BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF037A10

Length=666
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    235   5e-72   Nicotiana sylvestris
ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    230   5e-70   Nicotiana tomentosiformis
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    225   4e-68   Solanum tuberosum [potatoes]
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    225   5e-68   Solanum lycopersicum
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    224   8e-68   Sesamum indicum [beniseed]
emb|CDP04798.1|  unnamed protein product                                224   1e-67   Coffea canephora [robusta coffee]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               222   2e-67   Erythranthe guttata [common monkey flower]
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    221   4e-66   Sesamum indicum [beniseed]
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    216   2e-64   Nelumbo nucifera [Indian lotus]
ref|XP_002515557.1|  conserved hypothetical protein                     215   3e-64   
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         213   2e-63   Jatropha curcas
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    213   2e-63   Cucumis sativus [cucumbers]
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             211   3e-63   
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    213   4e-63   
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    212   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    212   5e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    211   6e-63   Camelina sativa [gold-of-pleasure]
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             211   6e-63   Eutrema salsugineum [saltwater cress]
dbj|BAH57107.1|  AT5G25460                                              205   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010106829.1|  hypothetical protein L484_006602                   206   1e-62   
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    210   2e-62   Nelumbo nucifera [Indian lotus]
ref|NP_196703.1|  uncharacterized protein                               210   3e-62   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63507.1|  unknown                                                 209   3e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             209   3e-62   Capsella rubella
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             209   4e-62   
dbj|BAD93856.1|  hypothetical protein                                   204   6e-62   Arabidopsis thaliana [mouse-ear cress]
gb|EPS73289.1|  hypothetical protein M569_01466                         208   8e-62   Genlisea aurea
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    208   8e-62   Citrus sinensis [apfelsine]
gb|AAN31807.1|  unknown protein                                         208   9e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    208   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    207   1e-61   Eucalyptus grandis [rose gum]
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    208   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    208   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    208   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             207   2e-61   Capsella rubella
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    207   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    207   2e-61   Tarenaya hassleriana [spider flower]
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    207   4e-61   Populus euphratica
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             207   4e-61   
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             207   4e-61   Prunus persica
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    207   5e-61   Vitis vinifera
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    206   5e-61   Fragaria vesca subsp. vesca
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    206   5e-61   Populus euphratica
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    206   5e-61   Brassica rapa
gb|KHG29602.1|  Allergen Act d 3                                        206   5e-61   Gossypium arboreum [tree cotton]
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    206   5e-61   Brassica rapa
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             206   6e-61   Citrus clementina [clementine]
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    206   6e-61   Prunus mume [ume]
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    206   6e-61   Arabis alpina [alpine rockcress]
emb|CDX85713.1|  BnaA02g01000D                                          206   7e-61   
emb|CDY19801.1|  BnaA09g04540D                                          206   7e-61   Brassica napus [oilseed rape]
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    206   8e-61   Populus euphratica
emb|CDX91217.1|  BnaC02g03800D                                          206   9e-61   
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             206   9e-61   Phaseolus vulgaris [French bean]
gb|KJB80694.1|  hypothetical protein B456_013G110800                    204   1e-60   Gossypium raimondii
gb|KHN06654.1|  hypothetical protein glysoja_037506                     206   1e-60   Glycine soja [wild soybean]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    206   1e-60   
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     205   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KJB80693.1|  hypothetical protein B456_013G110800                    205   2e-60   Gossypium raimondii
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    204   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    204   3e-60   Pyrus x bretschneideri [bai li]
gb|AAL06839.1|  AT5g25460/F18G18_200                                    204   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             203   3e-60   
emb|CAA22573.1|  putative protein                                       203   3e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             204   4e-60   Eutrema salsugineum [saltwater cress]
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             204   4e-60   
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    204   5e-60   Glycine max [soybeans]
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    203   5e-60   
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             204   5e-60   Arabidopsis lyrata subsp. lyrata
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    204   6e-60   Arabis alpina [alpine rockcress]
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             203   8e-60   Arabidopsis lyrata subsp. lyrata
gb|AAM61720.1|  unknown                                                 203   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          202   1e-59   
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    203   1e-59   
gb|ABK94923.1|  unknown                                                 203   1e-59   Populus trichocarpa [western balsam poplar]
dbj|BAE98407.1|  hypothetical protein                                   203   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567894.1|  uncharacterized protein                               202   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  203   1e-59   Theobroma cacao [chocolate]
emb|CAA06490.1|  hypothetical protein                                   197   2e-59   Cicer arietinum [garbanzo]
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    202   2e-59   Brassica rapa
emb|CDY54909.1|  BnaC02g48660D                                          202   2e-59   Brassica napus [oilseed rape]
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             203   2e-59   
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    202   2e-59   Brassica rapa
ref|XP_010110340.1|  GTP-binding nuclear protein                        207   3e-59   
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  203   3e-59   
gb|KJB07801.1|  hypothetical protein B456_001G045200                    202   3e-59   Gossypium raimondii
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    201   4e-59   Camelina sativa [gold-of-pleasure]
gb|KJB07802.1|  hypothetical protein B456_001G045200                    202   4e-59   Gossypium raimondii
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    201   4e-59   Camelina sativa [gold-of-pleasure]
emb|CDX80516.1|  BnaC07g29280D                                          199   5e-59   
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  200   5e-59   
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    201   6e-59   Solanum lycopersicum
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               201   6e-59   Gossypium arboreum [tree cotton]
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    201   7e-59   Solanum tuberosum [potatoes]
emb|CDX68849.1|  BnaC01g06040D                                          201   9e-59   
emb|CDX97108.1|  BnaC09g45170D                                          201   9e-59   
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    200   2e-58   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ84308.1|  unknown                                                 200   2e-58   Medicago truncatula
gb|AES58962.2|  plant/F18G18-200 protein                                200   2e-58   Medicago truncatula
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    200   2e-58   Nicotiana tomentosiformis
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    199   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    199   3e-58   Brassica rapa
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    198   1e-57   
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    197   2e-57   Nicotiana sylvestris
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    197   2e-57   Solanum lycopersicum
gb|AAB41813.1|  unknown protein                                         197   2e-57   Medicago sativa [alfalfa]
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    197   2e-57   Nicotiana sylvestris
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    196   3e-57   Cicer arietinum [garbanzo]
gb|KHN07099.1|  hypothetical protein glysoja_023282                     196   7e-57   Glycine soja [wild soybean]
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    196   7e-57   Elaeis guineensis
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    196   9e-57   
emb|CDX69757.1|  BnaA10g21060D                                          205   1e-56   
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    195   1e-56   Nicotiana tomentosiformis
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    195   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    194   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG21629.1|  GTPase Der                                              192   5e-56   Gossypium arboreum [tree cotton]
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    193   1e-55   
gb|KJB70569.1|  hypothetical protein B456_011G080100                    191   1e-55   Gossypium raimondii
gb|KHG06895.1|  Agmatine deiminase                                      192   2e-55   Gossypium arboreum [tree cotton]
gb|KJB70568.1|  hypothetical protein B456_011G080100                    192   2e-55   Gossypium raimondii
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    192   3e-55   Eucalyptus grandis [rose gum]
ref|XP_007150706.1|  hypothetical protein PHAVU_005G1745000g            189   5e-55   Phaseolus vulgaris [French bean]
gb|KHN07098.1|  hypothetical protein glysoja_023281                     189   9e-55   Glycine soja [wild soybean]
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    190   1e-54   Nicotiana tomentosiformis
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     190   1e-54   Glycine max [soybeans]
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    189   2e-54   Vitis vinifera
gb|AGV54541.1|  hypothetical protein                                    189   2e-54   Phaseolus vulgaris [French bean]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    189   3e-54   Glycine max [soybeans]
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    189   3e-54   
gb|KHN47787.1|  hypothetical protein glysoja_029205                     189   3e-54   Glycine soja [wild soybean]
gb|KDO83473.1|  hypothetical protein CISIN_1g017636mg                   186   3e-54   Citrus sinensis [apfelsine]
emb|CBI36253.3|  unnamed protein product                                189   4e-54   Vitis vinifera
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    189   4e-54   Elaeis guineensis
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    189   6e-54   
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    188   6e-54   Phoenix dactylifera
ref|XP_002517567.1|  conserved hypothetical protein                     188   7e-54   Ricinus communis
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    188   8e-54   Phoenix dactylifera
gb|AFK48067.1|  unknown                                                 182   1e-53   Lotus japonicus
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    187   1e-53   Sesamum indicum [beniseed]
gb|KHG10708.1|  Allergen Act d 3                                        187   1e-53   Gossypium arboreum [tree cotton]
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    187   2e-53   Solanum lycopersicum
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 187   2e-53   Theobroma cacao [chocolate]
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             186   3e-53   Citrus clementina [clementine]
gb|EMS52012.1|  hypothetical protein TRIUR3_31218                       185   3e-53   Triticum urartu
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    187   3e-53   Nicotiana sylvestris
gb|KJB68131.1|  hypothetical protein B456_010G227400                    186   4e-53   Gossypium raimondii
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    186   5e-53   Cicer arietinum [garbanzo]
dbj|BAK03126.1|  predicted protein                                      186   6e-53   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN44154.1|  hypothetical protein glysoja_031815                     185   9e-53   Glycine soja [wild soybean]
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    185   1e-52   Populus euphratica
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             184   2e-52   
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    185   2e-52   Populus euphratica
gb|EMT16005.1|  hypothetical protein F775_13621                         182   4e-52   
gb|KJB70570.1|  hypothetical protein B456_011G080200                    179   4e-52   Gossypium raimondii
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             184   4e-52   Populus trichocarpa [western balsam poplar]
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    183   5e-52   Malus domestica [apple tree]
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                183   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  183   6e-52   Medicago truncatula
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    182   1e-51   Eucalyptus grandis [rose gum]
ref|XP_007218161.1|  hypothetical protein PRUPE_ppa007461mg             179   2e-51   
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         182   2e-51   Jatropha curcas
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                182   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    181   3e-51   Tarenaya hassleriana [spider flower]
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    181   4e-51   Cucumis sativus [cucumbers]
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    181   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    180   6e-51   Fragaria vesca subsp. vesca
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             180   9e-51   Prunus persica
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    180   1e-50   Pyrus x bretschneideri [bai li]
dbj|BAD16016.1|  unknown protein                                        177   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    179   1e-50   Malus domestica [apple tree]
gb|ABF99456.1|  expressed protein                                       177   2e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    178   2e-50   Fragaria vesca subsp. vesca
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    179   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    178   4e-50   Nelumbo nucifera [Indian lotus]
gb|EEE56530.1|  hypothetical protein OsJ_05823                          178   4e-50   Oryza sativa Japonica Group [Japonica rice]
gb|KHG21630.1|  Adenosylhomocysteinase                                  178   5e-50   Gossypium arboreum [tree cotton]
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             178   5e-50   Prunus persica
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    178   6e-50   Fragaria vesca subsp. vesca
ref|NP_001046247.2|  Os02g0205200                                       177   6e-50   
gb|EEC72709.1|  hypothetical protein OsI_06304                          178   6e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          177   8e-50   
ref|XP_010088264.1|  hypothetical protein L484_005140                   177   9e-50   Morus notabilis
emb|CDO98109.1|  unnamed protein product                                176   1e-49   Coffea canephora [robusta coffee]
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    177   1e-49   Tarenaya hassleriana [spider flower]
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    177   1e-49   Prunus mume [ume]
gb|EAY92272.1|  hypothetical protein OsI_13995                          176   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    178   2e-49   Prunus mume [ume]
emb|CDO98108.1|  unnamed protein product                                176   3e-49   Coffea canephora [robusta coffee]
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    176   3e-49   Brachypodium distachyon [annual false brome]
ref|NP_001051644.1|  Os03g0807700                                       176   3e-49   
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    175   7e-49   Cucumis melo [Oriental melon]
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    175   7e-49   Prunus mume [ume]
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             175   9e-49   
ref|XP_007052493.1|  F17A17.37 protein                                  175   1e-48   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    174   1e-48   Eucalyptus grandis [rose gum]
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    174   2e-48   Setaria italica
gb|KJB19256.1|  hypothetical protein B456_003G091800                    172   2e-48   Gossypium raimondii
dbj|BAJ89665.1|  predicted protein                                      174   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT25156.1|  hypothetical protein F775_26385                         174   2e-48   
gb|KJB24990.1|  hypothetical protein B456_004G171200                    174   2e-48   Gossypium raimondii
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          174   2e-48   Sorghum bicolor [broomcorn]
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          173   3e-48   Amborella trichopoda
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    173   3e-48   Malus domestica [apple tree]
gb|KJB19257.1|  hypothetical protein B456_003G091800                    172   4e-48   Gossypium raimondii
gb|KJB24991.1|  hypothetical protein B456_004G171200                    174   4e-48   Gossypium raimondii
ref|XP_002517797.1|  conserved hypothetical protein                     172   5e-48   Ricinus communis
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    172   5e-48   Arabis alpina [alpine rockcress]
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    172   5e-48   Populus euphratica
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              173   6e-48   Gossypium arboreum [tree cotton]
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    172   8e-48   Eucalyptus grandis [rose gum]
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    172   1e-47   
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    172   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    171   1e-47   
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         171   2e-47   Jatropha curcas
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     172   2e-47   
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             171   2e-47   Eutrema salsugineum [saltwater cress]
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         171   2e-47   Jatropha curcas
gb|AFK44456.1|  unknown                                                 165   2e-47   Lotus japonicus
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    171   2e-47   Citrus sinensis [apfelsine]
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    171   2e-47   Setaria italica
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    170   4e-47   Populus euphratica
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             170   4e-47   Populus trichocarpa [western balsam poplar]
gb|KJB36028.1|  hypothetical protein B456_006G137000                    170   4e-47   Gossypium raimondii
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              171   5e-47   
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             170   5e-47   
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    170   5e-47   Populus euphratica
emb|CDP07813.1|  unnamed protein product                                170   5e-47   Coffea canephora [robusta coffee]
gb|KHG07966.1|  Imidazolonepropionase                                   170   5e-47   Gossypium arboreum [tree cotton]
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    170   6e-47   Populus euphratica
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    169   9e-47   Vitis vinifera
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          169   1e-46   
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             169   2e-46   Arabidopsis lyrata subsp. lyrata
gb|ACL52831.1|  unknown                                                 161   2e-46   Zea mays [maize]
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             168   2e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    168   2e-46   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    168   3e-46   
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               168   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    167   4e-46   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    167   5e-46   Glycine max [soybeans]
gb|KHN11697.1|  hypothetical protein glysoja_006150                     167   5e-46   Glycine soja [wild soybean]
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    170   1e-45   
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             166   1e-45   Citrus clementina [clementine]
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    166   1e-45   Pyrus x bretschneideri [bai li]
dbj|BAD52536.1|  unknown protein                                        164   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007028767.1|  F17A17.37 protein                                  166   1e-45   
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    166   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    166   2e-45   Brassica rapa
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    166   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             166   2e-45   Capsella rubella
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             166   2e-45   Capsella rubella
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             166   2e-45   Populus trichocarpa [western balsam poplar]
emb|CDY54317.1|  BnaC06g43150D                                          166   2e-45   Brassica napus [oilseed rape]
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    166   2e-45   Citrus sinensis [apfelsine]
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             166   3e-45   Phaseolus vulgaris [French bean]
gb|AGV54808.1|  hypothetical protein                                    166   3e-45   Phaseolus vulgaris [French bean]
ref|NP_001239749.1|  uncharacterized protein LOC100804119 precursor     165   3e-45   Glycine max [soybeans]
gb|KHN45084.1|  hypothetical protein glysoja_040000                     165   3e-45   Glycine soja [wild soybean]
ref|NP_001241275.1|  uncharacterized protein LOC100796094 precursor     165   3e-45   Glycine max [soybeans]
gb|AFK39148.1|  unknown                                                 165   4e-45   Lotus japonicus
ref|NP_001140426.1|  hypothetical protein precursor                     165   4e-45   Zea mays [maize]
ref|XP_003605795.1|  hypothetical protein MTR_4g039740                  165   5e-45   
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    165   5e-45   Pyrus x bretschneideri [bai li]
gb|EYU43005.1|  hypothetical protein MIMGU_mgv1a011073mg                163   5e-45   Erythranthe guttata [common monkey flower]
gb|AFK34548.1|  unknown                                                 165   5e-45   Lotus japonicus
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    165   5e-45   Tarenaya hassleriana [spider flower]
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    164   5e-45   Populus euphratica
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    165   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             164   6e-45   Populus trichocarpa [western balsam poplar]
gb|EAY74932.1|  hypothetical protein OsI_02826                          164   6e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    165   6e-45   Citrus sinensis [apfelsine]
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   164   6e-45   Citrus sinensis [apfelsine]
emb|CDY57694.1|  BnaA07g38340D                                          164   7e-45   Brassica napus [oilseed rape]
dbj|BAB21293.1|  unknown protein                                        164   9e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    165   9e-45   Brassica rapa
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    164   1e-44   Nelumbo nucifera [Indian lotus]
ref|NP_001043549.2|  Os01g0611000                                       164   2e-44   
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    163   2e-44   Populus euphratica
gb|KHN32410.1|  hypothetical protein glysoja_026304                     162   2e-44   Glycine soja [wild soybean]
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    163   2e-44   Nelumbo nucifera [Indian lotus]
emb|CDX79912.1|  BnaA05g02440D                                          165   2e-44   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    163   2e-44   
ref|XP_004506314.1|  PREDICTED: uncharacterized protein LOC101488216    163   2e-44   
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    163   2e-44   
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261             163   3e-44   
ref|XP_002532070.1|  conserved hypothetical protein                     162   3e-44   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    162   4e-44   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             162   5e-44   
gb|AES87990.2|  DUF642 family protein                                   162   7e-44   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    162   7e-44   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    162   8e-44   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  162   8e-44   
gb|AFK39561.1|  unknown                                                 161   9e-44   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    161   9e-44   
gb|KEH17090.1|  DUF642 family protein                                   161   1e-43   
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    161   1e-43   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    161   1e-43   
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    161   1e-43   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             161   1e-43   
dbj|BAK03627.1|  predicted protein                                      161   2e-43   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    161   2e-43   
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    160   2e-43   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    160   2e-43   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    160   2e-43   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    161   2e-43   
ref|NP_181712.1|  uncharacterized protein                               160   3e-43   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    160   3e-43   
emb|CDY48765.1|  BnaC04g02180D                                          162   3e-43   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             160   3e-43   
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    160   3e-43   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    159   5e-43   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    159   7e-43   
emb|CDY14785.1|  BnaC04g47820D                                          159   7e-43   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    159   9e-43   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     162   9e-43   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    159   1e-42   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             157   1e-42   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    158   1e-42   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    158   2e-42   
gb|EMT06486.1|  hypothetical protein F775_26416                         158   2e-42   
ref|NP_974254.1|  germination-related protein                           157   2e-42   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             158   2e-42   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             158   2e-42   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  157   3e-42   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    157   3e-42   
emb|CDX79913.1|  BnaA05g02430D                                          153   4e-42   
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          157   4e-42   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    157   5e-42   
ref|NP_566328.1|  germination-related protein                           157   5e-42   
ref|NP_181711.1|  uncharacterized protein                               157   5e-42   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                157   6e-42   
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    157   6e-42   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    156   8e-42   
ref|XP_010097437.1|  hypothetical protein L484_003208                   156   1e-41   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    156   1e-41   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             156   1e-41   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             156   1e-41   
emb|CDY48764.1|  BnaC04g02170D                                          151   1e-41   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                155   2e-41   
emb|CDY28002.1|  BnaC05g44040D                                          155   2e-41   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    155   2e-41   
emb|CDY22149.1|  BnaC01g39520D                                          155   2e-41   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    155   3e-41   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859    155   3e-41   
gb|EPS66311.1|  hypothetical protein M569_08463                         154   3e-41   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859            155   3e-41   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             155   4e-41   
ref|XP_010541767.1|  PREDICTED: uncharacterized protein LOC104815148    147   6e-41   
emb|CDY06908.1|  BnaA04g24070D                                          154   6e-41   
tpg|DAA58940.1|  TPA: hypothetical protein ZEAMMB73_364218              149   6e-41   
ref|XP_006411449.1|  hypothetical protein EUTSA_v10017674mg             154   6e-41   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    154   8e-41   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    154   8e-41   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                    154   9e-41   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    153   2e-40   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    153   2e-40   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    151   8e-40   
emb|CDP21696.1|  unnamed protein product                                151   8e-40   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    149   3e-39   
gb|ACG40327.1|  hypothetical protein                                    149   5e-39   
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         149   5e-39   
ref|NP_001145978.1|  hypothetical protein                               149   9e-39   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    148   9e-39   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    147   2e-38   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    147   2e-38   
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    145   4e-38   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    145   9e-38   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    145   1e-37   
ref|XP_006845338.1|  hypothetical protein AMTR_s00141p00087190          139   2e-37   
gb|EMT04285.1|  hypothetical protein F775_14657                         143   1e-36   
gb|EEC81716.1|  hypothetical protein OsI_25327                          143   1e-36   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    142   1e-36   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    142   2e-36   
emb|CAE01677.2|  OSJNBb0091E11.19                                       142   2e-36   
emb|CAH67378.1|  OSIGBa0159F11.2                                        142   2e-36   
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    141   4e-36   
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       141   5e-36   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              141   6e-36   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             141   6e-36   
gb|AGV54847.1|  hypothetical protein                                    141   7e-36   
emb|CAH67292.1|  OSIGBa0103O01.10                                       140   1e-35   
gb|EAY94676.1|  hypothetical protein OsI_16455                          140   1e-35   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    139   5e-35   
gb|AGV54803.1|  hypothetical protein                                    138   6e-35   
emb|CAE01676.2|  OSJNBb0091E11.17                                       137   8e-35   
ref|NP_001053189.1|  Os04g0494800                                       137   1e-34   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    137   2e-34   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    137   2e-34   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    137   2e-34   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    137   2e-34   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    137   2e-34   
gb|AFK48735.1|  unknown                                                 137   2e-34   
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  135   3e-34   
emb|CAH67377.1|  OSIGBa0159F11.1                                        136   4e-34   
ref|XP_002893594.1|  predicted protein                                  135   4e-34   
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          135   6e-34   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    135   7e-34   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     135   8e-34   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    135   9e-34   
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              135   1e-33   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    135   1e-33   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             135   1e-33   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    135   1e-33   
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    135   1e-33   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  134   1e-33   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    134   1e-33   
ref|NP_973938.1|  uncharacterized protein                               134   1e-33   
emb|CAD41548.2|  OSJNBb0091E11.18                                       134   2e-33   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    134   2e-33   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    134   2e-33   
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          134   2e-33   
ref|NP_001053190.1|  Os04g0494900                                       134   2e-33   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    134   2e-33   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    134   2e-33   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    134   2e-33   
gb|KHN33140.1|  La-related protein 7                                    137   2e-33   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    134   2e-33   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             134   2e-33   
ref|NP_564344.1|  uncharacterized protein                               134   3e-33   
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    133   3e-33   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    134   4e-33   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             133   5e-33   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             133   6e-33   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    133   7e-33   
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    132   7e-33   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    132   7e-33   
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    132   9e-33   
gb|KHG06200.1|  Periplasmic nitrate reductase                           132   1e-32   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             132   1e-32   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    132   1e-32   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    132   1e-32   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  132   1e-32   
gb|KJB69807.1|  hypothetical protein B456_011G043300                    132   1e-32   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    132   1e-32   
gb|KJB69808.1|  hypothetical protein B456_011G043300                    132   1e-32   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    132   2e-32   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    132   2e-32   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    132   2e-32   
ref|NP_001053188.1|  Os04g0494600                                       131   2e-32   
emb|CDX84311.1|  BnaC04g10730D                                          132   2e-32   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         132   2e-32   
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    132   2e-32   
gb|KHG28355.1|  putative metabolite transport                           131   2e-32   
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    131   2e-32   
gb|KJB57253.1|  hypothetical protein B456_009G155400                    131   2e-32   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                131   2e-32   
ref|NP_180998.1|  uncharacterized protein                               131   2e-32   
ref|XP_010110985.1|  hypothetical protein L484_021680                   132   2e-32   
gb|KJB57254.1|  hypothetical protein B456_009G155400                    132   2e-32   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             131   2e-32   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    131   2e-32   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             131   2e-32   
ref|XP_002519690.1|  conserved hypothetical protein                     131   2e-32   
gb|ACJ84883.1|  unknown                                                 127   3e-32   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    131   3e-32   
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          130   3e-32   
emb|CBI30867.3|  unnamed protein product                                130   4e-32   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    130   4e-32   
dbj|BAJ96954.1|  predicted protein                                      130   4e-32   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 131   4e-32   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             131   4e-32   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    132   4e-32   
gb|AFK49395.1|  unknown                                                 130   4e-32   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    130   4e-32   
emb|CDP19178.1|  unnamed protein product                                130   4e-32   
emb|CDY17255.1|  BnaA05g09330D                                          130   5e-32   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    130   6e-32   
dbj|BAD87481.1|  unknown protein                                        127   6e-32   
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    130   7e-32   
emb|CDX99870.1|  BnaC05g22920D                                          129   9e-32   
gb|EMT04284.1|  hypothetical protein F775_14656                         129   9e-32   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    130   1e-31   
gb|EPS66859.1|  hypothetical protein M569_07917                         129   1e-31   
emb|CDY26302.1|  BnaA09g26530D                                          129   1e-31   
gb|EMS63053.1|  hypothetical protein TRIUR3_01734                       128   2e-31   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    129   2e-31   
gb|ACN30906.1|  unknown                                                 129   2e-31   
gb|ACF86181.1|  unknown                                                 129   2e-31   
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    128   2e-31   
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          129   2e-31   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          129   2e-31   
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    129   3e-31   
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    128   3e-31   
ref|NP_001141282.1|  hypothetical protein precursor                     128   3e-31   
gb|KCW59326.1|  hypothetical protein EUGRSUZ_H02015                     123   3e-31   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              128   4e-31   
ref|NP_001143445.1|  uncharacterized protein LOC100276100               127   4e-31   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    128   5e-31   
gb|EEC70811.1|  hypothetical protein OsI_02272                          128   5e-31   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    127   6e-31   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          127   8e-31   
ref|NP_001044289.1|  Os01g0756600                                       127   9e-31   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    127   1e-30   
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    127   1e-30   
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                126   1e-30   
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    126   2e-30   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    125   2e-30   
ref|NP_001043243.2|  Os01g0531400                                       127   3e-30   
gb|ABK24630.1|  unknown                                                 125   3e-30   
gb|ACN40837.1|  unknown                                                 125   3e-30   
gb|EEE54731.1|  hypothetical protein OsJ_02078                          126   3e-30   



