalase
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/141 (70%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN YDG+MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHYDGFMNFMHRDEEIDYFPSRYDPARHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               ++G+RDKCVIEKENNFKQPG+RYRS++PDRQ+RFINR V  LS+PRVTHE+RS W+S
Sbjct  410  PVRLSGKRDKCVIEKENNFKQPGERYRSFSPDRQERFINRVVGGLSDPRVTHEVRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRP  224
            Y +QAD+SLGQK+ASRLN++P
Sbjct  470  YWSQADKSLGQKIASRLNVKP  490



>ref|XP_006342134.1| PREDICTED: catalase isozyme 3-like [Solanum tuberosum]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRLDPCRHAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG+R+K +IEKENNFKQPG+ YRSWAP RQ+RF+ RWV +LS+ R THEIRS WIS
Sbjct  410  PRVLTGKREKVIIEKENNFKQPGEHYRSWAPGRQERFVCRWVDALSDLRATHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLNIRPTM
Sbjct  470  YWSQADKSLGQKLASRLNIRPTM  492



>sp|P49315.1|CATA1_NICPL RecName: Full=Catalase isozyme 1, partial [Nicotiana plumbaginifolia]
 emb|CAA85424.1| catalase [Nicotiana plumbaginifolia]
Length=485

 Score =   225 bits (573),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  343  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  402

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  403  STMCTGKREKCVIQKENNFKQPGERYRSFTPDRQERFIRRWVETLSDPRITYEIRSIWIS  462

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  463  YWSQADKSLGQKLASRLNVRPSI  485



>ref|XP_011074090.1| PREDICTED: catalase isoform X1 [Sesamum indicum]
Length=513

 Score =   226 bits (575),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNY+ LPVNA KC +HNN +DG MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  371  DTQRHRIGPNYLQLPVNAPKCPHHNNHHDGAMNFMHRDEEVNYFPSRYDPCRHAEKFPIP  430

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+R K VIEKENNFKQPGDRYRSWAPDRQ+RFI RW+ +LS+PR+T EIRS W+S
Sbjct  431  PVVLSGQRVKTVIEKENNFKQPGDRYRSWAPDRQERFIRRWIDALSDPRLTAEIRSIWVS  490

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y TQAD+SLGQK+ASRLN+RP M
Sbjct  491  YWTQADKSLGQKLASRLNVRPAM  513



>prf||1906388A catalase
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AAD30292.1|AF139539_1 catalase 3 [Raphanus sativus]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KC+I+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIRS WIS
Sbjct  410  NKSYTGIRTKCIIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD SLGQK+ASRLN+RP++
Sbjct  470  YWSQADASLGQKLASRLNVRPSI  492



>ref|NP_195235.1| catalase 2 [Arabidopsis thaliana]
 sp|P25819.3|CATA2_ARATH RecName: Full=Catalase-2 [Arabidopsis thaliana]
 emb|CAA17773.1| catalase [Arabidopsis thaliana]
 emb|CAB80226.1| catalase [Arabidopsis thaliana]
 gb|AAL66998.1| putative catalase [Arabidopsis thaliana]
 gb|AAM44902.1| putative catalase [Arabidopsis thaliana]
 gb|AEE86462.1| catalase 2 [Arabidopsis thaliana]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CAA45564.1| catalase [Arabidopsis thaliana]
Length=492

 Score =   225 bits (574),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDQVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYR++ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRTFTPERQERFIQRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010523643.1| PREDICTED: catalase-2-like [Tarenaya hassleriana]
Length=492

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERYPVP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +GRR++C+IEKENNFKQPG+RYRS+ PDR++RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  SVVCSGRRERCIIEKENNFKQPGERYRSFTPDRKERFIRRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASR+N+RP +
Sbjct  470  YWSQADQSLGQKLASRMNVRPNI  492



>gb|AAD17935.1| catalase [Brassica juncea]
Length=492

 Score =   225 bits (573),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 129/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD++LGQK+ASRLN+RP++
Sbjct  470  YWSQADKTLGQKLASRLNVRPSI  492



>gb|KFK30147.1| catalase [Arabis alpina]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDTVRHAEKYPAP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFPPERQERFIRRWIEALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDY40645.1| BnaA03g53180D [Brassica napus]
Length=485

 Score =   224 bits (572),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  343  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  402

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  403  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  462

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP +
Sbjct  463  YWSQADKSLGQKLASRLNVRPNI  485



>ref|XP_010094556.1| Catalase isozyme 1 [Morus notabilis]
 gb|EXB56310.1| Catalase isozyme 1 [Morus notabilis]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HR+EEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHREEEVNYFPSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TGRR++ VI+KENNFKQPG+RYRS++PDRQ+RFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  SAICTGRRERTVIDKENNFKQPGERYRSFSPDRQERFIKRWVNALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>gb|AAD30291.2|AF139538_1 catalase 2 [Raphanus sativus]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             +  TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSE R+THEIRS WIS
Sbjct  410  SKSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSELRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRLN+RP++
Sbjct  470  YWSQADRSLGQKLASRLNVRPSI  492



>ref|XP_009138342.1| PREDICTED: catalase-2 [Brassica rapa]
 gb|AAD17934.1| catalase [Brassica juncea]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP +
Sbjct  470  YWSQADKSLGQKLASRLNVRPNI  492



>dbj|BAA34205.1| catalase [Oryza sativa Japonica Group]
 gb|AAQ19030.1| catalase [Oryza sativa]
Length=492

 Score =   225 bits (573),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P
Sbjct  350  DTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+S
Sbjct  410  SATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>ref|NP_001048861.1| Os03g0131200 [Oryza sativa Japonica Group]
 gb|ABF93810.1| Catalase-1, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF10775.1| Os03g0131200 [Oryza sativa Japonica Group]
 dbj|BAG88238.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89941.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74449.1| hypothetical protein OsI_09857 [Oryza sativa Indica Group]
 gb|EEE58275.1| hypothetical protein OsJ_09293 [Oryza sativa Japonica Group]
Length=492

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P
Sbjct  350  DTQRHRLGPNYLLLPPNAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               +TGRR+K VI KENNFKQPG+RYRSW P RQDRFI RW+ +LS+PR+THEIRS W+S
Sbjct  410  SATLTGRREKVVIAKENNFKQPGERYRSWDPARQDRFIKRWIDALSDPRLTHEIRSIWLS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>gb|KGN55499.1| hypothetical protein Csa_4G658590 [Cucumis sativus]
Length=492

