BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037A19

Length=639
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004231042.1|  PREDICTED: uncharacterized protein LOC101266077  90.5    3e-18   Solanum lycopersicum
ref|XP_006359698.1|  PREDICTED: uncharacterized protein LOC102599645  89.7    5e-18   Solanum tuberosum [potatoes]
ref|XP_009797256.1|  PREDICTED: uncharacterized protein LOC104243716  88.2    2e-17   Nicotiana sylvestris
gb|AFP19452.1|  bZIP transcription factor family protein 1            86.3    9e-17   Camellia sinensis [black tea]
gb|AFP19453.1|  bZIP transcription factor family protein 2            85.9    1e-16   Camellia sinensis [black tea]
emb|CDP14558.1|  unnamed protein product                              84.3    4e-16   Coffea canephora [robusta coffee]
ref|XP_009631591.1|  PREDICTED: uncharacterized protein LOC104121329  83.6    7e-16   Nicotiana tomentosiformis
ref|XP_008447959.1|  PREDICTED: uncharacterized protein LOC103490288  83.2    9e-16   Cucumis melo [Oriental melon]
ref|XP_004144846.1|  PREDICTED: uncharacterized protein LOC101208161  83.2    1e-15   Cucumis sativus [cucumbers]
ref|XP_004164905.1|  PREDICTED: uncharacterized protein LOC101232700  82.8    1e-15   
ref|XP_002278836.1|  PREDICTED: uncharacterized protein LOC100243471  81.6    4e-15   Vitis vinifera
emb|CAN73631.1|  hypothetical protein VITISV_026643                   81.3    4e-15   Vitis vinifera
ref|XP_002534148.1|  DNA binding protein, putative                    80.1    1e-14   
ref|XP_011088608.1|  PREDICTED: uncharacterized protein LOC105169791  79.7    2e-14   Sesamum indicum [beniseed]
ref|XP_006422593.1|  hypothetical protein CICLE_v10028931mg           79.0    3e-14   
gb|KDO68071.1|  hypothetical protein CISIN_1g024365mg                 78.6    3e-14   Citrus sinensis [apfelsine]
ref|XP_006422601.1|  hypothetical protein CICLE_v10028931mg           79.0    3e-14   
ref|XP_010107666.1|  hypothetical protein L484_008383                 78.6    3e-14   
ref|XP_009626744.1|  PREDICTED: uncharacterized protein LOC104117398  78.6    4e-14   Nicotiana tomentosiformis
ref|XP_009791619.1|  PREDICTED: uncharacterized protein LOC104238836  77.4    9e-14   Nicotiana sylvestris
ref|XP_009787001.1|  PREDICTED: uncharacterized protein LOC104235...  75.9    3e-13   Nicotiana sylvestris
ref|XP_009786999.1|  PREDICTED: uncharacterized protein LOC104235...  75.9    3e-13   Nicotiana sylvestris
gb|KJB12146.1|  hypothetical protein B456_002G003000                  74.3    9e-13   Gossypium raimondii
gb|KJB12148.1|  hypothetical protein B456_002G003000                  74.3    1e-12   Gossypium raimondii
ref|XP_009355669.1|  PREDICTED: uncharacterized protein LOC103946638  72.8    4e-12   Pyrus x bretschneideri [bai li]
ref|XP_009376970.1|  PREDICTED: uncharacterized protein LOC103965622  72.4    5e-12   Pyrus x bretschneideri [bai li]
ref|XP_010265995.1|  PREDICTED: uncharacterized protein LOC104603629  72.0    6e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009376950.1|  PREDICTED: uncharacterized protein LOC103965600  72.0    7e-12   Pyrus x bretschneideri [bai li]
gb|EYU37954.1|  hypothetical protein MIMGU_mgv1a011243mg              70.5    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_008457698.1|  PREDICTED: uncharacterized protein LOC103497...  69.3    6e-11   Cucumis melo [Oriental melon]
ref|XP_008457697.1|  PREDICTED: uncharacterized protein LOC103497...  68.9    8e-11   
gb|KHG28517.1|  Protein FD -like protein                              68.2    1e-10   Gossypium arboreum [tree cotton]
ref|XP_010327411.1|  PREDICTED: uncharacterized protein LOC104649609  68.2    1e-10   Solanum lycopersicum
ref|XP_004505820.1|  PREDICTED: uncharacterized protein LOC101509009  68.2    2e-10   Cicer arietinum [garbanzo]
gb|KJB15817.1|  hypothetical protein B456_002G197800                  67.8    2e-10   Gossypium raimondii
gb|KDP29660.1|  hypothetical protein JCGZ_18822                       67.8    2e-10   Jatropha curcas
ref|XP_007041826.1|  Basic-leucine zipper transcription factor fa...  67.4    3e-10   
ref|XP_009624365.1|  PREDICTED: uncharacterized protein LOC104115438  67.4    3e-10   Nicotiana tomentosiformis
ref|XP_007201303.1|  hypothetical protein PRUPE_ppa009913mg           67.4    3e-10   Prunus persica
ref|XP_004147043.1|  PREDICTED: uncharacterized protein LOC101219501  67.4    3e-10   Cucumis sativus [cucumbers]
ref|XP_007041828.1|  Basic-leucine zipper transcription factor fa...  67.4    3e-10   
ref|XP_010266832.1|  PREDICTED: uncharacterized protein LOC104604256  66.6    5e-10   Nelumbo nucifera [Indian lotus]
ref|XP_008236021.1|  PREDICTED: uncharacterized protein LOC103334...  66.2    6e-10   Prunus mume [ume]
ref|XP_007041827.1|  Basic-leucine zipper transcription factor fa...  67.0    7e-10   
ref|XP_010028728.1|  PREDICTED: uncharacterized protein LOC104418944  66.2    7e-10   Eucalyptus grandis [rose gum]
ref|XP_008236016.1|  PREDICTED: uncharacterized protein LOC103334...  66.2    7e-10   Prunus mume [ume]
ref|XP_008377738.1|  PREDICTED: uncharacterized protein LOC103440807  65.9    1e-09   
ref|XP_010526894.1|  PREDICTED: uncharacterized protein LOC104804328  65.1    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_004289872.1|  PREDICTED: uncharacterized protein LOC101314521  65.1    2e-09   Fragaria vesca subsp. vesca
ref|XP_003607180.1|  hypothetical protein MTR_4g073100                64.3    4e-09   Medicago truncatula
gb|KHN25468.1|  hypothetical protein glysoja_010385                   63.2    8e-09   Glycine soja [wild soybean]
ref|XP_002313707.2|  hypothetical protein POPTR_0009s13730g           62.8    1e-08   
ref|XP_011046168.1|  PREDICTED: uncharacterized protein LOC105140851  62.8    1e-08   Populus euphratica
ref|XP_006591923.1|  PREDICTED: bZIP transcription factor bZIP122...  62.8    2e-08   
ref|NP_001235033.1|  bZIP transcription factor bZIP122                62.4    2e-08   Glycine max [soybeans]
ref|NP_001237296.1|  bZIP transcription factor bZIP121                62.0    2e-08   
ref|XP_006590380.1|  PREDICTED: bZIP transcription factor bZIP121...  62.0    2e-08   
ref|XP_011092972.1|  PREDICTED: uncharacterized protein LOC105173...  62.0    3e-08   Sesamum indicum [beniseed]
ref|XP_011092974.1|  PREDICTED: uncharacterized protein LOC105173...  62.0    3e-08   Sesamum indicum [beniseed]
gb|KHN39873.1|  hypothetical protein glysoja_020613                   61.6    3e-08   Glycine soja [wild soybean]
gb|ABP88241.1|  transcription factor bZIP120                          59.3    3e-08   Glycine max [soybeans]
ref|XP_006409392.1|  hypothetical protein EUTSA_v10022810mg           61.2    5e-08   Eutrema salsugineum [saltwater cress]
gb|KJB32659.1|  hypothetical protein B456_005G254200                  61.2    5e-08   Gossypium raimondii
ref|XP_006409393.1|  hypothetical protein EUTSA_v10022810mg           61.2    5e-08   
ref|XP_010530900.1|  PREDICTED: uncharacterized protein LOC104807371  60.1    1e-07   Tarenaya hassleriana [spider flower]
gb|ACI90291.1|  putative bZIP transcription factor                    60.1    2e-07   Picrorhiza kurrooa
ref|XP_007131714.1|  hypothetical protein PHAVU_011G035700g           59.3    2e-07   Phaseolus vulgaris [French bean]
ref|XP_010516149.1|  PREDICTED: uncharacterized protein LOC104791854  55.5    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010467405.1|  PREDICTED: uncharacterized protein LOC104747472  54.3    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_006298365.1|  hypothetical protein CARUB_v10014436mg           54.3    2e-05   Capsella rubella
ref|NP_179268.2|  transcription factor bZIP23                         53.9    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAD24610.1|  hypothetical protein                                  53.5    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010489260.1|  PREDICTED: uncharacterized protein LOC104766980  53.1    4e-05   Camelina sativa [gold-of-pleasure]
ref|XP_002305521.2|  bZIP transcription factor family protein         51.6    1e-04   
ref|XP_006384577.1|  hypothetical protein POPTR_0004s18120g           51.6    1e-04   
ref|XP_002884017.1|  DNA binding protein                              51.2    2e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010935120.1|  PREDICTED: uncharacterized protein LOC105055101  50.8    2e-04   Elaeis guineensis
ref|XP_011046689.1|  PREDICTED: uncharacterized protein LOC105141...  50.4    3e-04   Populus euphratica
ref|XP_011046685.1|  PREDICTED: uncharacterized protein LOC105141...  50.4    3e-04   Populus euphratica
ref|XP_011046688.1|  PREDICTED: uncharacterized protein LOC105141...  50.4    3e-04   Populus euphratica
ref|XP_006284366.1|  hypothetical protein CARUB_v10005538mg           50.1    4e-04   Capsella rubella
emb|CBI37871.3|  unnamed protein product                              48.1    4e-04   Vitis vinifera
ref|XP_010437531.1|  PREDICTED: uncharacterized protein LOC104721282  50.1    5e-04   
ref|XP_010432347.1|  PREDICTED: uncharacterized protein LOC104716633  49.7    5e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010447005.1|  PREDICTED: uncharacterized protein LOC104729711  49.7    6e-04   Camelina sativa [gold-of-pleasure]