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   235 bits (599),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKY+D++HFSVP G+RA+ELVAGKESA+ Q+ART  GK  +L+F VGDASN
Sbjct  232  AWMVESLKAVKYLDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPYESKG+GGYK A LRF+ATANRTR+MF STYYHTRSDDFV
Sbjct  292  SCEGSMIVEAFAGMDTLKVPYESKGKGGYKRAVLRFKATANRTRIMFLSTYYHTRSDDFV  351

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPVVD VKL+SVRNP R L
Sbjct  352  SLCGPVVDDVKLLSVRNPRRFL  373



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKY+D++HFSVP G+RA+ELVAGKESA+ Q+ART  GK  +L+F VGDASN
Sbjct  232  AWMVESLKAVKYLDSDHFSVPQGKRAIELVAGKESAIAQVARTTIGKMYELSFKVGDASN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPYESKG+GG+K A LRF+A ANRTR+MF STYYHTRSDD+V
Sbjct  292  SCEGSMIVEAFAGRDTLKVPYESKGKGGFKRAVLRFKANANRTRIMFLSTYYHTRSDDYV  351

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPVVD VKL+SVRNP R L
Sbjct  352  SLCGPVVDDVKLLSVRNPRRFL  373



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKY+D++HFSVPHG+RA+ELVAGKESA+ Q+ART  GK   L+F VGDASN
Sbjct  230  AWMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDFV
Sbjct  290  ACEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFV  349