 Score =   224 bits (572),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPARHAERYPHP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R++CVI+KENNFK+PG+RYRSW PDRQ+RFI RWV +LS+PRVTHEIRS WI+
Sbjct  410  PAVCTGKRERCVIQKENNFKEPGERYRSWTPDRQERFIRRWVDALSDPRVTHEIRSIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRS+GQK+AS LN+RP++
Sbjct  470  YWSQADRSVGQKLASHLNVRPSI  492



>sp|P48350.1|CATA1_CUCPE RecName: Full=Catalase isozyme 1 [Cucurbita pepo]
 dbj|BAA09506.1| catalase [Cucurbita pepo]
Length=492

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD +R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPSRHAERYPHP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNFK+PG+RYRSW PDRQ+RF+ RWV +LS+ RVTHEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFKEPGERYRSWTPDRQERFVRRWVDALSDTRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP++
Sbjct  470  YWSQADRSLGQKLASHLNVRPSI  492



>gb|AAD17936.1| catalase [Brassica juncea]
Length=492

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +G+R++C+IEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAICSGKRERCIIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+A+RLN+RP++
Sbjct  470  YWSQADKSLGQKLANRLNVRPSI  492



>gb|ACA50528.1| putative catalase 2 [Brassica napus]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++C+IEKENNF+QPG+RYRSW  DRQ+RF+ R+V++L+EPRVTHEIRS WIS
Sbjct  410  PAVCSGKRERCIIEKENNFQQPGERYRSWDADRQERFVKRFVEALAEPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRP  224
            Y TQAD+SLGQK+ASRLN+RP
Sbjct  470  YWTQADKSLGQKLASRLNVRP  490



>ref|XP_010536468.1| PREDICTED: catalase-3-like [Tarenaya hassleriana]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P
Sbjct  350  DTQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +G R KCVIEKENNFKQPGDRYRSWAPDRQ+R+ NRWV++LS+ RVT EIR  WIS
Sbjct  410  SAICSGERVKCVIEKENNFKQPGDRYRSWAPDRQERYANRWVEALSDARVTDEIRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  470  YLSQSDKSLGMKVANRLNVRPSF  492



>sp|P32290.1|CATA_VIGRR RecName: Full=Catalase [Vigna radiata var. radiata]
 dbj|BAA02755.1| catalase [Vigna radiata var. radiata]
Length=492

 Score =   224 bits (571),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+LLP NA K  +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  350  DSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRFI RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAVFSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFIRRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP +
Sbjct  470  YWSQADRSLGQKIASHLNMRPNI  492



>gb|AAC48918.1| salicylic acid binding catalase, partial [Nicotiana tabacum]
Length=489

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R+AE++P P
Sbjct  347  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRHAEQYPIP  406

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TGRR+ CVIEKENNFKQ G+RYRSW PDRQDR++++WV+ LS+PRVT+EIRS WI 
Sbjct  407  SRVLTGRREMCVIEKENNFKQAGERYRSWEPDRQDRYVSKWVEHLSDPRVTYEIRSIWIC  466

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
             L+QAD+S GQKVASRL ++PTM
Sbjct  467  SLSQADKSCGQKVASRLTLKPTM  489



>ref|XP_009106100.1| PREDICTED: catalase-2 [Brassica rapa]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVN+ KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP +
Sbjct  470  YWSQADKSLGQKLASRLNVRPNI  492



>gb|AHF27433.1| catalase [Cucurbita maxima]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMP  408

Query  466  LRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WI
Sbjct  409  PNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP +
Sbjct  469  SYWSQADRSLGQKIASRLNVRPNI  492



>gb|AHF27430.1| catalase [Cucurbita moschata]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMP  408

Query  466  LRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVTHE+R+ WI
Sbjct  409  PNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTHEVRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP +
Sbjct  469  SYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_006382992.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60789.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
Length=490

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P
Sbjct  348  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  407

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WIS
Sbjct  408  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  467

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RP++
Sbjct  468  YWSQADKSLGQKLASHLNMRPSI  490



>ref|XP_009794245.1| PREDICTED: catalase isozyme 1 [Nicotiana sylvestris]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI+KENNFKQ GDRYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  410  STMCTGKREKCVIQKENNFKQAGDRYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CDP01803.1| unnamed protein product [Coffea canephora]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN +DG+MNF+HRDEEVDYFPS++D  R+AE  P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHDGFMNFMHRDEEVDYFPSRYDPVRHAEMHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+K +I KENNFKQPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WIS
Sbjct  410  SAVLTGRREKTIIPKENNFKQPGERYRSFAPDRQERFICRWVDALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLNIRP++
Sbjct  470  YWSQADKSLGQKLASRLNIRPSI  492



>ref|XP_004500876.1| PREDICTED: catalase-4-like isoform X1 [Cicer arietinum]
Length=493

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP
Sbjct  351  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTP  410

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WIS
Sbjct  411  PAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWIS  470

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP++
Sbjct  471  YWSQADRSLGQKIASHLNMRPSI  493



>emb|CDY17510.1| BnaC03g65530D [Brassica napus]
Length=477

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  335  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  394

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++LS+PR+THEIRS WIS
Sbjct  395  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALSDPRITHEIRSIWIS  454

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD++LGQK+AS LN+RP++
Sbjct  455  YWSQADKTLGQKLASHLNVRPSI  477



>ref|NP_001235974.1| catalase-3 [Glycine max]
 sp|O48560.1|CATA3_SOYBN RecName: Full=Catalase-3 [Glycine max]
 gb|AAB88171.1| catalase [Glycine max]
 gb|KHN12602.1| Catalase-3 [Glycine soja]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP N+ KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AER P P
Sbjct  350  DTQRHRLGPNYLQLPANSPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAERVPVP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R + G+R+KC+IEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIRS WIS
Sbjct  410  PRTLGGKREKCMIEKENNFKQPGERYRSWPSDRQERFVRRWVDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN++P++
Sbjct  470  YWSQADRSLGQKIASHLNLKPSI  492