>ref|XP_004231042.1| PREDICTED: uncharacterized protein LOC101266077 [Solanum lycopersicum]
Length=270

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 9/99 (9%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +K+ + YQ +VNP        GAYV+N CN+QC+D +YCL P     G +S+GT LN
Sbjct  165  QKPMKSGNTYQHIVNPNF-----PGAYVVNSCNLQCDDQVYCLHP--GAEGKNSDGTVLN  217

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPAN  337
             QG FNNC+FE+LQCLGNQT SG +E+PGC VGNS P +
Sbjct  218  GQG-FNNCEFETLQCLGNQT-SGLEEVPGCVVGNSTPTD  254



>ref|XP_006359698.1| PREDICTED: uncharacterized protein LOC102599645 [Solanum tuberosum]
Length=272

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 9/99 (9%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +K+ + YQ +VNP        GAYV+N CN+QC+D +YCL P     G SS+GT LN
Sbjct  165  QKPMKSGNTYQHIVNPNF-----PGAYVVNSCNLQCDDQVYCLHP--GAEGKSSDGTVLN  217

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPAN  337
             QG FNNC+FE+LQCLGNQT +G +E+PGC VGNS P +
Sbjct  218  GQG-FNNCEFETLQCLGNQT-TGLEEVPGCVVGNSTPTD  254



>ref|XP_009797256.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797257.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797258.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797259.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797260.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
Length=273

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 65/97 (67%), Gaps = 9/97 (9%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +K+ D YQ+LVNP        GAYVMNPCN+QC+D +YCL P     G S + T L+
Sbjct  167  QKPMKSGDVYQNLVNPNL-----PGAYVMNPCNLQCDDRVYCLHP--GSEGKSLDDTALD  219

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKP  343
             QG F+NC+FE+LQCLGNQTS   KE  GC +GN  P
Sbjct  220  GQG-FDNCEFETLQCLGNQTSE-LKEGSGCALGNGAP  254



>gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis]
Length=270

 Score = 86.3 bits (212),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 9/90 (10%)
 Frame = -1

Query  621  KNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGL  442
            KN D YQ+ VNP        GAYVM+PCN+QC+D +YCLQP       S E  ++N QG 
Sbjct  169  KNGDMYQNPVNPNLP-----GAYVMSPCNVQCDDQVYCLQP--GAESKSGEDASINGQG-  220

Query  441  FNNCDFESLQCLGNQTSSGFKELPGCGVGN  352
            F+ C+FE+LQCLGN+ ++G KELPGCG+GN
Sbjct  221  FSGCEFENLQCLGNE-NAGLKELPGCGLGN  249



>gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis]
Length=270

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 9/90 (10%)
 Frame = -1

Query  621  KNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGL  442
            KN D YQ+ VNP        GAYVM+PCN+QC+D +YCLQP       S E  ++N QG 
Sbjct  169  KNGDMYQNPVNPNLP-----GAYVMSPCNVQCDDQVYCLQP--GAESKSGEDASINGQG-  220

Query  441  FNNCDFESLQCLGNQTSSGFKELPGCGVGN  352
            F+ C+FE+LQCLGN+ ++G KELPGCG+GN
Sbjct  221  FSGCEFENLQCLGNE-NAGLKELPGCGLGN  249



>emb|CDP14558.1| unnamed protein product [Coffea canephora]
Length=273

 Score = 84.3 bits (207),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 65/100 (65%), Gaps = 11/100 (11%)
 Frame = -1

Query  639  YEKQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTT  460
            Y+K   K+ DAY    N  A       AYVMNPCN++C+D LYCL P     G S+E  T
Sbjct  166  YQKSANKSGDAYLANHNLPA-------AYVMNPCNVRCDDQLYCLHP--GSEGRSAEAAT  216

Query  459  LNNQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPA  340
            LN QG FN+C+FE+L C GNQ +SG KELPGCG+GN  P+
Sbjct  217  LNGQG-FNDCEFENLHCSGNQ-NSGLKELPGCGMGNGVPS  254



>ref|XP_009631591.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
 ref|XP_009631599.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
Length=273

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 66/97 (68%), Gaps = 9/97 (9%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +K+ D YQ+LVNP        GAYVMNPCN+QC+D +YCL P     G +S+GT L+
Sbjct  167  QKPMKSGDVYQNLVNPNL-----PGAYVMNPCNLQCDDRVYCLHP--GSEGKNSDGTALD  219

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKP  343
             QG F+NC+FE+LQCLGNQ S   KE  GC +G+  P
Sbjct  220  GQG-FDNCEFETLQCLGNQISE-LKEGSGCELGSGAP  254



>ref|XP_008447959.1| PREDICTED: uncharacterized protein LOC103490288 [Cucumis melo]
Length=270

 Score = 83.2 bits (204),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP        GAYVMNPCNMQC D +YCL P    G  SSEG  +N Q  F  C+
Sbjct  166  YQKAVNPNLSNPSMPGAYVMNPCNMQCEDQVYCLHP-GVDGSRSSEGAVINGQS-FGACE  223

Query  426  FESLQCLGNQTSSGFKELPGCGVGNSKPANV  334
            FE+LQCL N   SG KELPGCGVGN+   ++
Sbjct  224  FENLQCLANH-DSGSKELPGCGVGNAVSTDI  253



>ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus]
 gb|KGN43249.1| DNA binding protein [Cucumis sativus]
Length=270

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  +NP        GAYVMNPCNMQC D +YCL P    G  SSEG  +N Q  F  C+
Sbjct  166  YQKALNPNLSNPSMSGAYVMNPCNMQCEDQVYCLHP-GVDGSRSSEGAVINGQS-FGACE  223

Query  426  FESLQCLGNQTSSGFKELPGCGVGNSKPANV  334
            FE+LQCL N   SG KELPGCGVGN+   +V
Sbjct  224  FENLQCLANH-DSGSKELPGCGVGNAVSTDV  253



>ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus]
Length=262

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 57/91 (63%), Gaps = 3/91 (3%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  +NP        GAYVMNPCNMQC D +YCL P    G  SSEG  +N Q  F  C+
Sbjct  166  YQKALNPNLSNPSMSGAYVMNPCNMQCEDQVYCLHP-GVDGSRSSEGAVINGQS-FGACE  223

Query  426  FESLQCLGNQTSSGFKELPGCGVGNSKPANV  334
            FE+LQCL N   SG KELPGCGVGN+   +V
Sbjct  224  FENLQCLANH-DSGSKELPGCGVGNAVSTDV  253



>ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera]
Length=273

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 62/99 (63%), Gaps = 9/99 (9%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++  K+ D Y ++VN +       GA+VMNPCN+QC+D +YCL P       + E   LN
Sbjct  169  QKSAKSGDGYPNMVNQSL-----SGAFVMNPCNLQCDDQVYCLHP--GVEAKNGEAAGLN  221

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPAN  337
             QG FN CDFE++ C+GN  S+  KELPGCGVGN   AN
Sbjct  222  GQG-FNGCDFENIPCVGN-PSAALKELPGCGVGNGITAN  258



>emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera]
Length=264

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 47/99 (47%), Positives = 62/99 (63%), Gaps = 9/99 (9%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++  K+ D Y ++VN +       GA+VMNPCN+QC+D +YCL P       + E   LN
Sbjct  167  QKSAKSGDGYPNMVNQSL-----SGAFVMNPCNLQCDDQVYCLHP--GVEAKNGEAAGLN  219

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPAN  337
             QG FN CDFE++ C+GN  S+  KELPGCGVGN   AN
Sbjct  220  GQG-FNGCDFENIPCVGN-PSAALKELPGCGVGNGITAN  256



>ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28231.1| DNA binding protein, putative [Ricinus communis]
Length=284

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/70 (64%), Positives = 51/70 (73%), Gaps = 4/70 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAYVMNPCNMQCND +YCL P     G S +G  LN QG FN CDF++LQCL NQ S+  
Sbjct  182  GAYVMNPCNMQCNDQVYCLHP--GVDGRSDDGIALNGQG-FNGCDFDNLQCLANQNSAA-  237

Query  381  KELPGCGVGN  352
            KELP CG+GN
Sbjct  238  KELPSCGLGN  247



>ref|XP_011088608.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
 ref|XP_011088609.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
Length=287

 Score = 79.7 bits (195),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 58/95 (61%), Gaps = 15/95 (16%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++  K+ D YQ++ NP        G YVMNPCNMQ ND LYCL P           T LN
Sbjct  185  QKPTKSGDVYQNIANPNL-----PGTYVMNPCNMQRNDQLYCLHP--------GSETALN  231

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNS  349
             QGL  +C F++LQCLGNQ SS  KELP CG+GN+
Sbjct  232  GQGL-GDCGFDNLQCLGNQ-SSDQKELPDCGLGNA  264



>ref|XP_006422593.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422594.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422595.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422596.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422597.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422598.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422599.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422600.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006486739.1| PREDICTED: uncharacterized protein LOC102628933 isoform X1 [Citrus 
sinensis]
 ref|XP_006486740.1| PREDICTED: uncharacterized protein LOC102628933 isoform X2 [Citrus 
sinensis]
 ref|XP_006486741.1| PREDICTED: uncharacterized protein LOC102628933 isoform X3 [Citrus 
sinensis]
 gb|ESR35833.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35834.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35835.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35836.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35837.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35838.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35839.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35840.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|KDO68066.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68067.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68068.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68069.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68070.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=268

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 52/71 (73%), Gaps = 4/71 (6%)
 Frame = -1

Query  564  GGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
             GAYV+NPCNM+C+D +YCL P       S EG  LN QG F+ C+FE+LQC+GNQ SSG
Sbjct  179  AGAYVVNPCNMRCDDQVYCLHP--GMEDKSGEGIELNGQG-FSGCEFENLQCVGNQ-SSG  234

Query  384  FKELPGCGVGN  352
             +ELPGCG GN
Sbjct  235  VRELPGCGDGN  245



>gb|KDO68071.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=262

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = -1

Query  606  YQDLVNPTALXG-GGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNC  430
            YQ  VN   L      GAYV+NPCNM+C+D +YCL P       S EG  LN QG F+ C
Sbjct  164  YQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHP--GMEDKSGEGIELNGQG-FSGC  220

Query  429  DFESLQCLGNQTSSGFKELPGCGVGN  352
            +FE+LQC+GNQ SSG +ELPGCG GN
Sbjct  221  EFENLQCVGNQ-SSGVRELPGCGDGN  245



>ref|XP_006422601.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35841.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
Length=302

 Score = 79.0 bits (193),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 57/86 (66%), Gaps = 5/86 (6%)
 Frame = -1

Query  606  YQDLVNPTALXG-GGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNC  430
            YQ  VN   L      GAYV+NPCNM+C+D +YCL P       S EG  LN QG F+ C
Sbjct  164  YQKSVNNMNLPNPHSAGAYVVNPCNMRCDDQVYCLHP--GMEDKSGEGIELNGQG-FSGC  220

Query  429  DFESLQCLGNQTSSGFKELPGCGVGN  352
            +FE+LQC+GNQ SSG +ELPGCG GN
Sbjct  221  EFENLQCVGNQ-SSGVRELPGCGDGN  245



>ref|XP_010107666.1| hypothetical protein L484_008383 [Morus notabilis]
 gb|EXC16577.1| hypothetical protein L484_008383 [Morus notabilis]
Length=262

 Score = 78.6 bits (192),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 56/90 (62%), Gaps = 5/90 (6%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VN         GAYVMNPCNMQC+D +YCL P   G     +G  LN Q  F+ C+
Sbjct  167  YQKPVNQNLTNTTMPGAYVMNPCNMQCDDQVYCLHP---GMDGKCDGAVLNGQS-FSGCE  222

Query  426  FESLQCLGNQTSSGFKELPGCGVGNSKPAN  337
            FESLQCL NQ +SG KELPGC +GN+   N
Sbjct  223  FESLQCLANQ-NSGSKELPGCELGNASHVN  251



>ref|XP_009626744.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
 ref|XP_009626745.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
Length=276

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/98 (49%), Positives = 65/98 (66%), Gaps = 10/98 (10%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +K+ + YQ++VNP        G+YV+N CN+QC+D +YCL PG+E        T LN
Sbjct  168  QKPMKSGNVYQNVVNPNI-----PGSYVVNSCNLQCDDQVYCLHPGAEVKISDG--TVLN  220

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPA  340
             QG FNNC+FE+LQCLGNQT SG +E+P C V N  P 
Sbjct  221  GQG-FNNCEFETLQCLGNQT-SGMEEVP-CPVDNGTPT  255



>ref|XP_009791619.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
 ref|XP_009791625.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
Length=276

 Score = 77.4 bits (189),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 65/98 (66%), Gaps = 10/98 (10%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +K+ + YQ++VNP        G+YV+N CN+QC+D +YCL PG+E        T LN
Sbjct  168  QKPMKSGNVYQNVVNPNI-----PGSYVVNSCNLQCDDQVYCLHPGAEVKSSDG--TVLN  220