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPVVD V L+SVR  HRR+
Sbjct  350  SLCGPVVDDVTLLSVRT-HRRV  370



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 123/142 (87%), Gaps = 1/142 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKY+D++HFSVPHG+RA+ELVAGKESA+ Q+ART  GK   L+F VGDASN
Sbjct  230  AWMVESLKAVKYLDSDHFSVPHGKRAIELVAGKESAIAQVARTTIGKMYQLSFKVGDASN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPYES G+GGYK A LRF+ATA+RTR+MF STYYHTRSDDFV
Sbjct  290  ACEGSMIVEAFAGRDTLKVPYESMGKGGYKRAILRFKATASRTRIMFLSTYYHTRSDDFV  349

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPVVD V L+SVR  HRR+
Sbjct  350  SLCGPVVDDVTLLSVRT-HRRV  370



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 106/140 (76%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYIDA HFSVPHG+RA+ELV GKESA+ Q+ART+ GK  +LTF +GDASN
Sbjct  228  AWIVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIIGKTYELTFAIGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GGYK A LRF ATA RTR+MFFSTYYH RSDDF 
Sbjct  288  SCEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFAATAARTRIMFFSTYYHMRSDDFA  347

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPVVD VKL+SV  P R
Sbjct  348  SLCGPVVDDVKLLSVHKPRR  367



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/142 (73%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDA HFSVPH  RAVELVAGKESA+ Q+ART+ GK   LTFLVGDASN
Sbjct  230  GWMIESLKAVKYIDAAHFSVPHNSRAVELVAGKESAIAQVARTIIGKTYTLTFLVGDASN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EA+AG  T+K+PY S+G+GGYKPA L F AT NRTR+MFFSTYYHTRSDD  
Sbjct  290  SCEGSMIVEAYAGIVTVKIPYTSQGKGGYKPAVLHFVATTNRTRIMFFSTYYHTRSDDNA  349

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKL+SVRNP + +
Sbjct  350  SLCGPVIDDVKLLSVRNPRKLM  371



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYID  HFSVPHG RA+ELV GKESA+ Q+ART+AGK   LTF VGDASN
Sbjct  195  AWMVESLKAVKYIDRAHFSVPHGERAIELVGGKESAIAQVARTIAGKTYQLTFAVGDASN  254

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYES+G+GGYK A LRF A  NRTR+MF STYYH RSDD+ 
Sbjct  255  SCEGSMIVEAFAGRDTVKVPYESRGKGGYKRAVLRFVAPTNRTRIMFLSTYYHMRSDDYA  314

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPVVD VKL+SVRNP +
Sbjct  315  SLCGPVVDDVKLLSVRNPRK  334



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYIDA HFSVPHG+RA+ELV GKESA+ Q+ART+ GK   LTF VGDASN
Sbjct  264  AWMVESLKAVKYIDAAHFSVPHGQRAIELVGGKESAIAQVARTIVGKTYQLTFAVGDASN  323

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GGYK A LRF AT  RTR+MF ST+YH RSDD+ 
Sbjct  324  SCEGSMIVEAFAGRDTVKVPYESKGKGGYKRAVLRFVATTTRTRIMFLSTFYHMRSDDYA  383

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPVVD VKL+SVR P R
Sbjct  384  SLCGPVVDDVKLLSVRKPRR  403



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDAEHFSVP GRRAVELVAGKESA+ QIART+ GK   LTF VGDA+N
Sbjct  230  GWMIESLKAVKYIDAEHFSVPQGRRAVELVAGKESAIAQIARTIPGKVYTLTFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
            KCEGSMV+EAFA  +T+KVPYESKG GG+K A LRF A + RTR+MF ST+Y  RSDD  
Sbjct  290  KCEGSMVVEAFADRNTVKVPYESKGTGGFKRAVLRFTAVSTRTRIMFLSTFYTMRSDDMA  349

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPVVD VKL+S+RNP R
Sbjct  350  SLCGPVVDDVKLLSIRNPRR  369



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   215 bits (547),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID +HFSVP GRRA+ELVAGKESA+ Q+ARTV GK   L+F VGDASN
Sbjct  227  GWMVESLKAVKYIDVDHFSVPQGRRAIELVAGKESAIAQVARTVIGKTYTLSFAVGDASN  286

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  TLKVPYESKG+GG+K A LRF A ANRTR+MF+ST+Y  RSDDF 
Sbjct  287  SCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLRFVAVANRTRIMFYSTFYTMRSDDFS  346

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  347  SLCGPVLDDVKLLSVRKP  364



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/138 (73%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HFSVP  RRAVELVAGKESA+ Q+ARTV GK   L+F VGDASN
Sbjct  227  GWMIESLKAVKYIDSDHFSVPQARRAVELVAGKESAIAQVARTVVGKTYTLSFAVGDASN  286

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  TLKVPYESKG+GG+K A LRF A +NRTR+MF+ST+Y  RSDDF 
Sbjct  287  SCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLRFVAASNRTRIMFYSTFYTMRSDDFS  346

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  347  SLCGPVIDDVKLLSVRKP  364



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ QI RT+ GK   L+F+VGDASN
Sbjct  229  GWMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG +TLKVPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF 
Sbjct  289  SCEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V+L+SVRNP
Sbjct  349  SLCGPVLDKVRLLSVRNP  366



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   211 bits (538),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  203  AWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  262

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKVPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF 
Sbjct  263  ACQGSMIVEAFAGKDTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFS  322

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  323  SLCGPVIDDVKLLSVRKP  340



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ QI RT+ GK   L+F+VGDASN
Sbjct  283  GWMVESLKAVKYIDSDHFSVPSGKRAVELVAGKESAIAQIVRTIPGKTYILSFVVGDASN  342

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG +TLKVPY+SKG GG KPA L+F+A + RTR+MF ST+Y  RSDDF 
Sbjct  343  SCEGSMVVEAFAGKNTLKVPYQSKGNGGSKPAALKFKAESTRTRIMFLSTFYTMRSDDFS  402

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V+L+SVRNP
Sbjct  403  SLCGPVLDKVRLLSVRNP  420



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  230  AWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF 
Sbjct  290  ACQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  350  SLCGPVIDDVKLLSVRKP  367



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   212 bits (539),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  230  AWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF 
Sbjct  290  ACQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  350  SLCGPVIDDVKLLSVRKP  367



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  230  AWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF 
Sbjct  290  ACQGSMVVEAFAGRDTLKVPYESRGKGGFKRASMRFVAVSNRTRIMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  350  SLCGPVIDDVKLLSVRKP  367



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   211 bits (538),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  229  AWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKVPYES+G+GG+K A +RF A +NRTRVMF+ST+Y  RSDDF 
Sbjct  289  ACQGSMIVEAFAGKDTLKVPYESRGKGGFKRASMRFVAVSNRTRVMFYSTFYAMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  349  SLCGPVIDDVKLLSVRKP  366



>dbj|BAH57107.1| AT5G25460 [Arabidopsis thaliana]
Length=186

 Score =   205 bits (522),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK   L+F VGDA+N
Sbjct  49   GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANN  108

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF 
Sbjct  109  ACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFS  168

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  169  SLCGPVIDDVKLISVRKP  186



>ref|XP_010106829.1| hypothetical protein L484_006602 [Morus notabilis]
 gb|EXC12058.1| hypothetical protein L484_006602 [Morus notabilis]
Length=217

 Score =   206 bits (524),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ RT+ GK   LTF VGDASN 
Sbjct  80   WMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNS  139

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            CEGSM++EAFAG +T+KVPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDDF S
Sbjct  140  CEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSS  199

Query  301  LCGPVVDFVKLVSVRNP  251
            LCGPV+D +KL+SVR P
Sbjct  200  LCGPVLDDIKLLSVRKP  216



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDAEHFSVP G+RAVELVAGKESA+ Q+ARTV GK   L F VGDA+N
Sbjct  229  GWMIESLKAVKYIDAEHFSVPEGKRAVELVAGKESAIAQVARTVPGKAYALMFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
            +CEGSMV+EAFAG  T+KVPYESKG GG+K A L+F A + RTR+MF ST+Y  RSDD  
Sbjct  289  RCEGSMVVEAFAGRDTVKVPYESKGTGGFKRAVLKFTAASPRTRIMFLSTFYTMRSDDMA  348

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPVVD VKL+S+RNP R
Sbjct  349  SLCGPVVDDVKLLSIRNPRR  368



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  229  AWMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  349  SLCGPVIDDVKLLSARKP  366



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  229  AWMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  349  SLCGPVIDDVKLLSARKP  366



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   209 bits (533),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  230  AWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFSVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G+GG+K A +RF A +NRTR+MF+ST+Y  RSDDF 
Sbjct  290  ACQGSMVVEAFAGRDTLKVPYESRGKGGFKRATMRFVAVSNRTRIMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+ VR P
Sbjct  350  SLCGPVIDDVKLLGVRKP  367



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  229  AWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACQGSMIVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  349  SLCGPVIDDVKLLSARKP  366



>dbj|BAD93856.1| hypothetical protein [Arabidopsis thaliana]
Length=224

 Score =   204 bits (520),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK   L+F VGDA+N
Sbjct  87   GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANN  146

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF 
Sbjct  147  ACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFS  206

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  207  SLCGPVIDDVKLISVRKP  224



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   208 bits (529),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAV+YID+ HFSVP GRRA+ELV G+ESA+ Q+ART AGKF  LTF VGDASN
Sbjct  208  AWMVESLKAVRYIDSAHFSVPRGRRAIELVGGRESAIAQVARTAAGKFYRLTFAVGDASN  267

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG S++++PYES G+GGYK A L+F A ++RTR+MF STYYH RSDD+ 
Sbjct  268  SCEGSMVVEAFAGGSSVRIPYESSGRGGYKRAILQFVAASDRTRIMFTSTYYHMRSDDYA  327

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPVVD V+L+SVR   R
Sbjct  328  SLCGPVVDDVELLSVRETPR  347



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   208 bits (530),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HFSVP G+RA+ELVAGKESA+ QIART+ GK   LTF VGDA+N
Sbjct  228  GWMIESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF 
Sbjct  288  ACAGSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVRN  254
            SLCGPV+D VKL+SVRN
Sbjct  348  SLCGPVIDDVKLLSVRN  364



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   208 bits (530),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+A+TV GK   L+F VGDA+N
Sbjct  229  AWMVESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVAKTVVGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G+GG+K A LRF A + RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACQGSMVVEAFAGKDTLKVPYESRGKGGFKRASLRFVAVSTRTRVMFYSTFYSMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  349  SLCGPVIDDVKLLSARKP  366



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID EHFSVP GRRA+ELVAGKESA+ Q+A  +AGK   L+F VGDASN
Sbjct  227  GWMVESLKAVKYIDIEHFSVPQGRRAIELVAGKESAIAQVAPAIAGKTYVLSFAVGDASN  286

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKVPYES+G GG+K A +RF AT+NRTRVMF+ST+Y  RSDDF 
Sbjct  287  ACKGSMIVEAFAGRDTLKVPYESRGTGGFKRAAMRFVATSNRTRVMFYSTFYAMRSDDFS  346

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  347  SLCGPVIDDVKLLSVRKP  364



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 116/138 (84%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  188  GWMVESLKAVKYIDSGHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFAVGDASN  247

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T+KVPYESKG+GGYK A LRF+A + RTR+MF+ST+Y  RSDDF 
Sbjct  248  SCEGSMVVEAFAGKDTVKVPYESKGKGGYKRAVLRFKAVSVRTRIMFYSTFYTMRSDDFS  307

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  308  SLCGPVLDDVKLLSVRFP  325



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK   L+F VGDA+N
Sbjct  232  GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF 
Sbjct  292  ACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  352  SLCGPVIDDVKLISVRKP  369



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK   L+F VGDA+N
Sbjct  233  GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF 
Sbjct  293  ACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFS  352

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  353  SLCGPVIDDVKLISVRKP  370



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   208 bits (529),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK   L+F VGDA+N
Sbjct  232  GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+RVMF+ST+Y  RSDDF 
Sbjct  292  ACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRVMFYSTFYSMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  352  SLCGPVIDDVKLISVRKP  369



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ QI RTV GK   L+F VGDA+N
Sbjct  233  GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQIVRTVIGKTYVLSFAVGDANN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A +NR+R+MF+ST+Y  RSDDF 
Sbjct  293  ACKGSMVVEAFAGKETLKVPYESRGTGGFKRASIRFVAVSNRSRIMFYSTFYSMRSDDFS  352

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  353  SLCGPVIDDVKLISVRKP  370



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   207 bits (528),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 99/138 (72%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID EHFSVP GRRAVELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  228  GWMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESAIAQVARTVVGKTYVLSFAVGDANN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  T+KVPYES+G GG+K A LRF A ++RTR+MF+ST+Y  RSDDF 
Sbjct  288  ACKGSMIVEAFAGRDTIKVPYESRGTGGFKRAALRFVAASDRTRIMFYSTFYSMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+SVR P
Sbjct  348  SLCGPVVDDVKLLSVRKP  365



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   207 bits (527),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVK+ID++HFSVP GRRAVELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  226  GWIVESLKAVKFIDSDHFSVPQGRRAVELVAGKESAIAQVVRTIPGKTYVLSFAVGDASN  285

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MFFST+Y  RSDDF 
Sbjct  286  ACSGSMVVEAFAGKDTVKVPYESKGKGGFKRASLRFVAISNRTRIMFFSTFYSMRSDDFS  345

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  346  SLCGPVIDDVKLLSARKP  363



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID EHFSVP GRRAVELVAGKES + Q+ARTV GK   L+F VGDASN
Sbjct  229  GWMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESTIAQVARTVIGKTYTLSFAVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF 
Sbjct  289  SCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D +KL+S+R
Sbjct  349  SLCGPVIDDIKLLSLR  364



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   207 bits (528),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID EHFSVP GRRAVELVAGKESA+ Q+ARTV GK   L+F VGDASN
Sbjct  261  GWMVESLKAVKYIDVEHFSVPQGRRAVELVAGKESAIAQVARTVIGKTYTLSFAVGDASN  320