>ref|XP_002306427.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 ref|XP_006382993.1| catalase family protein [Populus trichocarpa]
 emb|CAI43950.1| catalase [Populus deltoides]
 gb|EEE93423.1| hypothetical protein POPTR_0005s10340g [Populus trichocarpa]
 gb|ERP60790.1| catalase family protein [Populus trichocarpa]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WIS
Sbjct  410  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RP++
Sbjct  470  YWSQADKSLGQKLASHLNMRPSI  492



>emb|CDX72514.1| BnaC07g45360D [Brassica napus]
Length=480

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MN +HRDEEV+YFPS++D  R+AE++PTP
Sbjct  338  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNVMHRDEEVNYFPSRYDPVRHAEKYPTP  397

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  398  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIGRWIDALSDPRITHEIRSIWIS  457

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  458  YWSQADKSLGQKLASRLNVRPSI  480



>gb|EYU30275.1| hypothetical protein MIMGU_mgv1a005250mg [Erythranthe guttata]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+RD+C IEKENNFKQPG+RYR+++PDRQ+RFI RWV +LS+PR+THEIRS WIS
Sbjct  410  PVVLSGKRDRCCIEKENNFKQPGERYRTFSPDRQERFIRRWVDALSDPRLTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RPTM
Sbjct  470  YWSQADKSLGQKLASRLNVRPTM  492



>gb|ACJ22771.1| catalase 1 [Jatropha curcas]
 gb|KDP36790.1| hypothetical protein JCGZ_08081 [Jatropha curcas]
Length=492

 Score =   224 bits (570),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNYM LPVNA KC +HNN YDG+MNF+HRDEE+DYF S++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYMQLPVNAPKCPHHNNHYDGFMNFMHRDEEIDYFQSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I++GRR+KCVI KENNFKQPG+RYRSW PDRQ+RF+ R V +LS+PR+THEIR  W+S
Sbjct  410  NAIISGRREKCVIPKENNFKQPGERYRSWTPDRQERFLCRLVNALSDPRITHEIRGIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+ASRLN+RP +
Sbjct  470  YWSQCDQSLGQKLASRLNVRPNI  492



>gb|AAC49807.1| catalase 3 [Arabidopsis thaliana]
 gb|AAC17732.1| catalase 3 [Arabidopsis thaliana]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  W S
Sbjct  410  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWTS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y  +ADRSLGQK+ASRLN+RP++
Sbjct  470  YWLKADRSLGQKLASRLNVRPSI  492



>sp|P30567.1|CATA2_GOSHI RecName: Full=Catalase isozyme 2 [Gossypium hirsutum]
 emb|CAA39998.1| subunit 2 of cotton catalase [Gossypium hirsutum]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WIS
Sbjct  410  STVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKIASRLNVRPSI  492



>sp|P49318.1|CATA2_RICCO RecName: Full=Catalase isozyme 2 [Ricinus communis]
 gb|AAB31538.1| catalase 2 [Ricinus communis=castor beans, hypocotyls, Peptide, 
492 aa]
 dbj|BAA04698.1| catalase CAT2 [Ricinus communis]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLG NY+ LPVNA KC YHNN YDG+MNF+HRDEEVDYF S++D  R+AE+ P P
Sbjct  350  DTQRHRLGTNYLQLPVNAPKCPYHNNHYDGFMNFMHRDEEVDYFQSRYDPVRHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+KCVIEKE+NF+QPGDRYRSWAPDRQ+RF+ R V +LSEPR+THEIRS W+S
Sbjct  410  NAICSGRREKCVIEKEDNFRQPGDRYRSWAPDRQERFLCRLVNALSEPRITHEIRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            + TQ D+SLGQK+ASRLN+RP +
Sbjct  470  WWTQCDKSLGQKLASRLNVRPNI  492



>gb|KHG12976.1| Catalase isozyme 2 [Gossypium arboreum]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              +++G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+PRVTHEIRS WIS
Sbjct  410  STVLSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKIASRLNVRPSI  492



>ref|XP_004500877.1| PREDICTED: catalase-4-like isoform X2 [Cicer arietinum]
Length=492

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+ D  R+AERFPTP
Sbjct  350  DSQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFIHRDEEVNYFPSRHDPVRHAERFPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               ++G+R++C+  KENNFKQPG+RYR+WAPDRQDRF  RW+++LS+PRVTHE+RS WIS
Sbjct  410  PAALSGKRERCIRPKENNFKQPGERYRTWAPDRQDRFARRWIEALSDPRVTHEVRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS LN+RP++
Sbjct  470  YWSQADRSLGQKIASHLNMRPSI  492



>gb|ACJ73906.1| CAT2 [Solanum nigrum]
Length=315

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNNS DG MNF+HRDEEVDY PS+FD  R AE++P P
Sbjct  173  DTQRHRIGPNYMQLPVNAPKCAHHNNSRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIP  232

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ G R  CV  KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEI S WIS
Sbjct  233  SCVLNGPRTMCVTPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIPSIWIS  292

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++P M
Sbjct  293  YLSQADKSCGQKVASRLTVKPPM  315



>ref|NP_001234827.1| catalase isozyme 1 [Solanum lycopersicum]
 sp|P30264.1|CATA1_SOLLC RecName: Full=Catalase isozyme 1 [Solanum lycopersicum]
 gb|AAA34145.1| catalase [Solanum lycopersicum]
 prf||1909364A catalase
Length=492

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR  CVI KENNFKQ G+RYRSW PDRQDR+IN+WV+SLS+PRVTHEIRS WIS
Sbjct  410  SCVLNGRRTNCVIPKENNFKQAGERYRSWEPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>gb|ABQ44283.1| catalase [Saccharum hybrid cultivar NCo 376]
Length=339

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG+MNF+HRDEEVDYFPS++D  +NA R+P P
Sbjct  197  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKNAPRYPIP  256

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               +TGRRDK VI KENNFKQPG+RYR+  P RQ+RFI RWV +LS+PR+THEIRS W+S
Sbjct  257  TVHITGRRDKTVIAKENNFKQPGERYRAMDPARQERFIKRWVDALSDPRLTHEIRSIWLS  316

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
              +QADRSLGQK+ASRL+ +P+M
Sbjct  317  NWSQADRSLGQKLASRLSAKPSM  339