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPA  340
             QG FNNC+FE+LQCLGNQT SG +E+P C + N  P 
Sbjct  221  GQG-FNNCEFETLQCLGNQT-SGMEEVP-CPMDNGTPT  255



>ref|XP_009787001.1| PREDICTED: uncharacterized protein LOC104235029 isoform X2 [Nicotiana 
sylvestris]
Length=269

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 19/99 (19%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +++ D YQ+LVNP        GAYVMNPCN+QC+D +YCLQP             LN
Sbjct  168  QKPMESADVYQNLVNPNL-----PGAYVMNPCNLQCDDQVYCLQP---------GSDELN  213

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKE-LPGCGVGNSKPA  340
             Q L  +C FE+LQC GNQ   G KE +PGC +G+  P 
Sbjct  214  GQDLI-SCGFENLQCFGNQ---GLKEVVPGCALGDGTPT  248



>ref|XP_009786999.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009787000.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
Length=274

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 45/99 (45%), Positives = 59/99 (60%), Gaps = 19/99 (19%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +++ D YQ+LVNP        GAYVMNPCN+QC+D +YCLQP             LN
Sbjct  168  QKPMESADVYQNLVNPNL-----PGAYVMNPCNLQCDDQVYCLQP---------GSDELN  213

Query  453  NQGLFNNCDFESLQCLGNQTSSGFKE-LPGCGVGNSKPA  340
             Q L  +C FE+LQC GNQ   G KE +PGC +G+  P 
Sbjct  214  GQDLI-SCGFENLQCFGNQ---GLKEVVPGCALGDGTPT  248



>gb|KJB12146.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
 gb|KJB12147.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=265

 Score = 74.3 bits (181),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAY+MNPCN+QCND +YCLQP  E  G + E T L+  G FN C+F+ +QCL +Q +SG 
Sbjct  182  GAYLMNPCNIQCNDQMYCLQP--EVEGNTGEATALDGHG-FNGCEFDDIQCLASQ-NSGA  237

Query  381  KELPGCGVGNS  349
            KELPG GVG++
Sbjct  238  KELPGGGVGSA  248



>gb|KJB12148.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=269

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/71 (58%), Positives = 53/71 (75%), Gaps = 4/71 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAY+MNPCN+QCND +YCLQP  E  G + E T L+  G FN C+F+ +QCL +Q +SG 
Sbjct  182  GAYLMNPCNIQCNDQMYCLQP--EVEGNTGEATALDGHG-FNGCEFDDIQCLASQ-NSGA  237

Query  381  KELPGCGVGNS  349
            KELPG GVG++
Sbjct  238  KELPGGGVGSA  248



>ref|XP_009355669.1| PREDICTED: uncharacterized protein LOC103946638 [Pyrus x bretschneideri]
Length=263

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 50/85 (59%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP+       GA  MNPCN+QC+D LYCL P     G   +G  +N Q  FN C 
Sbjct  160  YQKSVNPSLPNPNMPGAIFMNPCNVQCDDQLYCLHP--GMDGKCGDGAVMNGQD-FNGCG  216

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FESLQC  NQ   G KELP CGVGN
Sbjct  217  FESLQCFANQ-DGGAKELPDCGVGN  240



>ref|XP_009376970.1| PREDICTED: uncharacterized protein LOC103965622 [Pyrus x bretschneideri]
Length=268

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP+        A+ MNPCN+QC+D LYC  P     G   +G  +N Q  FN CD
Sbjct  165  YQKSVNPSLPKPNMPNAFFMNPCNVQCDDQLYCPHP--GMDGKCGDGAVMNGQD-FNGCD  221

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FESLQCL NQ   G KELPGCG GN
Sbjct  222  FESLQCLVNQ-DGGAKELPGCGPGN  245



>ref|XP_010265995.1| PREDICTED: uncharacterized protein LOC104603629 [Nelumbo nucifera]
Length=280

 Score = 72.0 bits (175),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 60/91 (66%), Gaps = 9/91 (10%)
 Frame = -1

Query  621  KNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGL  442
            K+ D  Q+LV+ +       GAYVMNPC+++C+D +YCL P     G   E   LN+QGL
Sbjct  172  KSSDGVQNLVHASL-----PGAYVMNPCDLRCDDQVYCLHP--GVEGKVGESAVLNDQGL  224

Query  441  FNNCDFESLQCLGNQTSSGFKELPGCGVGNS  349
             + C+ ++LQC+GN ++ G KELPGCG GN+
Sbjct  225  -SACEMDNLQCMGN-SNLGLKELPGCGQGNT  253



>ref|XP_009376950.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
 ref|XP_009376951.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
Length=268

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP+        A+ MNPCN+QC+D LYC  P     G   +G  +N Q  FN CD
Sbjct  165  YQKSVNPSLPKPNMPNAFFMNPCNVQCDDQLYCPHP--GMDGKCGDGAMMNGQD-FNGCD  221

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FESLQCL NQ   G KELPGCG GN
Sbjct  222  FESLQCLVNQ-DGGAKELPGCGPGN  245



>gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Erythranthe guttata]
Length=288

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 50/91 (55%), Gaps = 15/91 (16%)
 Frame = -1

Query  624  VKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQG  445
             KN D YQ++ NP        G YVMNPCNMQ N+ LYCL P           T  + QG
Sbjct  188  AKNADIYQNIANPNIQ-----GTYVMNPCNMQRNEQLYCLHP--------GSETAFSGQG  234

Query  444  LFNNCDFESLQCLGNQTSSGFKELPGCGVGN  352
            L  +C F+ LQCLGNQ S+   ELP CG  N
Sbjct  235  L-GDCGFDDLQCLGNQNSNPM-ELPDCGFDN  263



>ref|XP_008457698.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
 ref|XP_008457699.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
Length=272

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 54/86 (63%), Gaps = 4/86 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ   N         G+Y++NPCN++CND  YCL+P     G S E T LN Q  F+ CD
Sbjct  166  YQKPANSNPPNQNVSGSYMINPCNVECNDQAYCLRP--GDDGKSGESTLLNGQS-FSACD  222

Query  426  FESLQCLGNQTSSGFKELPGCGVGNS  349
            FE+LQCL NQ ++G KE P CG+GN+
Sbjct  223  FENLQCLANQ-NTGAKEPPDCGLGNT  247



>ref|XP_008457697.1| PREDICTED: uncharacterized protein LOC103497333 isoform X1 [Cucumis 
melo]
Length=273

 Score = 68.9 bits (167),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 53/86 (62%), Gaps = 4/86 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ   N         G+Y++NPCN++CND  YCL+P   G    S  +TL N   F+ CD
Sbjct  166  YQKPANSNPPNQNVSGSYMINPCNVECNDQAYCLRP---GDDGKSGESTLLNGQSFSACD  222

Query  426  FESLQCLGNQTSSGFKELPGCGVGNS  349
            FE+LQCL NQ ++G KE P CG+GN+
Sbjct  223  FENLQCLANQ-NTGAKEPPDCGLGNT  247



>gb|KHG28517.1| Protein FD -like protein [Gossypium arboreum]
Length=261

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
            GAYVMNPCN+QCND +YCL P       + E   LN QG FN CDF+++QCL NQ S+G
Sbjct  180  GAYVMNPCNVQCNDQMYCLHP--GVEDKTGEAAALNGQG-FNGCDFDNIQCLANQNSTG  235



>ref|XP_010327411.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
 ref|XP_010327412.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
Length=262

 Score = 68.2 bits (165),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 51/91 (56%), Gaps = 23/91 (25%)
 Frame = -1

Query  612  DAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNN  433
            D YQ+L           G YVMNPCN+QC+D +YCLQP SE           N QGL N+
Sbjct  170  DVYQNL----------RGTYVMNPCNLQCDDQVYCLQPNSEES---------NGQGL-NS  209