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A + RTR+MF+ST+Y  RSDDF 
Sbjct  321  SCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSTRTRIMFYSTFYTMRSDDFS  380

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D +KL+S+R
Sbjct  381  SLCGPVIDDIKLLSLR  396



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF 
Sbjct  288  SCEGSMIVEAFAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+S++NP +
Sbjct  348  SLCGPVLDDVKLLSLKNPRQ  367



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP  +RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  227  GWMVESLKAVKYIDSDHFSVPQEKRAVELVAGKESAIAQVARTIPGKTYALSFSVGDASN  286

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDD+ 
Sbjct  287  SCEGSMVVEAFAGRDTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDYA  346

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKL+S+R P R +
Sbjct  347  SLCGPVLDDVKLLSLRTPPRHI  368



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ QI RT+ GK   LTF VGDASN
Sbjct  229  GWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQIVRTIPGKTYMLTFSVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GG+K A L+FRA   RTR+MF ST+Y  RSDDF 
Sbjct  289  SCEGSMIVEAFAGRDTIKVPYESKGKGGFKRAVLKFRAVGPRTRIMFLSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+S+R P +
Sbjct  349  SLCGPVLDDVKLLSLRRPRQ  368



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   206 bits (523),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  206  GWMVESLKAVKFIDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASN  265

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF 
Sbjct  266  SCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFS  325

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPVVD VKL+S+R
Sbjct  326  SLCGPVVDDVKLLSLR  341



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  229  AWIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKV YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF 
Sbjct  289  ACKGSMIVEAFAGKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SV  P
Sbjct  349  SLCGPVIDDVKLLSVGKP  366



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYID+ H+ VP GRRAVELV GKESA+ QI RT+ GK   L+F VGDA+N
Sbjct  232  AWVVESLKAVKYIDSAHYFVPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+V+EAFAG +TLKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF 
Sbjct  292  SCAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+S+RNP
Sbjct  352  SLCGPVVDDVKLLSIRNP  369



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   206 bits (525),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  229  AWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACEGSMIVEAFAGRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFS  348

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D VKL+SV
Sbjct  349  SLCGPVIDDVKLLSV  363



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 115/137 (84%), Gaps = 0/137 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HFSVP G+RA+ELVAGKESA+ QIART+ GK   LTF VGDA+N
Sbjct  228  GWMIESLKAVKYIDSDHFSVPQGKRAIELVAGKESAIAQIARTIPGKTYTLTFTVGDANN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  T+KVPYESKG+GG+K A LRF A +NRTR+MF ST+Y  RSDDF 
Sbjct  288  ACAGSMVVEAFAGKGTIKVPYESKGKGGFKRAVLRFVAVSNRTRIMFLSTFYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVRN  254
            SLCGPV+D VKL+SVR+
Sbjct  348  SLCGPVIDDVKLLSVRS  364



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF 
Sbjct  288  SCEGSMIVEAFAGRDTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+S++NP +
Sbjct  348  SLCGPVLDDVKLLSLKNPRQ  367



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   206 bits (525),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  233  GWMVESLKAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF 
Sbjct  293  ACKGSMVVEAFAGKETLKVPYESRGTGGFKRASVRFVAVSTRTRVMFYSTFYAMRSDDFS  352

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  353  SLCGPVIDDVKLLSVRKP  370



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  229  AWMIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACEGSMIVEAFAGRDTLKVPYESKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFS  348

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D VKL+SV
Sbjct  349  SLCGPVIDDVKLLSV  363



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   206 bits (524),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  233  GWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTVIGKTYVLSFAVGDANN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF 
Sbjct  293  ACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFS  352

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  353  SLCGPVIDDVKLLSVRKP  370



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   206 bits (524),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKFIDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYSLSFAVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  TLKVPYESKG+GG+K A L+F A ++RTRVMF+ST+Y  RSDDF 
Sbjct  288  SCEGSMVVEAFAGKDTLKVPYESKGKGGFKRAVLKFVAVSSRTRVMFYSTFYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPVVD VKL+S+R
Sbjct  348  SLCGPVVDDVKLLSLR  363



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  229  AWMVESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPY+SKG+GG+K A LRF A + RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACEGSMIVEAFAGRDTLKVPYQSKGKGGFKRATLRFVAVSTRTRVMFYSTFYAMRSDDFS  348

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D VKL+SV
Sbjct  349  SLCGPVIDDVKLLSV  363



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVEL+AGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  229  GWMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A   RTRVMF ST+Y  RSDDF 
Sbjct  289  YCEGSMIVEAFAGKDTIKVPYESKGKGGFKRAALKFVAVGPRTRVMFLSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKLVS+R P
Sbjct  349  SLCGPVVDDVKLVSLRKP  366



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   204 bits (520),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYID+ H+ +P GRRAVELV GKESA+ QI RT+ GK   L+F VGDA+N
Sbjct  188  AWVVESLKAVKYIDSAHYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANN  247

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+V+EAFAG +TLKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF 
Sbjct  248  SCAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFS  307

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+S+RNP
Sbjct  308  SLCGPVVDDVKLLSIRNP  325



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVEL+AGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  229  GWMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF 
Sbjct  289  SCEGSMIVEAFAGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKLVS+R P
Sbjct  349  SLCGPVIDDVKLVSLRKP  366



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVEL+AGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  229  GWMVESLKAVKYIDSDHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG GG+K A L+F A   RTRVMF ST+Y  RSDDF 
Sbjct  289  SCEGSMIVEAFAGKDTIKVPYESKGNGGFKRAALKFVAVTPRTRVMFLSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKLVS+R P
Sbjct  349  SLCGPVIDDVKLVSLRKP  366



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   205 bits (522),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK   L+F VGDA+N
Sbjct  232  GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF 
Sbjct  292  ACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRIMFYSTFYAMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  352  SLCGPVIDDVKLISVRKP  369



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYID+ H+ +P GRRAVELV GKESA+ QI RT+ GK   L+F VGDA+N
Sbjct  232  AWVVESLKAVKYIDSAHYFMPQGRRAVELVGGKESAIAQITRTIVGKTYRLSFSVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+V+EAFAG +TLKVPYESKG GG+K A LRF A +NRTR+MF ST+Y  RSDDF 
Sbjct  292  SCAGSLVVEAFAGKATLKVPYESKGTGGFKRAALRFVAVSNRTRIMFLSTFYTMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+S+RNP
Sbjct  352  SLCGPVVDDVKLLSIRNP  369



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  232  GWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFA  +T+KVPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF 
Sbjct  292  SCEGSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+S+R P
Sbjct  352  SLCGPVVDDVKLLSLRKP  369



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFA  +T+KVPYESKG+GGYK A L+F A + RTRVMF STYY  RSDDF 
Sbjct  288  SCEGSMIVEAFADKNTVKVPYESKGKGGYKRAVLKFVAASTRTRVMFLSTYYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+S+R P
Sbjct  348  SLCGPVVDDVKLLSLRKP  365



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK   L+F VGDA+N
Sbjct  232  GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYESKG GG+K A +RF A   R+R+MF+ST+Y  RSDDF 
Sbjct  292  ACKGSMVVEAFAGKDTLKVPYESKGTGGFKRASIRFVAVLTRSRIMFYSTFYAMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  352  SLCGPVIDDVKLISVRKP  369



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   203 bits (517),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  188  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASN  247

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R DDF 
Sbjct  248  ACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSARTRVMFYSTFYAMREDDFS  307

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  308  SLCGPVIDDVKLLSARRP  325



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  188  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASN  247

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF 
Sbjct  248  ACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFS  307

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  308  SLCGPVIDDVKLLSARRP  325



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ARTV GK   L+F VGDA+N
Sbjct  230  GWMVESLKAVKYVDTEHFSVPQGRRAIELVAGKESAIAQVARTVVGKTYVLSFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF 
Sbjct  290  ACKGSMVVEAFAGKDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  350  SLCGPVIDDVKLLSVR  365



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   204 bits (518),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  217  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASN  276

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF 
Sbjct  277  ACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAASGRTRVMFYSTFYAMRNDDFS  336

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  337  SLCGPVIDDVKLLSARRP  354



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   204 bits (519),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+ HFSVP G+RAVEL+AGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  229  GWMVESLKAVKYIDSGHFSVPQGKRAVELIAGKESAIAQVARTIPGKTYVLSFSVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GG+K A L+F A   RTR+MF ST+Y  RSDDF 
Sbjct  289  SCEGSMIVEAFAGKDTIKVPYESKGKGGFKRAALKFVAVTPRTRIMFLSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKLVS+R P
Sbjct  349  SLCGPVIDDVKLVSLRKP  366



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   203 bits (517),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  208  GWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASN  267

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+++EAFAG +T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF 
Sbjct  268  SCEGSLIVEAFAGKNTVKVPYESKGKGGFKRAVLKFVAVSTRTRVMFLSTYYTMRSDDFS  327

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S+R P
Sbjct  328  SLCGPVLDDVKLLSLRKP  345



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   204 bits (518),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK   L+F VGDA+N
Sbjct  232  GWMVESLKAVKYVDIEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYVLSFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A ++R+R+MF+ST+Y  RSDDF 
Sbjct  292  ACKGSMVVEAFAGKETLKVPYESQGTGGFKRASIRFVAVSSRSRIMFYSTFYAMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  352  SLCGPVIDDVKLISVRKP  369



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   204 bits (518),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKA+KY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  230  AWMIESLKAIKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKTYVLSFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  TLKVPY+S G+GG+K A LRF A + RTR+MF+ST+Y  RSDDF 
Sbjct  290  ACEGSMIVEAFAGRDTLKVPYKSLGKGGFKRASLRFIAVSTRTRIMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL++ R P
Sbjct  350  SLCGPVIDDVKLLTARKP  367



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF 
Sbjct  288  ACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSDRTRVMFYSTFYAMRNDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  348  SLCGPVIDDVKLLSARRP  365



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   203 bits (517),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFSVP GRRA+ELVAGKESA+ Q+ RTV GK   L+F VGDA+N
Sbjct  232  GWMVESLKAVKYVDVEHFSVPQGRRAIELVAGKESAIAQVVRTVIGKTYVLSFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+E+FAG  TLKVPYESKG GG+K A +RF A + R+R+MF+ST+Y  RSDDF 
Sbjct  292  ACKGSMVVESFAGKDTLKVPYESKGTGGFKRASIRFVAVSTRSRMMFYSTFYAMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  352  SLCGPVIDDVKLISVRKP  369



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+ HFSVP G+RAVELVAGKESA+ Q+ART+ GK   LTF VGDASN
Sbjct  188  GWMVESLKAVKYIDSNHFSVPEGKRAVELVAGKESAIAQVARTIPGKLYALTFAVGDASN  247

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  TLKVPYESKG GG+K A LRF A + RTRV+F ST+Y  RSDDF 
Sbjct  248  ACTGSMVVEAFAGRDTLKVPYESKGTGGFKRAVLRFTAVSERTRVVFLSTFYSMRSDDFS  307

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+SV    R
Sbjct  308  SLCGPVIDDVKLLSVHGAPR  327



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPEGKRAVELVAGKESAIAQVVRTIPGKTYVLSFSVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFA  +T+KVPYESKG+GG+K A L+F A + RTRVMF STYY  RSDDF 
Sbjct  288  SCEGSMIVEAFADKNTVKVPYESKGKGGFKRAVLKFVAASTRTRVMFLSTYYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+S+R P
Sbjct  348  SLCGPVVDDVKLLSLRKP  365



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  T+KVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF 
Sbjct  288  SCQGSMVVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFS  347

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPVVD VKL+S+R
Sbjct  348  SLCGPVVDDVKLLSLR  363



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF 
Sbjct  288  ACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  348  SLCGPVIDDVKLLSARRP  365



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFSVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG+K + LRF A ++RTRVMF+ST+Y  R+DDF 
Sbjct  288  ACAGSMIVEAFAGKDTIKVPYESKGKGGFKRSSLRFVAVSSRTRVMFYSTFYAMRNDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  348  SLCGPVIDDVKLLSARRP  365



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   203 bits (516),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++H+ VP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  238  GWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANN  297

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  TLKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF 
Sbjct  298  SCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFS  357

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+SVR P
Sbjct  358  SLCGPVVDDVKLLSVRKP  375



>emb|CAA06490.1| hypothetical protein [Cicer arietinum]
Length=180

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D+ HFSVP G RA+ELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  43   GWMVESLKAVKYLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  102

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  
Sbjct  103  SCEGSMIVEAFAGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLS  162

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S+R P
Sbjct  163  SLCGPVIDDVKLLSLRKP  180



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 113/136 (83%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  230  GWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF 
Sbjct  290  ACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  350  SLCGPVIDDVKLLSVR  365



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  203  GWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  262

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF 
Sbjct  263  ACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFS  322

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S R
Sbjct  323  SLCGPVIDDVKLISAR  338



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVK+ID EHFSVP GRRA+ELVAGKESA+ Q+ RT+ GK   L+F VGDASN
Sbjct  278  GWMVESLKAVKFIDVEHFSVPQGRRAIELVAGKESAIAQVVRTIIGKTYTLSFAVGDASN  337

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T+KVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  RSDDF 
Sbjct  338  SCEGSMVVEAFAGKDTVKVPYESKGKGGFKRAVLKFVAASSRTRIMFYSTFYTMRSDDFS  397

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPVVD VKL+S+R
Sbjct  398  SLCGPVVDDVKLLSLR  413



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   202 bits (514),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFS+P GRRA+ELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  230  GWMVESLKAVKYVDTEHFSIPQGRRAIELVAGKESAIAQVARTIIGKTYVLSFAVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RTRVMF+ST+Y  RSDDF 
Sbjct  290  ACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTRVMFYSTFYAMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S R
Sbjct  350  SLCGPVIDDVKLISAR  365



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   207 bits (526),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 116/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ RT+ GK   LTF VGDASN 
Sbjct  227  WMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESAIAQVVRTIVGKTYRLTFSVGDASNS  286