>gb|ACB11496.1| catalase [Pinus sylvestris]
Length=492

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG+R+KCVIEKENNFKQPG+RYRS+AP+RQ+RF+ RWV +LS+PRVTHEI S WIS
Sbjct  410  SHTHTGKREKCVIEKENNFKQPGERYRSFAPERQERFVKRWVAALSDPRVTHEICSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D+SLGQK+A+RLN++  M
Sbjct  470  YWSQCDKSLGQKIAARLNMKANM  492



>gb|AAD37788.1|AF149283_1 catalase 1 [Phaseolus vulgaris]
Length=428

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+ +P NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AER P P
Sbjct  291  DSQRHRLGPNYLQIPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAERIPVP  350

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             RI+ G+R+KC+IEKENNFKQPG+RYRSWA DRQ+RF+ RWV +LSEPRVTHEIRS WIS
Sbjct  351  PRILDGKREKCMIEKENNFKQPGERYRSWASDRQERFLRRWVDALSEPRVTHEIRSIWIS  410

Query  286  YLTQADRSLGQKVASRLN  233
            Y +QADRSLGQK+AS LN
Sbjct  411  YWSQADRSLGQKIASHLN  428



>ref|XP_010437527.1| PREDICTED: catalase-2 [Camelina sativa]
Length=492

 Score =   223 bits (569),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010432341.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDQVRHAEKYPAP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGKRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>gb|AFW69584.1| catalase1 [Zea mays]
Length=353

 Score =   219 bits (558),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  211  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  270

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WIS
Sbjct  271  PRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWIS  330

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D +LGQK+ASRLN++P+M
Sbjct  331  YWSQCDAALGQKLASRLNLKPSM  353



>ref|XP_009597278.1| PREDICTED: catalase isozyme 1 [Nicotiana tomentosiformis]
 emb|CCP37651.1| catalase-1 [Nicotiana tabacum]
Length=492

 Score =   223 bits (568),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE++P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R+KCVI+KENNF QPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  410  STMCTGKREKCVIQKENNFNQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>dbj|BAJ87148.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=302

 Score =   218 bits (554),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P
Sbjct  160  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMP  219

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+S
Sbjct  220  PRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVS  279

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRL I+P M
Sbjct  280  YWSQCDASLGQKLASRLKIKPNM  302



>gb|AAR14052.2| catalase [Solanum tuberosum]
Length=475

 Score =   222 bits (566),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P
Sbjct  333  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIP  392

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  393  STVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWIS  452

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  453  YWSQADKSLGQKLASRLNVRPSI  475



>ref|XP_011022275.1| PREDICTED: catalase-like [Populus euphratica]
Length=476

 Score =   222 bits (566),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P
Sbjct  334  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  393

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WIS
Sbjct  394  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  453

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RP +
Sbjct  454  YWSQADKSLGQKLASHLNMRPGI  476



>emb|CDY52649.1| BnaAnng11640D [Brassica napus]
Length=449

 Score =   221 bits (564),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVN+ KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  307  DTQRHRLGPNYLQLPVNSPKCSHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  366

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+R +RFI RW+ +LS+PR+THEIRS WIS
Sbjct  367  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERLERFIGRWIDALSDPRITHEIRSIWIS  426

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP +
Sbjct  427  YWSQADKSLGQKLASRLNVRPNI  449



>ref|NP_001234186.1| catalase isozyme 2 [Solanum lycopersicum]
 sp|Q9XHH3.1|CATA2_SOLLC RecName: Full=Catalase isozyme 2 [Solanum lycopersicum]
 gb|AAD41256.1| catalase 2 [Solanum lycopersicum]
Length=492

 Score =   223 bits (567),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+I+KENNFKQPG+RYRS+ PDRQ+RFI RWV++LS+PR+T+EIRS WI+
Sbjct  410  STVCSGKREKCIIQKENNFKQPGERYRSFTPDRQERFIRRWVEALSDPRITYEIRSIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_010934843.1| PREDICTED: catalase isozyme 2 [Elaeis guineensis]
 gb|AFS65099.1| catalase 2 [Elaeis guineensis]
Length=492

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY++LPVNA KC +HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P
Sbjct  350  DTQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+
Sbjct  410  SRVVTGKREKIVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YLTQ D SLGQKVA+RLN++P+M
Sbjct  470  YLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_007046520.1| Catalase 2 [Theobroma cacao]
 gb|EOX90677.1| Catalase 2 [Theobroma cacao]
Length=492

 Score =   222 bits (566),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +G+R+KC+I+KENNF+QPG+RYRS+APDRQ+RFI RWV +LS+PRVT+EIRS WIS
Sbjct  410  TAICSGKREKCIIDKENNFQQPGERYRSFAPDRQERFIYRWVDALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y ++AD+SLGQK+ASRL++RP++
Sbjct  470  YWSKADKSLGQKLASRLSVRPSI  492



>ref|XP_011022153.1| PREDICTED: catalase-2-like isoform X2 [Populus euphratica]
Length=492

 Score =   222 bits (566),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WIS
Sbjct  410  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RP +
Sbjct  470  YWSQADKSLGQKLASHLNMRPGI  492



>ref|XP_006656514.1| PREDICTED: catalase isozyme B-like [Oryza brachyantha]
Length=492

 Score =   222 bits (565),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGTMNFMHRDEEVNYFPSRFDAARHAEKVPVP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KCVI KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PR+THE+R  WIS
Sbjct  410  PRVLTGCREKCVINKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRITHELRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRLN++P M
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>ref|XP_008791900.1| PREDICTED: catalase isozyme 2 [Phoenix dactylifera]
Length=492

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY++LPVNA KC +HNN +DG MNF+ R+EEVDYFPS+ D  R+AERFP P
Sbjct  350  DTQRYRLGPNYLMLPVNAPKCAFHNNQFDGLMNFMQRNEEVDYFPSRHDPLRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R+VTG+R+K VI K+N+FKQPG+RYRSWAPDRQ+RF+ RW +SL  P+V+HE+RS WI+
Sbjct  410  SRVVTGKREKTVIPKQNDFKQPGERYRSWAPDRQERFVRRWAESLGHPKVSHELRSIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YLTQ D SLGQKVA+RLN++P+M
Sbjct  470  YLTQCDVSLGQKVANRLNVKPSM  492