Query  432  CDFESLQCLGNQTSSGFKELPGCGVGNSKPA  340
            C FE+LQC    +S G KE+PGC +G   P 
Sbjct  210  CGFETLQC---SSSQGLKEVPGCALGFGTPT  237



>ref|XP_004505820.1| PREDICTED: uncharacterized protein LOC101509009 [Cicer arietinum]
Length=269

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 51/71 (72%), Gaps = 4/71 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+YVMNPCN+QC+D +YCL+P     G  +EG + N +G F+ C+FESLQCL  Q + G 
Sbjct  181  GSYVMNPCNVQCDDRVYCLRP--GADGNIAEGVSPNGEG-FDGCEFESLQCLAGQ-NVGI  236

Query  381  KELPGCGVGNS  349
            K+L GCGVG +
Sbjct  237  KDLHGCGVGQT  247



>gb|KJB15817.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15818.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15819.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
Length=257

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/59 (58%), Positives = 41/59 (69%), Gaps = 3/59 (5%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
            GAYVMNPCN+QCND +YCL P       + E   LN QG FN CDF+++QCL NQ S+G
Sbjct  180  GAYVMNPCNVQCNDQMYCLHP--GLEDKTGEAAALNGQG-FNGCDFDNIQCLANQNSTG  235



>gb|KDP29660.1| hypothetical protein JCGZ_18822 [Jatropha curcas]
Length=284

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 52/70 (74%), Gaps = 3/70 (4%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgse-gggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
            GAYVMNPCNMQCN  +YCL P  +   G SSEG  LN QG ++ C+F++LQCL +Q ++G
Sbjct  182  GAYVMNPCNMQCNGQVYCLHPSMDGKSGESSEGIALNGQG-YSGCEFDNLQCLASQ-NTG  239

Query  384  FKELPGCGVG  355
             K+L GCG+G
Sbjct  240  VKDLSGCGLG  249



>ref|XP_007041826.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041829.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041830.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041831.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97657.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97660.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97661.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97662.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=266

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAYVMNPCN+QCND +YCL P     G + E   LN QG FN C+F++L CL NQ +SG 
Sbjct  179  GAYVMNPCNVQCNDQMYCLHP--GADGKTGEVAELNGQG-FNVCEFDNLPCLANQ-NSGE  234

Query  381  KELPGCGVGNS  349
            KEL   GVG++
Sbjct  235  KELSTYGVGSA  245



>ref|XP_009624365.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624366.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624367.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624368.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
Length=263

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 59/99 (60%), Gaps = 19/99 (19%)
 Frame = -1

Query  633  KQQVKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLN  454
            ++ +K+ + YQ+LVNP        GAYVMNPCN+QC+D +YCLQPGS           LN
Sbjct  162  QKPMKSGNIYQNLVNPNY-----PGAYVMNPCNLQCDDQVYCLQPGSG---------ELN  207

Query  453  NQGLFNNCDFESLQC-LGNQTSSGFKELPGCGVGNSKPA  340
             QGL N+C F++ QC LGNQ     KE+ GC  G   P 
Sbjct  208  GQGL-NSCGFQTRQCFLGNQEP---KEVTGCAWGYGTPT  242



>ref|XP_007201303.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
 gb|EMJ02502.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
Length=272

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP         AYVMNPCN+Q +D LYCL       G   +G  +N QG F+ CD
Sbjct  169  YQKSVNPNLPNPNIPSAYVMNPCNLQRDDQLYCLH--QGADGKCGDGAVMNGQG-FSGCD  225

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FE+LQCL NQ   G+KEL GCG+GN
Sbjct  226  FENLQCLVNQ-DGGYKELSGCGLGN  249



>ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus]
 ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus]
 gb|KGN61936.1| hypothetical protein Csa_2G270780 [Cucumis sativus]
Length=273

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/86 (48%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ   N         G+Y++NPCN++CND  YCL P     G S E   LN Q  F+ CD
Sbjct  166  YQKPTNSNPPNQNVSGSYMINPCNVECNDQAYCLHP--GDDGKSGESALLNGQS-FSACD  222

Query  426  FESLQCLGNQTSSGFKELPGCGVGNS  349
            FE+LQCL NQ ++G KE P CG+GN+
Sbjct  223  FENLQCLANQ-NTGAKEPPDCGLGNT  247



>ref|XP_007041828.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOX97659.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
Length=281

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAYVMNPCN+QCND +YCL P     G + E   LN QG FN C+F++L CL NQ +SG 
Sbjct  179  GAYVMNPCNVQCNDQMYCLHP--GADGKTGEVAELNGQG-FNVCEFDNLPCLANQ-NSGE  234

Query  381  KELPGCGVGNS  349
            KEL   GVG++
Sbjct  235  KELSTYGVGSA  245



>ref|XP_010266832.1| PREDICTED: uncharacterized protein LOC104604256 [Nelumbo nucifera]
Length=273

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 47/70 (67%), Gaps = 4/70 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAYVMNPC+++C+D +YCL P     G   E   L +QG FN C+  +L CLGN ++SG 
Sbjct  187  GAYVMNPCDLRCDDQVYCLHP--GVEGKGEESAGLTSQG-FNACEIGNLHCLGN-SNSGL  242

Query  381  KELPGCGVGN  352
            KELP CG GN
Sbjct  243  KELPSCGNGN  252



>ref|XP_008236021.1| PREDICTED: uncharacterized protein LOC103334826 isoform X2 [Prunus 
mume]
Length=265

 Score = 66.2 bits (160),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP         AYVMNPCN+Q +D LYCL       G   +G  +N QG F+ CD
Sbjct  169  YQKSVNPNLPNPNIPSAYVMNPCNLQRDDQLYCLH--QGADGKCGDGAVMNGQG-FSGCD  225

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FE+LQCL NQ   G+KEL GCG+G+
Sbjct  226  FENLQCLVNQ-DGGYKELSGCGLGD  249



>ref|XP_007041827.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOX97658.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
Length=310

 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/71 (56%), Positives = 49/71 (69%), Gaps = 4/71 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAYVMNPCN+QCND +YCL P     G + E   LN QG FN C+F++L CL NQ +SG 
Sbjct  179  GAYVMNPCNVQCNDQMYCLHP--GADGKTGEVAELNGQG-FNVCEFDNLPCLANQ-NSGE  234

Query  381  KELPGCGVGNS  349
            KEL   GVG++
Sbjct  235  KELSTYGVGSA  245



>ref|XP_010028728.1| PREDICTED: uncharacterized protein LOC104418944 [Eucalyptus grandis]
 gb|KCW55527.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
 gb|KCW55528.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
Length=269

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/74 (50%), Positives = 47/74 (64%), Gaps = 3/74 (4%)
 Frame = -1

Query  564  GGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
            G AYV+NPCNMQCND ++CL P     G S +GT+++ Q  +  C+FE+LQC  NQ   G
Sbjct  179  GSAYVVNPCNMQCNDQVHCLHP--RVEGRSGDGTSIDGQS-YGGCEFENLQCPANQNVLG  235

Query  384  FKELPGCGVGNSKP  343
             K LPGC   N  P
Sbjct  236  LKTLPGCENENIAP  249



>ref|XP_008236016.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236017.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236018.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236020.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
Length=272

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 52/85 (61%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP         AYVMNPCN+Q +D LYCL       G   +G  +N QG F+ CD
Sbjct  169  YQKSVNPNLPNPNIPSAYVMNPCNLQRDDQLYCLH--QGADGKCGDGAVMNGQG-FSGCD  225

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FE+LQCL NQ   G+KEL GCG+G+
Sbjct  226  FENLQCLVNQ-DGGYKELSGCGLGD  249