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            CEGSM++EAFAG +T+KVPYESKG+GG+K   L F AT  RTR+MF ST+Y  RSDDF S
Sbjct  287  CEGSMIVEAFAGRATVKVPYESKGKGGFKRGVLTFVATETRTRIMFLSTFYSMRSDDFSS  346

Query  301  LCGPVVDFVKLVSVRNPHR  245
            LCGPV+D +KL+SVR P++
Sbjct  347  LCGPVLDDIKLLSVRKPNQ  365



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   203 bits (516),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++H+ VP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  275  GWMVESLKAVKYIDSDHYFVPQGRRAVELVAGKESAIAQVARTIIGKTYTLSFSVGDANN  334

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  TLKVPYESKG GG+K A L F+A + RTR+MF ST+Y  RSDDF 
Sbjct  335  SCAGSMVVEAFAGKDTLKVPYESKGTGGFKRAVLTFKAVSTRTRIMFLSTFYTMRSDDFS  394

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD VKL+SVR P
Sbjct  395  SLCGPVVDDVKLLSVRKP  412



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   202 bits (513),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYID+ H+ VP GRRAVELVAGKESA+ QI RT+ GK   L+F VGDA+N
Sbjct  232  AWIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+V+EAFAG  TLKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF 
Sbjct  292  SCVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFS  351

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S++
Sbjct  352  SLCGPVLDDVKLLSIQ  367



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYLDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG+K A LRF A + RTRVMF+ST+Y  R+DDF 
Sbjct  288  ACAGSMIVEAFAGKDTIKVPYESKGKGGFKRASLRFVAVSVRTRVMFYSTFYAMRNDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  348  SLCGPVIDDVKLLSARRP  365



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   202 bits (513),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYID+ H+ VP GRRAVELVAGKESA+ QI RT+ GK   L+F VGDA+N
Sbjct  237  AWIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANN  296

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+V+EAFAG  TLKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF 
Sbjct  297  SCVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFS  356

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S++
Sbjct  357  SLCGPVLDDVKLLSIQ  372



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 113/138 (82%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT+ GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTIPGKTYVLSFAVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVPYESKG+GG++ A LRF A + RTRVMF+ST+Y  R+DDF 
Sbjct  288  ACAGSMIVEAFAGKDTIKVPYESKGKGGFRRASLRFVAVSVRTRVMFYSTFYAMRNDDFS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S R P
Sbjct  348  SLCGPVIDDVKLLSARRP  365



>emb|CDX80516.1| BnaC07g29280D [Brassica napus]
Length=306

 Score =   199 bits (507),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/136 (68%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D EHFS+P GRRA+ELV GKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  169  GWMVESLKAVKYVDTEHFSIPQGRRAIELVVGKESAIAQVARTIIGKTYVLSFAVGDANN  228

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSMV+EAFAG  TLKVPYES+G GG+K A +RF A + RT+VMF+ST+Y  RSDDF 
Sbjct  229  ACKGSMVVEAFAGRDTLKVPYESRGTGGFKRASIRFVAVSTRTKVMFYSTFYAMRSDDFS  288

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  289  SLCGPVIDDVKLLSVR  304



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   200 bits (509),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  189  GWMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  248

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  
Sbjct  249  SCEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLS  308

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  309  SLCGPVIDDVKLLSVRKP  326



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID+EHF VP G+RAVELVAG+ESA+ Q+ RT  GK  DL F +GDASN
Sbjct  232  GWMIESLKAVKYIDSEHFHVPQGKRAVELVAGRESAIAQVVRTRPGKIYDLLFSIGDASN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  
Sbjct  292  SCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSG  351

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPVVD V+LV +RNPH
Sbjct  352  SLCGPVVDDVRLVGLRNPH  370



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   201 bits (512),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW VESLKAVKYID+ H+ VP GRRAVELVAGKESA+ QI RT+ GK   L+F VGDA+N
Sbjct  237  AWIVESLKAVKYIDSAHYFVPQGRRAVELVAGKESAIAQIVRTIVGKMYRLSFAVGDANN  296

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+V+EAFAG  TLKVPYESKG+GG+K A+L+F+A +NRTR+MF ST+Y  RSDDF 
Sbjct  297  SCVGSLVVEAFAGKDTLKVPYESKGKGGFKRAELKFKAVSNRTRIMFLSTFYTMRSDDFS  356

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S++
Sbjct  357  SLCGPVLDDVKLLSIQ  372



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   201 bits (511),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID+EHF VP G+RAVELVAG+ESA+ Q+ RT  GK  DL F +GDASN
Sbjct  231  GWMIESLKAVKYIDSEHFHVPEGKRAVELVAGRESALAQVVRTRPGKIYDLLFSIGDASN  290

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  
Sbjct  291  SCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSG  350

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPVVD V+LV VRNPH
Sbjct  351  SLCGPVVDDVRLVGVRNPH  369



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVEL+AGKESAV Q+ RT  GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPQGRRAVELIAGKESAVAQVVRTTPGKIYVLSFAVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVPYESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF 
Sbjct  288  ACAGSMIVEAFAGKDTLKVPYESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFS  347

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S R
Sbjct  348  SLCGPVIDDVKLLSAR  363



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  229  AWIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKV YES G+GG+K A LRF A ++RTRVMF+ST+Y  RSDDF 
Sbjct  289  ACKGSMIVEAFAGKDTLKVAYESNGKGGFKRAALRFVAVSSRTRVMFYSTFYAMRSDDFS  348

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D VKL+SV
Sbjct  349  SLCGPVIDDVKLLSV  363



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D++HF VP G+RA+ELVAGKESA+ Q+ RTV GK   LTF VGDA+N
Sbjct  230  GWMIESLKAVKYLDSDHFFVPSGKRAIELVAGKESAIAQVVRTVPGKLYALTFTVGDANN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  T KVPY SKG+GG+K A LRF AT  RTR+MF+ST+Y  RSDDF 
Sbjct  290  ACSGSMVVEAFAGKDTAKVPYNSKGKGGFKRAVLRFVATQTRTRIMFYSTFYSMRSDDFS  349

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V+LVSVR P
Sbjct  350  SLCGPVIDDVRLVSVRRP  367



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  239  GWMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  298

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  
Sbjct  299  SCEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLS  358

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  359  SLCGPVIDDVKLLSVRKP  376



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  239  GWMVESLKAVKYLDSAHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  298

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  
Sbjct  299  SCEGSMIVEAFAGKDTIKVPYTSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLS  358

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+SVR P
Sbjct  359  SLCGPVIDDVKLLSVRKP  376



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   200 bits (508),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/138 (68%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDAEHF+VP G+RAVELVAG+ESA+ Q+ RT  GK  DL F +GDASN
Sbjct  232  GWMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T++ PYESKG+GG+K A+LRF A + RTRV F STYYH +SD+  
Sbjct  292  SCEGSMLVEAFAGKITMQFPYESKGKGGFKRARLRFTAISPRTRVRFLSTYYHMKSDNSG  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD V+LV VRNP
Sbjct  352  SLCGPVVDDVRLVGVRNP  369



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+DAEHFSVP GRRAVEL+AGKESA+ Q+ RTV G+   L+F VGDASN
Sbjct  227  GWMVESLKAVKYLDAEHFSVPRGRRAVELLAGKESAIAQVVRTVPGRRYALSFAVGDASN  286

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+++EAFAG  T+KVPYESKG+GG K A L+F AT  RTRV+F+S+YY+TRSDD  
Sbjct  287  ACEGSLLVEAFAGEHTIKVPYESKGRGGSKRAVLQFTATTARTRVVFWSSYYNTRSDDLS  346

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V LVSVR P
Sbjct  347  SLCGPVLDDVALVSVRYP  364



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP GRRAVELVAGKESAV Q+ RT  GK   L+F VGDASN
Sbjct  228  GWMVESLKAVKYIDSDHFSVPQGRRAVELVAGKESAVAQVVRTTPGKIYVLSFAVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ESKG+GG+K A L+F A ++RTR+MF+ST+Y  R+DDF 
Sbjct  288  ACAGSMIVEAFAGKDTLKVPHESKGKGGFKRASLKFVAVSDRTRIMFYSTFYAMRNDDFS  347

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S R
Sbjct  348  SLCGPVIDDVKLLSAR  363



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDAEHF+VP G+RA+ELVAG+ESA+ QI RT  GK  DL F VGDASN
Sbjct  231  GWMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASN  290

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TL+VPYES G+GG+K AKLRF A   RTRV F STYYH +SD   
Sbjct  291  SCQGSMLIEAFAGNITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKSDHSG  350

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD V+LV VR P
Sbjct  351  SLCGPVVDDVRLVGVRYP  368



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDAEHF+VP G+RAVELVAG+ESA+ Q+ RT  GK  DL F +GDASN
Sbjct  232  GWMIESLKAVKYIDAEHFTVPEGKRAVELVAGRESAIAQVVRTRPGKVYDLIFSIGDASN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T++ PYESKG+GG K ++LRF A + RTRV F STYYH +SD+  
Sbjct  292  SCEGSMLVEAFAGKITMQFPYESKGKGGVKRSRLRFTAISPRTRVRFLSTYYHMKSDNSG  351

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD V+LV VRNP
Sbjct  352  SLCGPVVDDVRLVGVRNP  369



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDAEHF+VP G+RA+ELVAG+ESA+ QI RT  GK  DL F VGDASN
Sbjct  236  GWMIESLKAVKYIDAEHFTVPEGKRAIELVAGRESAIAQIVRTQKGKVYDLMFSVGDASN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TL+VPYES G+GG+K AKLRF A   RTRV F STYYH ++D   
Sbjct  296  SCQGSMLIEAFAGKITLRVPYESAGKGGFKRAKLRFTAVTERTRVRFLSTYYHMKNDHSG  355

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD ++LV VR+P
Sbjct  356  SLCGPVVDDMRLVGVRHP  373



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   197 bits (502),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 109/136 (80%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D+ HFSVP G RAVELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  238  GWMVESLKAVKYLDSGHFSVPQGTRAVELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  297

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPY SKG+GG+K A L+F A   RTRVMF ST+Y  RSDD  
Sbjct  298  SCEGSMIVEAFAGKDTIKVPYSSKGKGGFKRAALKFVAVGTRTRVMFLSTFYSMRSDDLS  357

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  358  SLCGPVIDDVKLLSVR  373



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   197 bits (501),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDA HF+VP G+RA+ELVAG+ESA+ Q+  T  GK  DL F VGDASN
Sbjct  235  GWMIESLKAVKYIDAAHFTVPEGKRAIELVAGRESAIAQVVITTKGKVYDLMFSVGDASN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TL+VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD   
Sbjct  295  SCQGSMLIEAFAGQITLRVPYESKGSGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSG  354

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD V+LV VR+P
Sbjct  355  SLCGPVVDDVRLVGVRHP  372



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 112/138 (81%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D+ HFSVP G RA+ELVAGKESA+ Q+ART+ GK   L+F VGDASN
Sbjct  229  GWMVESLKAVKYLDSSHFSVPEGTRAIELVAGKESAIAQVARTIPGKTYVLSFSVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPY+SKG+GG+K A L+F A  +RTR+MF ST+Y  R+DD  
Sbjct  289  SCEGSMIVEAFAGRDTVKVPYQSKGKGGFKRAVLKFVAVGSRTRIMFLSTFYSMRTDDLS  348

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+S+R P
Sbjct  349  SLCGPVIDDVKLLSLRKP  366



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK   L F VGDA N
Sbjct  216  GWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGN  275

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD  
Sbjct  276  SCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLA  335

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D V L+S+R PHRR 
Sbjct  336  SLCGPVIDDVTLISLRKPHRRF  357



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 111/142 (78%), Gaps = 2/142 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAV YID+ HF VP G+RAVELV GKESA+ Q+ARTV G+   L+FLVGDA N
Sbjct  228  GWMVESLKAVNYIDSAHFKVPQGKRAVELVGGKESALAQVARTVVGRVYTLSFLVGDAGN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G MV+EAFA  ST+KVPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D   
Sbjct  288  ACTGPMVVEAFAARSTVKVPYDSKGTGGFKRAVLRFTAVAERTRVVFLSTYYNTRTDG--  345

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPVVD V L+SVRNP RRL
Sbjct  346  SLCGPVVDDVTLLSVRNPSRRL  367



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   196 bits (497),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK   L F VGDA N
Sbjct  229  GWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y+ RSDD  
Sbjct  289  SCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYNMRSDDLA  348

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D V L+S+R PHRR 
Sbjct  349  SLCGPVIDDVTLISLRKPHRRF  370



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW +ESLKAVKY+D EHFSVP GRRAVELVAGKESA+ Q+ART+ GK   L+F VGDA+N
Sbjct  229  AWIIESLKAVKYVDVEHFSVPQGRRAVELVAGKESAIAQVARTIVGKSYVLSFAVGDANN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKV YESKG+GG+K A LRF A +NRTRVMF+ST+Y  RSDDF 
Sbjct  289  ACKGSMIVEAFAGKDTLKVAYESKGKGGFKRAALRFVAVSNRTRVMFYSTFYAMRSDDFS  348

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D VKL+SV
Sbjct  349  SLCGPVIDDVKLLSV  363



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   195 bits (496),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYIDA HF+VP G+RA+ELVAG+ESA+ Q   T  GK  DL F VGDASN
Sbjct  235  GWMIESLKAVKYIDAAHFAVPEGKRAIELVAGRESAIAQQVITTKGKVYDLMFSVGDASN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TL+VPYESKG GG+K AKLRF+A + RTRV F STYYH +SD   
Sbjct  295  SCQGSMLIEAFAGQITLRVPYESKGNGGFKRAKLRFKAVSERTRVRFLSTYYHMKSDHSG  354

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD V+LV VR+P
Sbjct  355  SLCGPVVDDVRLVGVRHP  372



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 111/138 (80%), Gaps = 2/138 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVPHG+RAVELVAGKESA+ Q+ART+ GK   LTF VGDA N
Sbjct  228  GWMVESLKAVKYIDSDHFSVPHGKRAVELVAGKESALAQVARTIPGKVYTLTFSVGDAGN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFA   T+K+PYESKG GGYK A LRF A   RTRV+F ST+YHT++D   
Sbjct  288  GCVGSMVVEAFASRGTVKIPYESKGTGGYKRAVLRFTAAVERTRVVFLSTFYHTKTDG--  345