>ref|XP_006649332.1| PREDICTED: catalase-1-like [Oryza brachyantha]
Length=492

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG+MNF+HRDEEVDYFPS++D  ++A R+P P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGFMNFMHRDEEVDYFPSRYDPAKHAPRYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               +TGRR+K VI KENNFKQPG+RYRSW P RQ+RFI RW+ +LS+PR+THEIRS W+S
Sbjct  410  SVNLTGRREKTVIPKENNFKQPGERYRSWDPARQERFIKRWIDALSDPRLTHEIRSIWLS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>ref|XP_011022152.1| PREDICTED: catalase-2-like isoform X1 [Populus euphratica]
Length=511

 Score =   222 bits (566),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AER+P P
Sbjct  369  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERYPNP  428

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I TG+R+KC+IEKENNFKQPG+RYRS++PDR++RF+ RWV++LS+PRVT+EIRS WIS
Sbjct  429  SVIHTGKREKCIIEKENNFKQPGERYRSFSPDRKERFVRRWVEALSDPRVTYEIRSIWIS  488

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RP +
Sbjct  489  YWSQADKSLGQKLASHLNMRPGI  511



>gb|AAO17721.1| catalase [Hypericum perforatum]
Length=492

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA K  +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKSAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR+KC+I KENNFKQPG+RYRS++PDRQ+RF+NRW+ SLS+PRVTHEIR+ W++
Sbjct  410  PVVLNGRREKCMIAKENNFKQPGERYRSFSPDRQERFLNRWISSLSDPRVTHEIRAIWVT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y  QAD+SLGQK+ASRLN+RP M
Sbjct  470  YWYQADKSLGQKLASRLNVRPNM  492



>pir||S40265 catalase (EC 1.11.1.6) - eggplant
Length=502

 Score =   222 bits (565),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MNF+HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCAHHNNHRDGAMNFMHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+KCVI KENNFKQ G+RYR+W PDRQDR+IN+WV+SLS+PRVTHEIRS WIS
Sbjct  410  SCVLTGRREKCVIPKENNFKQAGERYRTWEPDRQDRYINKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRL  236
            YL+QAD+S GQKVASRL
Sbjct  470  YLSQADKSCGQKVASRL  486



>sp|A2YH64.2|CATA2_ORYSI RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Indica 
Group]
 gb|EEC81340.1| hypothetical protein OsI_24526 [Oryza sativa Indica Group]
Length=492

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WIS
Sbjct  410  PRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRLN++P M
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AAY59707.1| catalase [Oryza sativa Indica Group]
Length=492

 Score =   221 bits (564),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KCVI+KENNFKQ G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WIS
Sbjct  410  PRVLTGCREKCVIDKENNFKQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRLN++P M
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>gb|AAC19397.1| leaf catalase [Mesembryanthemum crystallinum]
Length=492

 Score =   221 bits (564),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN YDG MNF+HRD+EVDYFPS++D  R+AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHYDGQMNFMHRDDEVDYFPSRYDPVRHAERYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ G RD+ +I+KENNFKQPG+RYRSW P RQ+RFI RWV +LS+PR+THEIR+ WIS
Sbjct  410  PNVLNGNRDRQIIQKENNFKQPGERYRSWDPARQERFICRWVDALSDPRITHEIRNIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+S+G K+ASRLN+RPTM
Sbjct  470  YWSQADKSVGMKLASRLNVRPTM  492



>gb|KDP43757.1| hypothetical protein JCGZ_22384 [Jatropha curcas]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPPNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++TGRR+K VI KENNFKQPG+RYRS+ PDR+DRFI RWV++LS+PRVT+EIRS WIS
Sbjct  410  PPVLTGRREKTVIPKENNFKQPGERYRSFTPDRKDRFIRRWVEALSDPRVTYEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+AS LN+RPTM
Sbjct  470  YWSQADKSLGQKIASHLNMRPTM  492



>ref|XP_010446982.1| PREDICTED: catalase-2-like [Camelina sativa]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRYDPVRHAEKYPAP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G R++CVI KENNFK+PG+RYRS+ P+RQ+RFI RW+ +LS+PR+THEIRS WIS
Sbjct  410  PAVCSGTRERCVIAKENNFKEPGERYRSFPPERQERFICRWIDALSDPRITHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>ref|XP_008464839.1| PREDICTED: catalase isozyme 3 [Cucumis melo]
 gb|ADN33988.1| catalase [Cucumis melo subsp. melo]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 128/144 (89%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMP  408

Query  466  LRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WI
Sbjct  409  PNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASR+N+RP++
Sbjct  469  SYWSQADRSLGQKIASRMNVRPSI  492



>ref|XP_006340832.1| PREDICTED: catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P
Sbjct  350  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDQVRHAEVYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+I+KENNFKQPG+RYR++ PDRQ+RFI RWV++LS+PR+T+EIRS WI+
Sbjct  410  STVCSGKREKCIIQKENNFKQPGERYRTFTPDRQERFIRRWVEALSDPRITYEIRSIWIT  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKLASRLNVRPSI  492



>emb|CAG23920.1| catalase [Festuca arundinacea]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG MNF+HRDEEVDYFPS+FD   +A R+P P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPATDAPRYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+S
Sbjct  410  SRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+A RL+++P+M
Sbjct  470  YWSQADRSLGQKLAGRLSVKPSM  492



>gb|ABK24453.1| unknown [Picea sitchensis]
Length=492

 Score =   221 bits (563),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LP NA KC +HNN ++G+MNF+HRDEEV+YFPS+FD  R+AERFP P
Sbjct  350  DTQRHRLGPNYLMLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRFDPVRHAERFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                +G R+KCVIEKENNFKQPG+RYRS+ PDRQ+RF+ RWV +LS+PRVTHEI S WIS
Sbjct  410  SHTHSGMREKCVIEKENNFKQPGERYRSFEPDRQERFVKRWVAALSDPRVTHEICSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q+D+SLGQK+A+RLN++  M
Sbjct  470  YWSQSDKSLGQKIAARLNMKANM  492



>ref|XP_008452957.1| PREDICTED: catalase isozyme 1-like [Cucumis melo]
Length=492

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+ D   +AER+P P
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRIDPAHHAERYPQP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + TG+R++CVIEKENNFKQPG+RYRSW  DRQ+RF+ RWV +LS+PRVTHEIR+ WIS
Sbjct  410  PAVYTGKRERCVIEKENNFKQPGERYRSWPADRQERFVGRWVDALSDPRVTHEIRNIWIS  469