>ref|XP_008377738.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
 ref|XP_008377739.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
Length=263

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 43/85 (51%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP         A  MNPCN+QC+D LYCL+P     G   +G  +N Q  FN C 
Sbjct  160  YQKSVNPXLPNPNMPXAIFMNPCNVQCDDQLYCLRP--GMDGKCGDGAVMNGQD-FNGCG  216

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FESLQC  NQ   G KELP CG+GN
Sbjct  217  FESLQCFANQ-DGGAKELPDCGLGN  240



>ref|XP_010526894.1| PREDICTED: uncharacterized protein LOC104804328 [Tarenaya hassleriana]
Length=273

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 43/69 (62%), Gaps = 2/69 (3%)
 Frame = -1

Query  558  AYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGFK  379
            +Y+MNPCN+QC+D  YCL PG  GG           QG+ + CDF+ LQCL NQ S   K
Sbjct  184  SYMMNPCNLQCDDQAYCLHPGVGGGNSGEGAAMNGGQGI-SGCDFDQLQCLANQNSVS-K  241

Query  378  ELPGCGVGN  352
            ELP C VGN
Sbjct  242  ELPACSVGN  250



>ref|XP_004289872.1| PREDICTED: uncharacterized protein LOC101314521 [Fragaria vesca 
subsp. vesca]
Length=276

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 49/85 (58%), Gaps = 4/85 (5%)
 Frame = -1

Query  606  YQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCD  427
            YQ  VNP         AYVMNPCNMQC+D LYCLQ      G   +G  +N QG F+ C+
Sbjct  171  YQKPVNPGMQNPNYSSAYVMNPCNMQCDDQLYCLQ--RGNDGKRGDGVAMNGQG-FSGCE  227

Query  426  FESLQCLGNQTSSGFKELPGCGVGN  352
            FE+LQC  NQ   G   L GC +GN
Sbjct  228  FENLQCFTNQ-DGGSMGLSGCDLGN  251



>ref|XP_003607180.1| hypothetical protein MTR_4g073100 [Medicago truncatula]
 gb|ACJ84596.1| unknown [Medicago truncatula]
 gb|AES89377.1| BZIP transcription factor [Medicago truncatula]
Length=267

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 50/69 (72%), Gaps = 5/69 (7%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G++VMNPCN+QC+D  YCL+P    G +++E  + N +G F+ C+FESLQC+G Q + G 
Sbjct  180  GSHVMNPCNVQCDDRAYCLRP---DGKIAAEVASPNEEG-FDGCEFESLQCMGGQ-NLGL  234

Query  381  KELPGCGVG  355
            K+L GCG G
Sbjct  235  KDLRGCGGG  243



>gb|KHN25468.1| hypothetical protein glysoja_010385 [Glycine soja]
Length=247

 Score = 63.2 bits (152),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+YVMNPCN+QC+D +YC  P     G   E   LN +  F+ C+FE+LQCL +Q + G 
Sbjct  167  GSYVMNPCNLQCDDRVYCHHP----YGKIGESAALNGEE-FDGCEFENLQCLASQ-NLGL  220

Query  381  KELPGCGVGNSK  346
            K+L  CGVG ++
Sbjct  221  KDLRACGVGQAR  232



>ref|XP_002313707.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
 gb|EEE87662.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
Length=267

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+ VMNPCN++C+D +YC  P     G   EG  L  QG FN+C+FE+LQC+  Q +SG 
Sbjct  179  GSLVMNPCNIRCDDQVYCQHP--GLDGKGGEGEALKGQG-FNSCEFENLQCMEYQ-NSGM  234

Query  381  KELPGCGVGNSK  346
            ++LPGC +GN +
Sbjct  235  RDLPGCSIGNEE  246



>ref|XP_011046168.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046178.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046187.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046199.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
Length=267

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 49/72 (68%), Gaps = 4/72 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+ VMNPCN++C+D +YC  P     G   EG  L  QG FN+C+FE+LQC+  Q +SG 
Sbjct  179  GSLVMNPCNIRCDDQVYCQHP--GLDGKGGEGEALKGQG-FNSCEFENLQCMEYQ-NSGM  234

Query  381  KELPGCGVGNSK  346
            ++LPGC +GN +
Sbjct  235  RDLPGCSIGNEE  246



>ref|XP_006591923.1| PREDICTED: bZIP transcription factor bZIP122 isoform X1 [Glycine 
max]
 ref|XP_006591924.1| PREDICTED: bZIP transcription factor bZIP122 isoform X2 [Glycine 
max]
 ref|XP_006591925.1| PREDICTED: bZIP transcription factor bZIP122 isoform X3 [Glycine 
max]
 ref|XP_006591926.1| PREDICTED: bZIP transcription factor bZIP122 isoform X4 [Glycine 
max]
 ref|XP_006591927.1| PREDICTED: bZIP transcription factor bZIP122 isoform X5 [Glycine 
max]
 ref|XP_006591928.1| PREDICTED: bZIP transcription factor bZIP122 isoform X6 [Glycine 
max]
 ref|XP_006591929.1| PREDICTED: bZIP transcription factor bZIP122 isoform X7 [Glycine 
max]
Length=271

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+YVMNPCN+QC+D +YC  P     G   E   LN +  F+ C+FE+LQCL +Q + G 
Sbjct  185  GSYVMNPCNLQCDDRVYCHHP----YGKIGESAALNGEE-FDGCEFENLQCLASQ-NLGL  238

Query  381  KELPGCGVGNSK  346
            K+L  CGVG ++
Sbjct  239  KDLRACGVGQAR  250



>ref|NP_001235033.1| bZIP transcription factor bZIP122 [Glycine max]
 ref|XP_006591930.1| PREDICTED: bZIP transcription factor bZIP122 isoform X8 [Glycine 
max]
 ref|XP_006591931.1| PREDICTED: bZIP transcription factor bZIP122 isoform X9 [Glycine 
max]
 gb|ABI34664.1| bZIP transcription factor bZIP122 [Glycine max]
Length=265

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 47/72 (65%), Gaps = 6/72 (8%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+YVMNPCN+QC+D +YC  P     G   E   LN +  F+ C+FE+LQCL +Q + G 
Sbjct  185  GSYVMNPCNLQCDDRVYCHHP----YGKIGESAALNGEE-FDGCEFENLQCLASQ-NLGL  238

Query  381  KELPGCGVGNSK  346
            K+L  CGVG ++
Sbjct  239  KDLRACGVGQAR  250



>ref|NP_001237296.1| bZIP transcription factor bZIP121 [Glycine max]
 gb|ABI34680.1| bZIP transcription factor bZIP121 [Glycine max]
Length=270

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = -1

Query  564  GGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
             G+YVMNPCN+ C+D +YCL P           T   N   F+ C+FE+LQCL +Q + G
Sbjct  180  AGSYVMNPCNLPCDDRVYCLHP-----DGRIGETAALNGEEFDGCEFENLQCLASQ-NLG  233

Query  384  FKELPGCGVG  355
             K+L  CGVG
Sbjct  234  LKDLRACGVG  243



>ref|XP_006590380.1| PREDICTED: bZIP transcription factor bZIP121 isoform X1 [Glycine 
max]
 ref|XP_006590381.1| PREDICTED: bZIP transcription factor bZIP121 isoform X2 [Glycine 
max]
 ref|XP_006590382.1| PREDICTED: bZIP transcription factor bZIP121 isoform X3 [Glycine 
max]
Length=270

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = -1

Query  564  GGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
             G+YVMNPCN+ C+D +YCL P           T   N   F+ C+FE+LQCL +Q + G
Sbjct  180  AGSYVMNPCNLPCDDRVYCLHP-----DGRIGETAALNGEEFDGCEFENLQCLASQ-NLG  233