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD V L+SVR+P
Sbjct  346  SLCGPVVDDVSLLSVRSP  363



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 111/141 (79%), Gaps = 2/141 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             WTVESLKAVKYID++HFSVP G+RAVELVAGKESA+ Q+ARTV GK   L F +GDA N
Sbjct  230  GWTVESLKAVKYIDSDHFSVPRGKRAVELVAGKESALAQVARTVPGKVYALAFSIGDAGN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  T K+PYESKG GGYK   LRF A A RTRV+FFST+YHT+ D   
Sbjct  290  GCVGSMVVEAFAGRGTAKIPYESKGTGGYKRGVLRFTAVAERTRVVFFSTFYHTKVDG--  347

Query  304  SLCGPVVDFVKLVSVRNPHRR  242
            SLCGP +D V L+SVR+P RR
Sbjct  348  SLCGPSLDDVSLLSVRSPVRR  368



>gb|KHG21629.1| GTPase Der [Gossypium arboreum]
Length=302

 Score =   192 bits (487),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+   L+FLVGDA+N
Sbjct  162  GWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANN  221

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  
Sbjct  222  GCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSG  281

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPV+D VKL+SVR  H
Sbjct  282  SLCGPVLDDVKLLSVRKLH  300



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   193 bits (490),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+DA+HF+VP G+RA+ELVAG+ESA+ Q   T AG+  DLTF VGDA+N
Sbjct  240  GWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKAGRIYDLTFSVGDANN  299

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG   L+  Y SKG+GG+K AKLRF AT+ RTRV F S+YYH +SD+  
Sbjct  300  SCEGSMVVEAFAGNVALQFKYVSKGKGGFKRAKLRFTATSQRTRVRFLSSYYHMKSDNSG  359

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPVVD V+LVSVRNP
Sbjct  360  SLCGPVVDDVRLVSVRNP  377



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   191 bits (486),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+   L+FLVGDA+N
Sbjct  188  GWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANN  247

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  
Sbjct  248  GCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSG  307

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPV+D VKL+SVR  H
Sbjct  308  SLCGPVLDDVKLLSVRKLH  326



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+   L+FLVGDA+N
Sbjct  234  GWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTTIGRNYVLSFLVGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  
Sbjct  294  GCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSG  353

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPV+D VKL+SVR  H
Sbjct  354  SLCGPVLDDVKLLSVRKLH  372



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKA+KYID+EHFSVP G+RA+EL+AGKESAV QI +T  G+   L+FLVGDA+N
Sbjct  234  GWIIESLKAIKYIDSEHFSVPKGKRAIELIAGKESAVAQIVKTAIGRNYVLSFLVGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG MV+EAFAG +T+KV Y SKG+GG+K A+L FRA + RTR+MF+ST+Y  +SD+  
Sbjct  294  GCEGPMVVEAFAGKNTVKVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTFYAMKSDNSG  353

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPV+D VKL+SVR  H
Sbjct  354  SLCGPVLDDVKLLSVRKLH  372



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+ HFSVP G RA+ELVAGKESA+ Q+ART+ GK   L F VGDASN
Sbjct  229  GWMVESLKAVKYIDSAHFSVPGGYRAIELVAGKESAIAQVARTIPGKTYTLFFAVGDASN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG+GG+K A LRF+A + RTR+MF+ST+Y  RSDDF 
Sbjct  289  SCEGSMIVEAFAGRDTIKVPYESKGKGGFKRAVLRFKAVSTRTRIMFYSTFYTMRSDDFS  348

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPVVD V L+SVRNP 
Sbjct  349  SLCGPVVDDVVLLSVRNPR  367



>ref|XP_007150706.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
 gb|ESW22700.1| hypothetical protein PHAVU_005G1745000g, partial [Phaseolus vulgaris]
Length=294

 Score =   189 bits (479),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T  G+  DLTF VGDA+N
Sbjct  154  GWIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANN  213

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+++PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+  
Sbjct  214  ACEGSMIVEAFAGAETVQIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSG  273

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+SVR P R
Sbjct  274  SLCGPVIDDVKLLSVRYPRR  293



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   189 bits (480),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK   L+F VGDA N
Sbjct  191  GWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGN  250

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF 
Sbjct  251  SCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFA  310

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V L+S+R P
Sbjct  311  SLCGPVIDDVTLISLRKP  328



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID EHF+VP G+RAVELVAG+ESA+ Q   T AGK  DL F VGDA+N
Sbjct  239  GWIIESLKAVKYIDTEHFAVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANN  298

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG   L+VPY SKG+GG+K AK RF A + RTRV F ST YH ++D+  
Sbjct  299  SCEGSMLIEAFAGKVALQVPYMSKGKGGFKRAKFRFTAISRRTRVRFLSTNYHMKTDNSG  358

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V+LVSVRNP
Sbjct  359  SLCGPVIDDVRLVSVRNP  376



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAV+YID++HFSVP G+RAVEL+ GKESA+ Q+ART+ GK   L F VGDA N
Sbjct  227  GWMVESLKAVRYIDSDHFSVPKGKRAVELIGGKESAIAQVARTIPGKTYTLFFAVGDAGN  286

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
              EGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RT ++F ST+Y+ RSDD  
Sbjct  287  SSEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTHILFLSTFYNMRSDDLA  346

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D V L+S+R PHRR 
Sbjct  347  SLCGPVIDDVTLISLRKPHRRF  368



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HF+VP G+R VELVAGKESA++Q+  T+  +   L+F VGDA+N
Sbjct  233  GWMIESLKAVKYIDSDHFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T+KVPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+  
Sbjct  293  SCEGSMVVEAFAGLDTVKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSG  352

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  353  SLCGPVLDDVKLLSVR  368



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 111/140 (79%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T  G+  DLTF VGDA+N
Sbjct  236  GWIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGRVYDLTFAVGDANN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+++PY+SKG+GG    KLRF+A A RTR+ F ST+Y  +SD+  
Sbjct  296  ACEGSMIVEAFAGAETVQIPYQSKGKGGSVRGKLRFKAVATRTRLRFLSTFYTMKSDNSG  355

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+SVR P R
Sbjct  356  SLCGPVIDDVKLLSVRYPRR  375



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   189 bits (480),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T+ GK  DLTF+VGDA+N
Sbjct  234  GWMVESLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T++V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  
Sbjct  294  SCEGSMVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTG  353

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGP++D ++L+SVR
Sbjct  354  SLCGPIIDDIRLLSVR  369



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HFSVP G+ AVEL+ GKESA+ Q+ART+ GK   L+F VGDA N
Sbjct  228  GWIVESLKAVKYIDSDHFSVPLGKGAVELIGGKESAIAQVARTIPGKTYTLSFAVGDAGN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+ +EA+ G  ++KVPYESKG+GG+K A L+F A + RTR++F ST+Y  RSDDF 
Sbjct  288  SCEGSLSVEAYVGKESVKVPYESKGKGGFKRATLKFVAVSTRTRILFLSTFYTMRSDDFA  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V L+S+R P
Sbjct  348  SLCGPVIDDVTLISLRKP  365



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   189 bits (479),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T+ GK  DLTF+VGDA+N
Sbjct  232  GWMVESLKAVKYIDSDHFAVPEGKRAIELVAGKESAIAQVVITIIGKVYDLTFVVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T++V Y+SKG+GG+   KLRF+A + RTR+ F ST+Y T+SD+  
Sbjct  292  SCEGSMVVEAFAGKDTIQVQYQSKGKGGFIRGKLRFKAMSTRTRIRFLSTFYTTKSDNTG  351

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGP++D ++L+SVR
Sbjct  352  SLCGPIIDDIRLLSVR  367



>gb|KDO83473.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=291

 Score =   186 bits (473),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP+G  AVELVAG+ESA+ QI RTV  K  +LTF +GDA N
Sbjct  155  GWIIESLKAVKFIDAKHFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKN  214

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM +EAFAG  T+ VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF 
Sbjct  215  GCHGSMRVEAFAGKDTVAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFG  274

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V+++S+R
Sbjct  275  SLCGPVLDEVRVLSIR  290



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   189 bits (481),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/136 (65%), Positives = 112/136 (82%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HF+VP G+R VELVAGKESA++Q+  T+  +   L+F VGDA+N
Sbjct  233  GWMIESLKAVKYIDSDHFAVPEGKRGVELVAGKESALSQVVFTIPNRVYVLSFSVGDANN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T+KVPYESKG+GG+K AKLRF+A + RTRVMF STYY  ++D+  
Sbjct  293  SCEGSMVVEAFAGLDTVKVPYESKGKGGFKRAKLRFKAISKRTRVMFLSTYYTMKNDNSG  352

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  353  SLCGPVLDDVKLLSVR  368



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W V+S KAVKY+D+ HFSVP G RAVEL+AGKESA+ Q  RTV G+   L F VGDASN
Sbjct  227  GWMVDSPKAVKYLDSTHFSVPRGSRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASN  286

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+G+M++EAFAG  T+KVPYESKG GG K A LRFRA+  RTR++FFS+ Y+TRSDD  
Sbjct  287  ACQGTMIVEAFAGEHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFFSSNYNTRSDDLS  346

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V LVS+RNP
Sbjct  347  SLCGPVLDDVALVSIRNP  364



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   189 bits (480),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 87/138 (63%), Positives = 109/138 (79%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D+ HF+VP G+RAVELVAG+ESA+ Q  RTV GK  +L F +GDA N
Sbjct  261  GWMIESLKAVKYVDSNHFAVPEGKRAVELVAGRESALAQTVRTVPGKTYNLIFSIGDAKN  320

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM +EA AG   L+VPYESKG GG+K AKLRF+A ++RTRV F ST+YH +SD+  
Sbjct  321  SCEGSMTVEANAGRDILQVPYESKGNGGFKRAKLRFKAVSSRTRVRFLSTFYHIKSDNSG  380

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGP++D V+LVS+R P
Sbjct  381  SLCGPIIDDVRLVSIRYP  398



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   188 bits (478),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 107/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W V+S KAVKY+D+ HF VPHGRRAVEL+AGKESA+ Q  RTV G+   L F VGDASN
Sbjct  228  GWMVDSPKAVKYLDSAHFFVPHGRRAVELLAGKESALAQEVRTVPGRAYALAFSVGDASN  287

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG  T+KVPYESKG GG K A LRFRA+  RTR++F S+ Y TR DD  
Sbjct  288  ACEGSMIVEAFAGEHTVKVPYESKGAGGAKRAVLRFRASKARTRIVFLSSNYSTRRDDLS  347

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V LVS+RNP
Sbjct  348  SLCGPVLDDVALVSIRNP  365



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   188 bits (478),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID +HF+VP G+RA+ELVAGKESA+ Q+ +T+ GK   LTF VGDA+N
Sbjct  237  GWIIESLKAVKYIDLDHFAVPEGKRAIELVAGKESALAQVVKTIPGKTYVLTFSVGDANN  296

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EA+AG   ++ PY SKG+GG+K AKL+F+A +  TR+MF S++Y  +SD+  
Sbjct  297  ACEGSMIVEAYAGKDKIQFPYVSKGKGGFKTAKLQFKAVSTHTRIMFLSSFYTMKSDNSG  356

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKL+SVR P R L
Sbjct  357  SLCGPVLDDVKLISVRQPRRLL  378



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 110/142 (77%), Gaps = 2/142 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            +W VESLKAV YID+ HF VP G+RAVELV GKESA+ Q+ RTV G+   L+F VGDA N
Sbjct  234  SWMVESLKAVNYIDSAHFKVPQGKRAVELVGGKESALAQVVRTVVGRVYTLSFSVGDAGN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G+M++EAFA  ST+KVPY+SKG GG+K A LRF A A RTRV+F STYY+TR+D   
Sbjct  294  ACAGTMMVEAFAARSTVKVPYDSKGTGGFKRAVLRFTAEAERTRVVFLSTYYNTRTDG--  351

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPVVD V L+SVR P RRL
Sbjct  352  SLCGPVVDDVTLLSVRKPSRRL  373



>gb|AFK48067.1| unknown [Lotus japonicus]
Length=204

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+ HF+VP G+RAVELVAGKES + Q  +T  GK   LTF VGDA+N
Sbjct  64   GWMVESLKAVKYIDSNHFAVPAGKRAVELVAGKESVIAQNVKTTIGKVYVLTFAVGDANN  123

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG  T++VPY+SKG+GG+   KLRF+A + RTRV F ST+Y  ++D+  
Sbjct  124  SCEGSMVVEAFAGGDTVQVPYQSKGKGGFVRGKLRFKAVSARTRVRFLSTFYTMKNDNSG  183

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGP++D ++L+SVR P R
Sbjct  184  SLCGPIIDDIRLLSVRYPGR  203



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 108/143 (76%), Gaps = 3/143 (2%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVA---GKESAVTQIARTVAGKFXDLTFLVGD  494
             W +ESLKAVKYID++HF VP G+RAVELVA   G+E A+ Q  RTV GK  DL F +GD
Sbjct  230  GWMIESLKAVKYIDSDHFGVPEGKRAVELVAVGKGRERALAQTVRTVPGKTYDLIFSIGD  289

Query  493  ASNKCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSD  314
            A N CEGSM++EA AG   L+VPYESKG GG+K AKLRF+A + RTR+ F STYYH +SD
Sbjct  290  AKNSCEGSMMVEATAGKVILQVPYESKGAGGFKRAKLRFKAISTRTRIRFLSTYYHMKSD  349

Query  313  DFVSLCGPVVDFVKLVSVRNPHR  245
            +  SLCGPV+D VKLV VR P R
Sbjct  350  NSGSLCGPVIDDVKLVGVRRPGR  372



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 115/139 (83%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W ++SLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT  G+   L+F +GDA+N
Sbjct  234  GWIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGRDYVLSFTIGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFA  +T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+  
Sbjct  294  ACEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSG  353

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPVVD VKLVS+R  H
Sbjct  354  SLCGPVVDDVKLVSIRKLH  372