Query  286  YLTQADRSLGQKVASRLNIR  227
            Y +QAD+SLGQK+ASRLN++
Sbjct  470  YWSQADKSLGQKLASRLNVK  489



>gb|ABC01913.1| catalase isozyme 1-like protein [Solanum tuberosum]
Length=492

 Score =   221 bits (562),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WIS
Sbjct  410  ACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>gb|ADZ45555.1| catalase [Vigna radiata]
Length=492

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D+ RHRLGPNY+LLP NA K  +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  350  DSQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS L++RP +
Sbjct  470  YWSQADRSLGQKIASHLSMRPNI  492



>gb|AAF79625.1|AC027665_26 F5M15.5 [Arabidopsis thaliana]
 gb|AAF80611.1|AC069251_4 F2D10.11 [Arabidopsis thaliana]
Length=1013

 Score =   227 bits (579),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEE++Y+PSKFD  R AE+ PTP
Sbjct  389  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEINYYPSKFDPVRCAEKVPTP  448

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                TG R KCVI+KENNFKQ GDRYRSWAPDRQDRF+ RWV+ LSEPR+THEIR  WIS
Sbjct  449  TNSYTGIRTKCVIKKENNFKQAGDRYRSWAPDRQDRFVKRWVEILSEPRLTHEIRGIWIS  508

Query  286  YLTQADRSLGQKVASRLNIRPT  221
            Y +QADRSLGQK+ASRLN+RP+
Sbjct  509  YWSQADRSLGQKLASRLNVRPS  530


 Score =   216 bits (550),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646   DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
             D+ RHRLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+ D  R+AE++PT 
Sbjct  871   DSQRHRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRLDPVRHAEKYPTT  930

Query  466   LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
               + +G R+KC I KENNFKQPG+RYRSW  DRQ+RF+ R+V++LSEPRVTHEIRS WIS
Sbjct  931   PIVCSGNREKCFIGKENNFKQPGERYRSWDSDRQERFVKRFVEALSEPRVTHEIRSIWIS  990

Query  286   YLTQADRSLGQKVASRLNIRPTM  218
             Y +QAD+SLGQK+A+RLN+RP  
Sbjct  991   YWSQADKSLGQKLATRLNVRPNF  1013



>dbj|BAA05494.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   220 bits (561),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WIS
Sbjct  410  PRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRLN++P M
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>dbj|BAA34204.1| catalase [Oryza sativa Japonica Group]
Length=492

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WIS
Sbjct  410  PRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRLN++P M
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>ref|NP_001058635.1| Os06g0727200 [Oryza sativa Japonica Group]
 sp|Q0D9C4.1|CATA2_ORYSJ RecName: Full=Catalase isozyme B; Short=CAT-B [Oryza sativa Japonica 
Group]
 dbj|BAD61813.1| catalase [Oryza sativa Japonica Group]
 dbj|BAF20549.1| Os06g0727200 [Oryza sativa Japonica Group]
 gb|EAZ38347.1| hypothetical protein OsJ_22721 [Oryza sativa Japonica Group]
 dbj|BAG91437.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94401.1| unnamed protein product [Oryza sativa Japonica Group]
Length=492

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC YHNN +DG MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAYHNNHHDGSMNFMHRDEEVNYFPSRFDAARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KCVI+KENNF+Q G+RYRS+ P RQDRF+ RWV +LS+PR+THE+R  WIS
Sbjct  410  PRVLTGCREKCVIDKENNFQQAGERYRSFDPARQDRFLQRWVDALSDPRITHELRGIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRLN++P M
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>sp|Q43206.1|CATA1_WHEAT RecName: Full=Catalase-1 [Triticum aestivum]
 dbj|BAA13068.1| catalase [Triticum aestivum]
 gb|ADF83496.1| catalase [Triticum aestivum]
Length=492

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+S
Sbjct  410  SRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRL+ +P+M
Sbjct  470  YWSQADKSLGQKLASRLSSKPSM  492



>gb|EMT05040.1| Catalase-1 [Aegilops tauschii]
Length=526

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P
Sbjct  384  DTQRHRLGPNYLLLPANAPKCSHHNNHYDGLMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  443

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R + GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI++ W+S
Sbjct  444  SRTLNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKAIWLS  503

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRL+ +P+M
Sbjct  504  YWSQADKSLGQKLASRLSSKPSM  526



>sp|P48352.1|CATA3_CUCPE RecName: Full=Catalase isozyme 3 [Cucurbita pepo]
 dbj|BAA09508.1| catalase [Cucurbita pepo]
Length=492

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/144 (69%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMP  408

Query  466  LRIVTGRRDKCVIEKE-NNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              ++TG+R++CVI KE NNFKQ GDRYRSWAPDRQDRF+ R+V++LS+PRVT E+R+ WI
Sbjct  409  PNVLTGKRERCVIPKENNNFKQAGDRYRSWAPDRQDRFVKRFVEALSDPRVTDEVRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASRLN+RP +
Sbjct  469  SYWSQADRSLGQKIASRLNVRPNI  492



>ref|XP_004144240.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
Length=483

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  340  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMP  399

Query  466  LRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WI
Sbjct  400  PNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWI  459

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASR+N+RP +
Sbjct  460  SYWSQADRSLGQKIASRMNVRPNI  483



>gb|AHF27429.1| catalase, partial [Cucurbita moschata]
Length=461

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  318  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPMP  377

Query  466  LRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ WI
Sbjct  378  PNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWI  437

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQADRSLGQK+ASR+N RP M
Sbjct  438  SYWTQADRSLGQKIASRMNARPNM  461



>ref|XP_010534184.1| PREDICTED: catalase isozyme 3-like [Tarenaya hassleriana]
Length=492

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+FD+ R+A ++P P
Sbjct  350  DTQRYRLGPNYLQLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDSVRHAAKYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G R KCVIEKENNFKQPG+RYRSWAPDRQ+R+  RWV++LS+ RVT EIR  WIS
Sbjct  410  SAVCSGERIKCVIEKENNFKQPGERYRSWAPDRQERYAKRWVEALSDARVTDEIRGVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+Q+D+SLG KVA+RLN+RP+ 
Sbjct  470  YLSQSDKSLGMKVANRLNVRPSF  492