Query  384  FKELPGCGVG  355
             K+L  CGVG
Sbjct  234  LKDLRACGVG  243



>ref|XP_011092972.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
 ref|XP_011092973.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
Length=288

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 9/68 (13%)
 Frame = -1

Query  555  YVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGFKE  376
            YVMN CN+QCND LYCL        + SE    N QGL  +C+F++LQCLGNQ  SG  +
Sbjct  206  YVMNSCNVQCNDQLYCLH-------LGSETGAFNGQGL-GDCEFDNLQCLGNQI-SGSNQ  256

Query  375  LPGCGVGN  352
            LPGCG G+
Sbjct  257  LPGCGFGS  264



>ref|XP_011092974.1| PREDICTED: uncharacterized protein LOC105173033 isoform X2 [Sesamum 
indicum]
Length=287

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 45/68 (66%), Gaps = 9/68 (13%)
 Frame = -1

Query  555  YVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGFKE  376
            YVMN CN+QCND LYCL        + SE    N QGL  +C+F++LQCLGNQ  SG  +
Sbjct  206  YVMNSCNVQCNDQLYCLH-------LGSETGAFNGQGL-GDCEFDNLQCLGNQI-SGSNQ  256

Query  375  LPGCGVGN  352
            LPGCG G+
Sbjct  257  LPGCGFGS  264



>gb|KHN39873.1| hypothetical protein glysoja_020613 [Glycine soja]
Length=268

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 42/70 (60%), Gaps = 6/70 (9%)
 Frame = -1

Query  564  GGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
             G+YVMNPCN+ C+D +YCL P           T   N   F+ C+FE+LQCL +Q + G
Sbjct  180  AGSYVMNPCNLPCDDRVYCLHP-----DGRIGETAALNGEEFDGCEFENLQCLASQ-NLG  233

Query  384  FKELPGCGVG  355
             K+L  CGVG
Sbjct  234  LKDLRACGVG  243



>gb|ABP88241.1| transcription factor bZIP120, partial [Glycine max]
Length=118

 Score = 59.3 bits (142),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 45/69 (65%), Gaps = 6/69 (9%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+YVMNPCN+QC+D +YC  P     G   E   LN +  F+ C+FE+LQCL +Q + G 
Sbjct  50   GSYVMNPCNLQCDDRVYCHHP----YGKIGESAALNGEE-FDGCEFENLQCLASQ-NLGL  103

Query  381  KELPGCGVG  355
            K+L  CGVG
Sbjct  104  KDLRACGVG  112



>ref|XP_006409392.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50845.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=263

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 8/70 (11%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+MNPCNMQC+ D LYCLQ      G   EG ++N QGL N C+FE LQCLGNQ  +G 
Sbjct  178  SYMMNPCNMQCDVDNLYCLQ-----NGNIGEGASMNEQGL-NGCEFEQLQCLGNQNLAG-  230

Query  381  KELPGCGVGN  352
            KE+P C  GN
Sbjct  231  KEIPLCSNGN  240



>gb|KJB32659.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
 gb|KJB32660.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
Length=266

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 44/63 (70%), Gaps = 4/63 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GAYVMNPC++QCND +YCL P     G + E   L+ QG FN CDF+++QCL +  +SG 
Sbjct  179  GAYVMNPCHVQCNDQMYCLHP--GVEGRTGEDAALHGQG-FNGCDFDNVQCLAD-YNSGA  234

Query  381  KEL  373
            KEL
Sbjct  235  KEL  237



>ref|XP_006409393.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50846.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=265

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/70 (57%), Positives = 48/70 (69%), Gaps = 8/70 (11%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+MNPCNMQC+ D LYCLQ      G   EG ++N QGL N C+FE LQCLGNQ  +G 
Sbjct  178  SYMMNPCNMQCDVDNLYCLQ-----NGNIGEGASMNEQGL-NGCEFEQLQCLGNQNLAG-  230

Query  381  KELPGCGVGN  352
            KE+P C  GN
Sbjct  231  KEIPLCSNGN  240



>ref|XP_010530900.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530901.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530902.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530904.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530905.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530906.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530907.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530908.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530909.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530910.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530911.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530912.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
Length=270

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 45/69 (65%), Gaps = 4/69 (6%)
 Frame = -1

Query  558  AYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGFK  379
            +Y+MNPCN+QC+D  YCL P    GG   EG  +N QGL + CDF  LQCL NQ +SG  
Sbjct  183  SYMMNPCNLQCDDEAYCLHP--GVGGNGGEGAPMNGQGL-SGCDFGQLQCLANQ-NSGTD  238

Query  378  ELPGCGVGN  352
            +LP   VGN
Sbjct  239  DLPASSVGN  247



>gb|ACI90291.1| putative bZIP transcription factor [Picrorhiza kurrooa]
Length=289

 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 53/99 (54%), Gaps = 17/99 (17%)
 Frame = -1

Query  624  VKNRDAYQDLVNPTALXGGGGGAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQG  445
             K+RD YQ++VN           YVMNPCNMQ NDPLYCL      G  ++    L+ QG
Sbjct  188  TKDRDVYQNVVNTNF-----PATYVMNPCNMQRNDPLYCL----YSGSETALNGQLSGQG  238

Query  444  LFNNCDFESLQCLGNQTS-------SGFKELPGCGVGNS  349
            L  +C F++LQCLG+Q S       SG   + G   G S
Sbjct  239  L-GDCGFDNLQCLGDQNSIQKELLDSGLDRVNGVSSGTS  276



>ref|XP_007131714.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 ref|XP_007131715.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03708.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03709.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
Length=265

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 44/71 (62%), Gaps = 7/71 (10%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+YVMNPCNMQC+D +YC        G   E  +L+ +  F  C+FE+LQCL NQ + G 
Sbjct  181  GSYVMNPCNMQCDDRVYC-----GADGRIVENVSLDGEE-FGGCEFENLQCLANQ-NLGL  233

Query  381  KELPGCGVGNS  349
            KEL  CG G +
Sbjct  234  KELRACGAGQA  244



>ref|XP_010516149.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
 ref|XP_010516157.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
Length=256

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 48/71 (68%), Gaps = 10/71 (14%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+M+PCNMQC+ D +YCLQ        + EG ++N QGL N C+F+ LQCL NQ  +G 
Sbjct  171  SYMMHPCNMQCDVDNMYCLQ-----NENNGEGASMNEQGL-NGCEFDQLQCLANQNLAG-  223

Query  381  KELPGC--GVG  355
            KE+P C  GVG
Sbjct  224  KEIPLCSNGVG  234



>ref|XP_010467405.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
 ref|XP_010467406.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
Length=259

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 10/71 (14%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+M+PCNMQC+ D +YCLQ      G + EG ++N QGL N C+F+ LQCL NQ  +G 
Sbjct  174  SYMMHPCNMQCDVDNMYCLQ-----NGNNGEGASMNEQGL-NGCEFDQLQCLNNQNLAG-  226

Query  381  KELPGC--GVG  355
            KE+P C  GVG
Sbjct  227  KEIPLCSNGVG  237



>ref|XP_006298365.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 ref|XP_006298366.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31263.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31264.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
Length=258

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/71 (52%), Positives = 49/71 (69%), Gaps = 10/71 (14%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+M+PCNMQC+ D +YCLQ      G + EGT +N QGL N C+F+ L+CL NQ  +G 
Sbjct  173  SYMMHPCNMQCDVDNMYCLQ-----NGNNGEGTLMNEQGL-NGCEFDQLECLANQNLAG-  225

Query  381  KELPGC--GVG  355
            KE+P C  GVG
Sbjct  226  KEIPLCSNGVG  236



>ref|NP_179268.2| transcription factor bZIP23 [Arabidopsis thaliana]
 dbj|BAC42143.1| putative bzip transcription factor atbzip23 [Arabidopsis thaliana]
 gb|ABI93931.1| At2g16770 [Arabidopsis thaliana]
 gb|AEC06536.1| Basic-leucine zipper (bZIP) transcription factor family protein 
[Arabidopsis thaliana]
Length=249