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+DA+HF+VP G+RA+ELVAG+ESA+ Q   T  G+  DL F VGDA+N
Sbjct  240  GWIVESLKAVKYVDADHFTVPEGKRAIELVAGRESAIAQQVITKTGRIYDLIFSVGDANN  299

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG   L+  Y SKG+GG+K AKLRF A + RTRV F S+YYH +SD+  
Sbjct  300  ACEGSMVVEAFAGNVALQFQYVSKGKGGFKRAKLRFTAMSQRTRVRFLSSYYHMKSDNSG  359

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V+LVSVRNP
Sbjct  360  SLCGPVIDDVRLVSVRNP  377



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   187 bits (474),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID+EHFSVP G+RA+ELVAGKESA+ Q+ +T  G+   L+F VGDA+N
Sbjct  232  GWIIESLKAVKYIDSEHFSVPEGKRAIELVAGKESALAQVVKTTIGRSYVLSFTVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFAG +T+K  Y+SKG+GG+K A L F+A ++RTR+MF+ST+Y  +SD+  
Sbjct  292  ACEGSMVVEAFAGKNTVKASYQSKGKGGFKRAILAFKAESSRTRIMFYSTFYTMKSDNSG  351

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPV+D VKL+SVR  H
Sbjct  352  SLCGPVLDDVKLLSVRKLH  370



>ref|XP_006439076.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 ref|XP_006482850.1| PREDICTED: uncharacterized protein LOC102610407 [Citrus sinensis]
 gb|ESR52316.1| hypothetical protein CICLE_v10031881mg [Citrus clementina]
 gb|KDO83472.1| hypothetical protein CISIN_1g017636mg [Citrus sinensis]
Length=368

 Score =   186 bits (473),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 110/136 (81%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP+G  AVELVAG+ESA+ QI RTV  K  +LTF +GDA N
Sbjct  232  GWIIESLKAVKFIDAKHFNVPYGHAAVELVAGRESAIAQILRTVPNKEYNLTFTIGDAKN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM +EAFAG  T+ VP+ESKG+GG+K A L+F+A A RTR+ FFSTYYHT+ +DF 
Sbjct  292  GCHGSMRVEAFAGKDTVAVPFESKGKGGFKSASLKFKAIAARTRITFFSTYYHTKINDFG  351

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V+++S+R
Sbjct  352  SLCGPVLDEVRVLSIR  367



>gb|EMS52012.1| hypothetical protein TRIUR3_31218 [Triticum urartu]
Length=312

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV GK   L+F VGDASN
Sbjct  169  GWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASN  228

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDF  308
             C GS+++EA+AG  + KVPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD 
Sbjct  229  TCRGSLMVEAYAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDM  288

Query  307  VSLCGPVVDFVKLVSVR-NPHRR  242
             SLCGPV+D V +VSVR  P +R
Sbjct  289  SSLCGPVIDDVAVVSVRARPPKR  311



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   187 bits (474),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+DAEHF+VP G+RAVELVAG+ESA+ Q   T AGK  DL F VGDA+N
Sbjct  239  GWIIESLKAVKYVDAEHFTVPEGKRAVELVAGRESALAQQVITKAGKIYDLIFTVGDANN  298

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EAFAG   L+V Y SKG+GG+K AKLRF A + RT V F ST YH +SD+  
Sbjct  299  SCEGSMLIEAFAGKVALQVRYMSKGKGGFKRAKLRFTAISRRTGVRFLSTNYHMKSDNSG  358

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V+LVSVRNP
Sbjct  359  SLCGPVIDDVRLVSVRNP  376



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 114/139 (82%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W ++SLKAVKYID++HF+VP G+RA+EL+AGKES+++Q+ RT  G    L+F +GDA+N
Sbjct  234  GWIIDSLKAVKYIDSDHFTVPEGKRAIELIAGKESSLSQVVRTTIGGDYVLSFTIGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSMV+EAFA  +T+KV Y+SKG+GG+K A+LRF+A + RTR+MF+ST+Y  ++D+  
Sbjct  294  ACEGSMVVEAFANKNTVKVTYDSKGKGGFKQARLRFKADSTRTRIMFYSTFYTMKNDNSG  353

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPVVD VKLVS+R  H
Sbjct  354  SLCGPVVDDVKLVSIRKLH  372



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF VP G RA+ELVAGKESA+ Q+  T  GK  DLTF VGDA+N
Sbjct  232  GWIVESLKAVKYIDSKHFYVPEGNRAIELVAGKESALAQVVITTIGKVYDLTFSVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM +EAFAG  T++VPYESKG+GG+   KLRF A + RTR+ F ST+Y  ++D+  
Sbjct  292  SCEGSMTVEAFAGGDTVQVPYESKGKGGFVRGKLRFTALSTRTRIRFLSTFYTMKNDNSG  351

Query  304  SLCGPVVDFVKLVSVRNPHRR  242
            SLCGPV+D VKL+SVR P++ 
Sbjct  352  SLCGPVIDDVKLLSVRYPNKH  372



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   186 bits (471),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 112/140 (80%), Gaps = 1/140 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV GK   L+F VGDASN
Sbjct  231  GWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGKQYALSFSVGDASN  290

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDF  308
             C GS+++EA+AG  + KVPYES GQGG  K A L FRAT+ RTRV+FFS++Y+TR+DD 
Sbjct  291  TCRGSLMVEAYAGRESAKVPYESAGQGGAAKRAVLPFRATSPRTRVVFFSSFYNTRTDDM  350

Query  307  VSLCGPVVDFVKLVSVRNPH  248
             SLCGPV+D V +VSVR  H
Sbjct  351  SSLCGPVIDDVAVVSVRARH  370



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   185 bits (470),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 111/138 (80%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP G+RA+ELVAGKESA+ Q+  T  GK  DLTF VGDA+N
Sbjct  234  GWIVESLKAVKYIDSDHFAVPEGKRAIELVAGKESALAQVVITTIGKTYDLTFAVGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
            +CE SM++EAFAG +T++VPY+SKG+GG+   KLRF+A + RTR+ F ST+Y  +SD+  
Sbjct  294  ECEASMMVEAFAGANTVQVPYQSKGKGGFVRGKLRFKAVSTRTRLRFLSTFYTMKSDNSG  353

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D VKL+ VR P
Sbjct  354  SLCGPVIDDVKLLGVRYP  371



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W V+SLKAVKYID+EHF+VP G+RAVEL+AGKESA++QI +T+  K   LTF VGD SN
Sbjct  232  GWIVDSLKAVKYIDSEHFTVPEGKRAVELIAGKESAISQIVKTIINKIYVLTFNVGDTSN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+E +AG    +VPY+S G+GG+K AK  F+A +N TR+ F S++Y  +SD+  
Sbjct  292  SCVGSMVVEVYAGKDRTQVPYKSNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSG  351

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKLVSVRNP R L
Sbjct  352  SLCGPVLDDVKLVSVRNPRRHL  373



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   184 bits (468),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W V+SLKAVKYID++HF+VP G+RAVELVAGKESA++Q+ +T   K   LTF VGD SN
Sbjct  232  GWMVDSLKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+E +AG    +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  
Sbjct  292  SCVGSMVVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYTMKSDNSG  351

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKLVSVRNP R L
Sbjct  352  SLCGPVLDDVKLVSVRNPRRHL  373



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   185 bits (469),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W V+SLKAVKYID++HF+VP G+RAVELVAGKESA++Q+ +T   K   LTF VGD SN
Sbjct  254  GWMVDSLKAVKYIDSDHFTVPEGKRAVELVAGKESAISQVVKTTISKIYALTFSVGDTSN  313

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+E +AG    +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  
Sbjct  314  SCVGSMVVEVYAGKDKTQVPYESNGKGGFKHAKFVFKAISNHTRITFLSSFYSMKSDNSG  373

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKLVSVRNP R L
Sbjct  374  SLCGPVLDDVKLVSVRNPRRHL  395



>gb|EMT16005.1| hypothetical protein F775_13621 [Aegilops tauschii]
Length=340

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 115/143 (80%), Gaps = 2/143 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+   L+F VG+ASN
Sbjct  197  GWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFSVGNASN  256

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDF  308
             C GS+++EA+AG  + KVPYES GQGG  K A L FRAT++RTRV+FFS++Y+TR+DD 
Sbjct  257  TCRGSLMVEAYAGRESTKVPYESAGQGGAAKRAVLPFRATSSRTRVVFFSSFYNTRTDDM  316

Query  307  VSLCGPVVDFVKLVSVR-NPHRR  242
             SLCGPV+D V +VSVR  P +R
Sbjct  317  SSLCGPVIDDVAVVSVRARPPKR  339



>gb|KJB70570.1| hypothetical protein B456_011G080200 [Gossypium raimondii]
Length=203

 Score =   179 bits (453),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 82/140 (59%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKA+KYID+EH SVP G+ A+EL+AGKESAV QI +T  G+   L+F+VGDA+N
Sbjct  63   GWIIESLKAIKYIDSEHLSVPQGKWAIELIAGKESAVAQIVKTTIGRNYVLSFVVGDANN  122

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M++EAFAG + + V Y SKG+GG+K A+L FRA + RTR+MF+ST Y  +SD+  
Sbjct  123  GCEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRIMFYSTIYTIKSDNSG  182

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D V L+SVR  H 
Sbjct  183  SLCGPVLDDVMLLSVRKLHH  202



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W V+SLKAVKYID EHF+VP G+RAVELVAGKESA++Q  +T+  K   LTF VGD SN
Sbjct  248  GWIVDSLKAVKYIDREHFTVPEGKRAVELVAGKESAISQTVKTIINKIYVLTFYVGDTSN  307

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+E +AG    +VPYES G+GG+K AK  F+A +N TR+ F S++Y  +SD+  
Sbjct  308  SCVGSMVVEVYAGKDRTQVPYESNGKGGFKRAKFVFKAVSNHTRITFLSSFYTMKSDNSG  367

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKLVSVRNP R L
Sbjct  368  SLCGPVLDDVKLVSVRNPRRHL  389



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID+EHF VP GRRA+ELV GKESA+TQ+  T  GK   LTF VGD++N
Sbjct  235  GWIIESLKAVKYIDSEHFFVPEGRRAIELVTGKESALTQVVFTKPGKLYALTFSVGDSNN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+V+EAFAG  TLKVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   
Sbjct  295  SCEGSLVVEAFAGKDTLKVPYQSKGKGGFKRARLIFTAVGPRTRIMFYSTFYTMVADHSG  354

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGP++D VKL+SVR
Sbjct  355  SLCGPIIDDVKLLSVR  370



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   183 bits (464),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID+++F VP G+RAVELV G+ES V Q+ RT   K  DL F VGD++N
Sbjct  230  GWMIESLKAVKYIDSDNFRVPEGKRAVELVGGRESVVAQVVRTEPEKVYDLVFSVGDSNN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
            KCEGSM++ A+AG   L+VPYESKG GG+K A++RF+AT+ RTR+ F S YYH +SD+  
Sbjct  290  KCEGSMMVVAYAGVDILQVPYESKGHGGFKSARMRFKATSTRTRIRFSSEYYHMKSDNSG  349

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPVVD V+LV +R P R
Sbjct  350  SLCGPVVDDVRLVRIRYPSR  369



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   183 bits (464),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 109/140 (78%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID+EHF+VP G+RA+ELVAGKESA+ Q   T  GK   LTF VGDA+N
Sbjct  232  GWIVESLKAVKYIDSEHFTVPEGKRAIELVAGKESALAQEVFTTIGKVYVLTFAVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM +EAFAG  T++VPY+SKG+GG+   KLRF+A+  RTR+ F ST+Y  ++D+  
Sbjct  292  ACEGSMTVEAFAGRDTVQVPYQSKGKGGFVRGKLRFKASTRRTRIRFLSTFYTMKNDNSG  351

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+SVR P+ 
Sbjct  352  SLCGPVIDDVKLLSVRYPNN  371



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 108/137 (79%), Gaps = 0/137 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK++D++HF+VP G+RAVELVAGKESA+ Q+  T  GK   LTF VGDA N
Sbjct  232  GWIIESLKAVKFVDSDHFAVPEGKRAVELVAGKESAIAQVVSTQRGKVYVLTFAVGDAKN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM +EA+AG +++ VPY S G+GGY  AKLRF AT++RTRV F S+YY+ +SD   
Sbjct  292  SCEGSMAVEAYAGTASVTVPYTSTGKGGYVHAKLRFTATSDRTRVRFLSSYYNMQSDHSG  351

Query  304  SLCGPVVDFVKLVSVRN  254
            SLCGPV+D V+LVSVRN
Sbjct  352  SLCGPVIDDVRLVSVRN  368



>ref|XP_007218161.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19360.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=291

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ Q+ RTV  K  DL+F+VGDA N
Sbjct  156  GWIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARN  215

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ 
Sbjct  216  GCHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYG  275

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D V++  V
Sbjct  276  ALCGPILDQVRVYPV  290



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYI++EHF VP G+RA+ELVAGKESA++QI +T+  K   LTF VGDA+N
Sbjct  234  GWIIESLKAVKYINSEHFKVPQGKRAIELVAGKESALSQIVKTIPKKSYVLTFNVGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+V+E +AG   +++PY SKG+GG+KPA+ +F+A +  TR+MF S++Y  +SD+  
Sbjct  294  SCEGSLVVEVYAGNDKIEIPYVSKGKGGFKPARFQFQAVSTHTRLMFLSSFYTMKSDNSG  353

Query  304  SLCGPVVDFVKLVSVRNPHRRL  239
            SLCGPV+D VKL+SVR P   L
Sbjct  354  SLCGPVIDDVKLLSVRRPRHLL  375



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D++H+ VP G+RAVELVAG+ESA+ QI +TV GK  DL FL+GDA N
Sbjct  234  GWIIESLKAVKYVDSDHYGVPEGKRAVELVAGRESALAQIVKTVPGKTYDLYFLLGDAKN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M +EA AG ++L+  YESKG GG++ +KLRF+A + RTRV F S  YH +SD+  
Sbjct  294  SCEGMMTVEAAAGKNSLQFHYESKGAGGFQRSKLRFKAVSVRTRVRFLSMLYHMKSDNTG  353