>gb|AHF27432.1| catalase, partial [Cucurbita maxima]
Length=461

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  318  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPMP  377

Query  466  LRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ WI
Sbjct  378  PNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWI  437

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQADRSLGQK+ASR+N RP M
Sbjct  438  SYWTQADRSLGQKIASRMNARPNM  461



>gb|ADM96039.1| catalase [Cucumis sativus]
Length=492

 Score =   220 bits (560),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMP  408

Query  466  LRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WI
Sbjct  409  PNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASR+N+RP +
Sbjct  469  SYWSQADRSLGQKIASRMNVRPNI  492



>gb|AAM97541.1| catalase 2, partial [Capsicum annuum]
Length=484

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT R+RLGPNY+ LP NA KC +HNN YDG MNF+HRDEE+DYFPS++D  R+AE +P P
Sbjct  342  DTQRYRLGPNYLQLPANAPKCAHHNNHYDGSMNFMHRDEEIDYFPSRYDPVRHAENYPIP  401

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+I+KENNF+QPG+RYRS++ DRQ+RFI RWV++LS+PR+T+EIRS WIS
Sbjct  402  TTVCSGKREKCIIQKENNFQQPGERYRSFSADRQERFIRRWVEALSDPRITYEIRSIWIS  461

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  462  YWSQADKSLGQKLASRLNVRPSI  484



>ref|XP_004158284.1| PREDICTED: catalase isozyme 3-like [Cucumis sativus]
 gb|KGN47533.1| Catalase isozyme 3 [Cucumis sativus]
Length=492

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 127/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDPCRHAEKFPMP  408

Query  466  LRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+ R+V++LS+PRVTHE+R+ WI
Sbjct  409  PNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVRRFVEALSDPRVTHEVRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY +QADRSLGQK+ASR+N+RP +
Sbjct  469  SYWSQADRSLGQKIASRMNVRPNI  492



>gb|AAC17729.1| catalase 1, partial [Hordeum vulgare subsp. vulgare]
Length=398

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG MNF+HRDEEV+YFPS+FD TR+AE++P P
Sbjct  256  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGLMNFIHRDEEVNYFPSRFDPTRHAEKYPMP  315

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R+++G R+KC+I+KENNFKQ G+RYRS+ P RQDRF+ RWV +L++ RVTHEI+S W+S
Sbjct  316  PRVLSGCREKCIIDKENNFKQAGERYRSFDPARQDRFLQRWVDALTDARVTHEIQSIWVS  375

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRL I+P M
Sbjct  376  YWSQCDASLGQKLASRLKIKPNM  398



>ref|XP_009108683.1| PREDICTED: catalase-2-like isoform X2 [Brassica rapa]
Length=496

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/147 (65%), Positives = 128/147 (87%), Gaps = 4/147 (3%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRS  299
              + +G+R++CVIEKENNFK+PG RYRS+ PD    RQ+RFI RW+++LS+PR+THEIRS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGGRYRSFTPDSFDFRQERFIRRWIEALSDPRITHEIRS  469

Query  298  TWISYLTQADRSLGQKVASRLNIRPTM  218
             WISY +QAD++LGQK+ASRLN+RP++
Sbjct  470  IWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AHF21552.1| catalase [Hylocereus undatus]
Length=492

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D  R+RLG NYM+LPVNA KC +HNN YDG MNF+HRDEE+DYFPSKFD  R AE++P  
Sbjct  350  DAQRYRLGANYMMLPVNAPKCAHHNNQYDGVMNFMHRDEEIDYFPSKFDPARQAEKYPIL  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             ++ TG+R+K VI KENNFKQPGDRYRSW P RQ+RF+ RWV  LS+PRVT E+RS W+S
Sbjct  410  TKVYTGKREKTVIPKENNFKQPGDRYRSWDPARQERFVKRWVDVLSDPRVTLELRSIWVS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+Q DRSLG KVA+RLN+RPTM
Sbjct  470  YLSQCDRSLGMKVATRLNMRPTM  492



>ref|NP_001274863.1| catalase isozyme 1 [Solanum tuberosum]
 gb|ABY21246.1| catalase isozyme [Solanum tuberosum]
Length=492

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WIS
Sbjct  410  ACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>gb|ADZ45556.1| catalase [Vigna radiata]
Length=492

 Score =   219 bits (559),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            D  RHRLGPNY+LLP NA K  +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+FP P
Sbjct  350  DPQRHRLGPNYLLLPANAPKSAHHNNHHEGFMNFIHRDEEVNYFPSRYDPVRHAEKFPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              I +GRR+K  IEKENNFKQ G+R+RSWAPDRQDRF  RWV +LS+PRVTHEIRS WIS
Sbjct  410  PAICSGRREKIAIEKENNFKQAGERFRSWAPDRQDRFTRRWVDALSDPRVTHEIRSVWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+AS L++RP +
Sbjct  470  YWSQADRSLGQKIASHLSMRPNI  492



>emb|CAA42720.1| catalase-1 [Zea mays]
Length=492

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WIS
Sbjct  410  PRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D +LGQK+ASRLN++P+M
Sbjct  470  YWSQCDAALGQKLASRLNLKPSM  492



>gb|KJB17473.1| hypothetical protein B456_003G002800 [Gossypium raimondii]
Length=492

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LP NA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLQLPANAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKHPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R+KC+I KENNFKQPG+RYRS++ DRQ+RFINRW+ +LS+ RVTHEIRS WIS
Sbjct  410  STVYSGKREKCIIGKENNFKQPGERYRSFSADRQERFINRWIDALSDSRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD+SLGQK+ASRLN+RP++
Sbjct  470  YWSQADKSLGQKIASRLNVRPSI  492



>ref|NP_001241808.1| catalase isozyme B [Zea mays]
 gb|ACG48924.1| catalase isozyme B [Zea mays]
 gb|ACN25578.1| unknown [Zea mays]
 gb|AFW69583.1| catalase1 [Zea mays]
Length=492

 Score =   219 bits (559),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +L++PRVTHE R+ WIS
Sbjct  410  PRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALTDPRVTHEHRTIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D +LGQK+ASRLN++P+M
Sbjct  470  YWSQCDAALGQKLASRLNLKPSM  492