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 8/69 (12%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+M+PCNMQC+ D LYCLQ      G + EG ++N QGL N C+F+ L+CL NQ  +G 
Sbjct  164  SYMMHPCNMQCDVDNLYCLQ-----NGNNGEGASMNEQGL-NGCEFDQLECLANQNLAG-  216

Query  381  KELPGCGVG  355
            KE+P C  G
Sbjct  217  KEIPVCSNG  225



>gb|AAD24610.1| hypothetical protein [Arabidopsis thaliana]
Length=255

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/69 (51%), Positives = 47/69 (68%), Gaps = 8/69 (12%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+M+PCNMQC+ D LYCLQ      G + EG ++N QGL N C+F+ L+CL NQ  +G 
Sbjct  164  SYMMHPCNMQCDVDNLYCLQ-----NGNNGEGASMNEQGL-NGCEFDQLECLANQNLAG-  216

Query  381  KELPGCGVG  355
            KE+P C  G
Sbjct  217  KEIPVCSNG  225



>ref|XP_010489260.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489261.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489262.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489264.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
Length=256

 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 10/71 (14%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+M+PCNMQC+ D +YCLQ      G + EG ++N QGL N C+F+ LQCL N+  +G 
Sbjct  171  SYMMHPCNMQCDVDNMYCLQ-----NGNNGEGASMNEQGL-NGCEFDQLQCLDNKNLAG-  223

Query  381  KELPGC--GVG  355
            KE+P C  GVG
Sbjct  224  KEIPLCSNGVG  234



>ref|XP_002305521.2| bZIP transcription factor family protein [Populus trichocarpa]
 gb|EEE86032.2| bZIP transcription factor family protein [Populus trichocarpa]
Length=265

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+ VMNPCN+QC+  +YC +P         EG  LN QG F++C+ E+LQC+  Q +SG 
Sbjct  180  GSLVMNPCNIQCDGQIYCQRP--VLDSKGGEGAPLNGQG-FSSCEIENLQCMEYQ-NSGM  235

Query  381  KELPGCGVGN  352
              L GC +GN
Sbjct  236  IGLSGCSLGN  245



>ref|XP_006384577.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
 gb|ERP62374.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
Length=266

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+ VMNPCN+QC+  +YC +P         EG  LN QG F++C+ E+LQC+  Q +SG 
Sbjct  180  GSLVMNPCNIQCDGQIYCQRP--VLDSKGGEGAPLNGQG-FSSCEIENLQCMEYQ-NSGM  235

Query  381  KELPGCGVGN  352
              L GC +GN
Sbjct  236  IGLSGCSLGN  245



>ref|XP_002884017.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60276.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 47/69 (68%), Gaps = 8/69 (12%)
 Frame = -1

Query  558  AYVMNPCNMQCN-DPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            +Y+M+PCNMQC+ D LYCLQ      G + EG ++N+QGL N C+F+ L+CL N   +G 
Sbjct  170  SYMMHPCNMQCDVDNLYCLQ-----NGNNGEGGSMNDQGL-NGCEFDQLECLANPNLAG-  222

Query  381  KELPGCGVG  355
            KE+P C  G
Sbjct  223  KEIPVCSNG  231



>ref|XP_010935120.1| PREDICTED: uncharacterized protein LOC105055101 [Elaeis guineensis]
Length=273

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 3/73 (4%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            GA+V+N C+ +C+D +YCL PG +G  +   G  +NNQ  F  C+  ++QC+G+ ++SG 
Sbjct  185  GAHVLNSCDFRCDDEVYCLHPGMQGKNMGERG-VVNNQE-FGVCEIGNIQCMGS-SASGS  241

Query  381  KELPGCGVGNSKP  343
             +  GCG GN  P
Sbjct  242  SDFVGCGRGNVMP  254



>ref|XP_011046689.1| PREDICTED: uncharacterized protein LOC105141220 isoform X3 [Populus 
euphratica]
Length=265

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+ VMNPCN+QC+  +YC +P         EG  +N QG F++C+ E+LQC+  Q +SG 
Sbjct  180  GSLVMNPCNIQCDGQIYCQRP--VLDSKGGEGAPVNGQG-FSSCELENLQCMEYQ-NSGM  235

Query  381  KELPGCGVGN  352
              L GC +GN
Sbjct  236  IGLSGCSLGN  245



>ref|XP_011046685.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046686.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046687.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
Length=266

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+ VMNPCN+QC+  +YC +P         EG  +N QG F++C+ E+LQC+  Q +SG 
Sbjct  180  GSLVMNPCNIQCDGQIYCQRP--VLDSKGGEGAPVNGQG-FSSCELENLQCMEYQ-NSGM  235

Query  381  KELPGCGVGN  352
              L GC +GN
Sbjct  236  IGLSGCSLGN  245



>ref|XP_011046688.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
 ref|XP_011046690.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
Length=265

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/70 (44%), Positives = 44/70 (63%), Gaps = 4/70 (6%)
 Frame = -1

Query  561  GAYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSGF  382
            G+ VMNPCN+QC+  +YC +P         EG  +N QG F++C+ E+LQC+  Q +SG 
Sbjct  180  GSLVMNPCNIQCDGQIYCQRP--VLDSKGGEGAPVNGQG-FSSCELENLQCMEYQ-NSGM  235

Query  381  KELPGCGVGN  352
              L GC +GN
Sbjct  236  IGLSGCSLGN  245



>ref|XP_006284366.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
 gb|EOA17264.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
Length=258

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = -1

Query  558  AYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQ  397
            +++MNPCN+QC+D +YC  P +  GG + E  ++N+QGL + CDF+ LQC+ NQ
Sbjct  177  SHMMNPCNVQCDDEVYC--PQNGFGGNTQEVASINDQGL-SGCDFDQLQCMANQ  227



>emb|CBI37871.3| unnamed protein product [Vitis vinifera]
Length=127

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 2/41 (5%)
 Frame = -1

Query  459  LNNQGLFNNCDFESLQCLGNQTSSGFKELPGCGVGNSKPAN  337
            LN QG FN CDFE++ C+GN  S+  KELPGCGVGN   AN
Sbjct  74   LNGQG-FNGCDFENIPCVGNP-SAALKELPGCGVGNGITAN  112



>ref|XP_010437531.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
 ref|XP_010437532.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
Length=264

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = -1

Query  558  AYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
            +++MNPCN+QC+D +YC  P +  GG + EG ++N+QGL   CDF+ LQCL NQ   G
Sbjct  183  SHMMNPCNVQCDDEVYC--PQNGFGGNTQEGASINDQGL-GGCDFDQLQCLANQNLGG  237



>ref|XP_010432347.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
 ref|XP_010432348.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
Length=264

 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 3/54 (6%)
 Frame = -1

Query  558  AYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQ  397
            +++MNPCN+QC+D +YC  P +  GG + EG ++N+QGL   CDF+ LQCL NQ
Sbjct  183  SHMMNPCNVQCDDEVYC--PQNGFGGNTQEGASINDQGL-GGCDFDQLQCLANQ  233



>ref|XP_010447005.1| PREDICTED: uncharacterized protein LOC104729711 [Camelina sativa]
Length=261

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 3/58 (5%)
 Frame = -1

Query  558  AYVMNPCNMQCNDPLYCLQPgsegggvsseGTTLNNQGLFNNCDFESLQCLGNQTSSG  385
            +++MNPCN+QC+D +YC  P +  GG + EG ++N+QGL   CDF+ LQCL NQ   G
Sbjct  180  SHMMNPCNVQCDDEVYC--PQNGFGGNNQEGASINDQGL-GGCDFDQLQCLANQNLGG  234



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 947301083750