>sp|P49284.1|CATA1_SOLTU RecName: Full=Catalase isozyme 1 [Solanum tuberosum]
 gb|AAA80650.1| catalase [Solanum tuberosum]
Length=492

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MN  HRDEEVDYFPS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYFPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR  CVI KENN KQ G+RYRSW  DRQDR+IN+WV+SLS+PRVTHEIRS WIS
Sbjct  410  ACVLNGRRTNCVIPKENNSKQAGERYRSWESDRQDRYINKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>ref|XP_003558892.1| PREDICTED: catalase-1 [Brachypodium distachyon]
Length=492

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+LLP NA KC +HNN YDG MNF+HRDEEVDYFPS+FD  ++A R+P P
Sbjct  350  DTQRHRLGPNYLLLPANAPKCAHHNNHYDGTMNFMHRDEEVDYFPSRFDPAKHAPRYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
                 GRR+K VIEKENNFKQPG+RYRS  P RQ+RFINRW+ +LS+PR+THEI+S W+S
Sbjct  410  SSTCNGRREKMVIEKENNFKQPGERYRSMDPARQERFINRWIDALSDPRLTHEIKSIWLS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QADRSLGQK+ASRL+ +P+M
Sbjct  470  YWSQADRSLGQKLASRLSAKPSM  492



>gb|AIU99479.1| catalase [Saccharum arundinaceum]
Length=492

 Score =   219 bits (558),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY++LPVNA KC +HNN +DG+MNF+HRDEEV+YFPS+FD  R+AE+ P P
Sbjct  350  DTQRHRLGPNYLMLPVNAPKCAHHNNHHDGFMNFMHRDEEVNYFPSRFDPARHAEKVPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
             R++TG R+KC+I+KENNFKQ G+RYRS+ P RQDRFI RWV +LS+PRVTHE  + WIS
Sbjct  410  SRVLTGCREKCIIQKENNFKQAGERYRSFDPARQDRFIQRWVDALSDPRVTHEHHTIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +Q D SLGQK+ASRLN++P M
Sbjct  470  YWSQCDASLGQKLASRLNLKPNM  492



>sp|P48351.1|CATA2_CUCPE RecName: Full=Catalase isozyme 2 [Cucurbita pepo]
 dbj|BAA09507.1| catalase [Cucurbita pepo]
Length=492

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/144 (67%), Positives = 126/144 (88%), Gaps = 1/144 (1%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++P P
Sbjct  349  DTQRHRLGPNYLQLPVNAPKCPHHNNHHEGFMNFMHRDEEVNYFPSRYDACRHAEKYPMP  408

Query  466  LRIVTGRRDKCVIEKEN-NFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWI  290
              +++G+R++CVI KEN NFKQ GDRYRSWAPDRQ+RF+NR+V++LS+ +VTHE+R+ WI
Sbjct  409  PNVLSGKRERCVIPKENHNFKQAGDRYRSWAPDRQERFVNRFVEALSDSKVTHEVRNIWI  468

Query  289  SYLTQADRSLGQKVASRLNIRPTM  218
            SY TQADRSLGQK+ASR+N RP M
Sbjct  469  SYWTQADRSLGQKIASRMNARPNM  492



>gb|AAD17933.1| catalase [Brassica juncea]
Length=496

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 129/147 (88%), Gaps = 4/147 (3%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPD----RQDRFINRWVKSLSEPRVTHEIRS  299
              + +G+R++CVIEKENNFK+PG+RYRS+ P+    RQ+RFI RW+++LS+PR+THEIRS
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPESFDFRQERFIRRWIEALSDPRITHEIRS  469

Query  298  TWISYLTQADRSLGQKVASRLNIRPTM  218
             WISY +QAD++LGQK+ASRLN+RP++
Sbjct  470  IWISYWSQADKTLGQKLASRLNVRPSI  496



>gb|AAR97905.1| catalase [Solanum tuberosum]
Length=492

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WIS
Sbjct  410  ACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>sp|P55312.1|CATA2_SOLTU RecName: Full=Catalase isozyme 2 [Solanum tuberosum]
Length=492

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P
Sbjct  350  DTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WIS
Sbjct  410  ACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWIS  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  470  YLSQADKSCGQKVASRLTVKPTM  492



>emb|CAA85470.1| catalase [Solanum tuberosum]
Length=491

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHR+GPNYM LPVNA KC +HNN  DG MN  HRDEEVDY PS+FD  R AE++P P
Sbjct  349  DTQRHRIGPNYMQLPVNAPKCGHHNNHRDGAMNMTHRDEEVDYLPSRFDPCRPAEQYPIP  408

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              ++ GRR  CVI KENNFKQ G+RYRSW  DRQDR+I +WV+SLS+PRVTHEIRS WIS
Sbjct  409  ACVLNGRRTNCVIPKENNFKQAGERYRSWESDRQDRYITKWVESLSDPRVTHEIRSIWIS  468

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            YL+QAD+S GQKVASRL ++PTM
Sbjct  469  YLSQADKSCGQKVASRLTVKPTM  491



>gb|AFN81243.1| catalase 1 [Brassica rapa subsp. pekinensis]
Length=492

 Score =   219 bits (557),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = -2

Query  646  DTXRHRLGPNYMLLPVNATKCXYHNNSYDGYMNFVHRDEEVDYFPSKFDNTRNAERFPTP  467
            DT RHRLGPNY+ LPVNA KC +HNN ++G+MNF+HRDEEV+YFPS++D  R+AE++PTP
Sbjct  350  DTQRHRLGPNYLQLPVNAPKCAHHNNHHEGFMNFMHRDEEVNYFPSRYDPVRHAEKYPTP  409

Query  466  LRIVTGRRDKCVIEKENNFKQPGDRYRSWAPDRQDRFINRWVKSLSEPRVTHEIRSTWIS  287
              + +G+R++CVIEKENNFK+PG+RYRS+ P+RQ+RFI RW+++L +PR+THEIRS WI 
Sbjct  410  PAVCSGKRERCVIEKENNFKEPGERYRSFTPERQERFIRRWIEALFDPRITHEIRSIWIF  469

Query  286  YLTQADRSLGQKVASRLNIRPTM  218
            Y +QAD++ GQK+ASRLN+RP++
Sbjct  470  YWSQADKTFGQKLASRLNVRPSI  492



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 974366829000