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D V+LV VRNP R
Sbjct  354  SLCGPVIDDVRLVGVRNPGR  373



>ref|XP_010534242.1| PREDICTED: uncharacterized protein LOC104809851 [Tarenaya hassleriana]
Length=365

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP+G  A+ELVAGKESA+ Q+ RTV  K   L+F VGDA N
Sbjct  230  GWIIESLKAVKFIDSKHFNVPYGEAAIELVAGKESAIAQVIRTVPNKVYSLSFAVGDARN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFAG  TLKVP+ S G G YK A L+F+A   RTR+ FFSTYYHT+ DDF 
Sbjct  290  GCHGSMVVEAFAGKDTLKVPHNSVGAGHYKTASLKFKALEARTRITFFSTYYHTKKDDFG  349

Query  304  SLCGPVVDFVKLVSV  260
            SLCGP++D +++V V
Sbjct  350  SLCGPIIDDIRVVPV  364



>ref|XP_004149718.1| PREDICTED: uncharacterized protein LOC101216438 [Cucumis sativus]
 ref|XP_004164153.1| PREDICTED: uncharacterized LOC101216438 [Cucumis sativus]
 gb|KGN58580.1| hypothetical protein Csa_3G689790 [Cucumis sativus]
Length=368

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G  A+ELVAG+ESAV QI RT+  K   LTF VGDA N
Sbjct  233  GWIIESLKAVKFIDSKHFNVPVGLAAIELVAGRESAVAQIIRTIPNKVYSLTFKVGDAKN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T+KVP++S+G+G YK A L+F+AT+ RTR+ FFS+YYHTR+DDF 
Sbjct  293  GCHGSMMVEAFAAKETVKVPFQSQGKGLYKNAILKFKATSRRTRITFFSSYYHTRTDDFG  352

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V+++S  
Sbjct  353  SLCGPVLDDVRVISTN  368



>ref|XP_010241207.1| PREDICTED: uncharacterized protein LOC104585883 [Nelumbo nucifera]
Length=365

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID+ HF+VP+G  AVELVAGKESA+ Q+ RTV  K  +LTF VGDA N
Sbjct  229  GWIIESLKAVKFIDSAHFNVPYGSAAVELVAGKESAIAQVIRTVPNKLYNLTFTVGDARN  288

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM +EAFAG  TLKVP+ESKG+GG+K    +F+A   RTR+ FFS++YHTR DD+ 
Sbjct  289  GCHGSMSVEAFAGAETLKVPFESKGKGGFKAVSFKFKAVGARTRITFFSSFYHTRVDDYG  348

Query  304  SLCGPVVDFVKLVSV  260
            SLCGP++D V++  V
Sbjct  349  SLCGPILDQVRVFPV  363



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 108/135 (80%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP G+ AVELVAG+ESA+ Q+ RTV  K   L+F +GDA N
Sbjct  233  GWIIESLKAVKFIDAKHFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTIGDARN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ S+G+GG+K A  +F+AT+ RTR+ FFS++YHTR+DD+ 
Sbjct  293  GCHGSMMVEAFAGKDTLKVPFNSQGKGGFKNASFKFKATSFRTRITFFSSFYHTRTDDYG  352

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D VK+  +
Sbjct  353  ALCGPILDEVKVSPI  367



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   180 bits (456),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ Q+ RTV  K  DL+F+VGDA N
Sbjct  232  GWIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYDLSFVVGDARN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ 
Sbjct  292  GCHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYG  351

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D V++  V
Sbjct  352  ALCGPILDQVRVYPV  366



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   180 bits (456),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HF VP GRRA+ELV GKESA+ Q+  T  GK   LTF VGD++N
Sbjct  235  GWIIESLKAVKYIDSKHFFVPEGRRAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+++EAFAG  TLKVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   
Sbjct  295  ACEGSLIVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSG  354

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGP++D VKL+SVR
Sbjct  355  SLCGPIIDDVKLLSVR  370



>dbj|BAD16016.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD38436.1| unknown protein [Oryza sativa Japonica Group]
Length=302

 Score =   177 bits (450),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+   L+F VGDASN 
Sbjct  158  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNG  217

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
            CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  
Sbjct  218  CEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMS  277

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V +VSVR
Sbjct  278  SLCGPVIDDVAVVSVR  293



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HF VP GR+A+ELV GKESA+ Q+  T  GK   LTF VGD++N
Sbjct  235  GWIIESLKAVKYIDSQHFFVPEGRKAIELVGGKESALAQVVFTKPGKLYALTFSVGDSNN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+++EAFAG  TLKVPY+SKG+GG+K A+L F A   RTR+MF+ST+Y   +D   
Sbjct  295  ACEGSLIVEAFAGKDTLKVPYQSKGKGGFKRARLLFTAVGPRTRIMFYSTFYTMSADHSG  354

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGP++D VKL+SVR
Sbjct  355  SLCGPIIDDVKLLSVR  370



>gb|ABF99456.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAH00287.1| unnamed protein product [Oryza sativa Japonica Group]
Length=295

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTVA +  +L+F+VGDA N 
Sbjct  160  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNG  219

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFAG  T KVP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VS
Sbjct  220  CHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVS  279

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+  ++
Sbjct  280  LCGPVLDQVKVQPLK  294



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 106/140 (76%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HF+VP GRRA+EL+AGKESA+ Q+  T  G+   LTF VGD +N
Sbjct  193  GWIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNN  252

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+ +EAFAG  T+KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD   
Sbjct  253  GCEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSG  312

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D VKL+S+R   R
Sbjct  313  SLCGPVIDDVKLLSIRGRPR  332



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HFSVP GRRA+ELVAGKESA+ Q+  T+ GK   LTF VGD++N
Sbjct  235  GWIIESLKAVKYIDSKHFSVPEGRRAIELVAGKESALAQVVFTLPGKLYALTFTVGDSNN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+ +EAFAG  TLKV Y+SKGQGG+K A+  F A   RTRVMF+S +Y   +D   
Sbjct  295  ACEGSLAVEAFAGKDTLKVLYQSKGQGGFKRARFLFTAVGPRTRVMFYSMFYTMAADHSG  354

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  355  SLCGPVIDDVKLLSVR  370



>ref|XP_010257157.1| PREDICTED: uncharacterized protein LOC104597377 [Nelumbo nucifera]
Length=366

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 106/136 (78%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID+ HF+VP+G +AVELVAG+ESA+ QI RTV  +   ++F VGDA N
Sbjct  230  GWIIESLKAVKFIDSAHFNVPYGFKAVELVAGRESAIAQIIRTVPNRLYGVSFTVGDARN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   TLKVPYES G+GG+K A  +F+A   RTR+ F+S++YHTR DD+ 
Sbjct  290  GCHGSMMVEAFAAKETLKVPYESHGKGGFKTASFKFKAIEPRTRITFYSSFYHTRVDDYG  349

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGP++D V++V VR
Sbjct  350  SLCGPILDQVRVVPVR  365



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   178 bits (452),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/136 (65%), Positives = 109/136 (80%), Gaps = 1/136 (1%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+   L+F VGDASN 
Sbjct  235  WMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASNG  294

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
            CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD  
Sbjct  295  CEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDMS  354

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V +VSVR
Sbjct  355  SLCGPVIDDVAVVSVR  370



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 108/139 (78%), Gaps = 0/139 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKA+K+ID+EHFSVP G+RA+EL+AGKES V QI +T  G+   L+F+VGDA+N
Sbjct  234  GWIIESLKAIKHIDSEHFSVPQGKRAIELIAGKESTVVQIVKTSIGRNYLLSFVVGDANN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M++EAFAG + + V Y SKG+GG+K A+L FRA + RTR+ F+ST Y  +SD+  
Sbjct  294  GCEGPMMVEAFAGKNMVMVSYNSKGKGGFKAARLAFRAESTRTRITFYSTIYTIKSDNSG  353

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPV+D VKL+SVR  H
Sbjct  354  SLCGPVLDDVKLLSVRKLH  372



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   178 bits (451),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID+ HF+VP G+RA+ELVAGKESA+ Q+  T  G+   LTF VGD+ N
Sbjct  236  GWIIESLKAVKYIDSTHFAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+V+EAFAG  TLKVPYESKG+GG+K A+L F A    TRVMF ST+Y   +D   
Sbjct  296  ACEGSLVVEAFAGKDTLKVPYESKGKGGFKRARLLFTAVETHTRVMFLSTFYTMSADHSG  355

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  356  SLCGPVIDDVKLLSVR  371



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/136 (63%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HF+VP GRRA+EL+AGKESA+ Q+  T  G+   LTF VGD +N
Sbjct  233  GWIIESLKAVKYIDSKHFAVPEGRRAIELIAGKESALAQVVFTKPGRRYTLTFSVGDGNN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+ +EAFAG  T+KVPYESKG+GG+K A+L F A + RTRVMF ST Y   SD   
Sbjct  293  GCEGSLFIEAFAGKETVKVPYESKGKGGFKKARLFFTAVSPRTRVMFLSTMYTMTSDHSG  352

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+S+R
Sbjct  353  SLCGPVIDDVKLLSIR  368



>ref|NP_001046247.2| Os02g0205200 [Oryza sativa Japonica Group]
 dbj|BAF08161.2| Os02g0205200, partial [Oryza sativa Japonica Group]
Length=365

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+   L+F VGDASN
Sbjct  220  GWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASN  279

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDF  308
             CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD 
Sbjct  280  GCEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDM  339

Query  307  VSLCGPVVDFVKLVSVR  257
             SLCGPV+D V +VSVR
Sbjct  340  SSLCGPVIDDVAVVSVR  356



>gb|EEC72709.1| hypothetical protein OsI_06304 [Oryza sativa Indica Group]
Length=379

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 109/137 (80%), Gaps = 1/137 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKYID++HF+VP GRRAVEL+AG+ESA+ Q+ RTV G+   L+F VGDASN
Sbjct  234  GWMVESLKAVKYIDSDHFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGG-YKPAKLRFRATANRTRVMFFSTYYHTRSDDF  308
             CEGS+V+EA+AG  + +V +ES G+GG  K A L FRA A RTRV+FFS++Y TRSDD 
Sbjct  294  GCEGSLVVEAYAGRESTRVAHESAGRGGAAKRAVLPFRAAAARTRVVFFSSFYSTRSDDM  353

Query  307  VSLCGPVVDFVKLVSVR  257
             SLCGPV+D V +VSVR
Sbjct  354  SSLCGPVIDDVAVVSVR  370



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 108/140 (77%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKA+KYID++ F+VP GRRAVEL+AG+ESA+ Q+ RTV G+   L+F VGDASN
Sbjct  224  GWMVESLKAIKYIDSDSFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYALSFTVGDASN  283

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+++EA+AG  + KV YES G+GG K A L FRA + RTR++FFS++Y TRSDD  
Sbjct  284  ACRGSLMVEAYAGRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLS  343

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            SLCGPV+D V +VSVR   R
Sbjct  344  SLCGPVLDDVAVVSVRTTKR  363



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   177 bits (450),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 104/140 (74%), Gaps = 0/140 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W ++SLKAVKYID++HF VP G+RA+ELV GKES++ QI RT  GK   LTF VGDA N
Sbjct  235  GWIIDSLKAVKYIDSDHFHVPEGKRAIELVGGKESSIAQIVRTEPGKEYVLTFAVGDAKN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+ +EAFAG  T KV Y S G GG+K AKLRF+AT  RTRVMFFST+Y   SD+  
Sbjct  295  SCVGSLGIEAFAGNGTTKVVYVSTGSGGFKRAKLRFKATQWRTRVMFFSTFYTMTSDNSG  354

Query  304  SLCGPVVDFVKLVSVRNPHR  245
            +LCGP +D VKL+SVR P R
Sbjct  355  TLCGPTLDDVKLISVRTPPR  374



>emb|CDO98109.1| unnamed protein product [Coffea canephora]
Length=332

 Score =   176 bits (446),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 104/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D+EHFSVP G+RAVEL+AG+ESA+ QI +T+ G + DL F VGDA N
Sbjct  193  GWIIESLKAVKYVDSEHFSVPEGKRAVELIAGRESAIAQIVKTIPGWWYDLVFSVGDAKN  252

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++EA AG  TL+VPY+S G+G +  A  RFRA + RTRV F S  YH RSD+  
Sbjct  253  GCEGSMLIEASAGKVTLQVPYQSSGKGKFIRATHRFRAVSRRTRVRFLSINYHMRSDNTG  312

Query  304  SLCGPVVDFVKLVSVR  257
            +LCGPV+D V+L S+R
Sbjct  313  TLCGPVIDDVRLYSLR  328



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 85/137 (62%), Positives = 100/137 (73%), Gaps = 0/137 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAVKY+D  HF+VP G RA+ELV GKES+V QI RT   KF  LTF VGDA N
Sbjct  226  GWIVESLKAVKYVDKAHFAVPEGHRAIELVGGKESSVAQIVRTTPNKFYKLTFAVGDAGN  285

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M +EAFAG   + V Y S G+GG KPA+L F+A + RTRV F ST+YHT+SD   
Sbjct  286  SCEGPMAVEAFAGRGRISVDYVSSGKGGSKPARLMFKAISARTRVTFLSTFYHTKSDHSG  345

Query  304  SLCGPVVDFVKLVSVRN  254
            SLCGPV+D V+LV VR+
Sbjct  346  SLCGPVIDDVRLVPVRS  362



>ref|XP_008245331.1| PREDICTED: uncharacterized protein LOC103343457 [Prunus mume]
Length=373

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 104/137 (76%), Gaps = 0/137 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ QI RT+  KF +LTF +GDA N
Sbjct  236  GWIIESLKPVKYIDKKHFSVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVPY S+G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF 
Sbjct  296  ACHGSMMVEAFAGKETLKVPYTSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFG  355

Query  304  SLCGPVVDFVKLVSVRN  254
             +CGPV+D V ++ V +
Sbjct  356  HMCGPVLDNVIVLPVSS  372



>gb|EAY92272.1| hypothetical protein OsI_13995 [Oryza sativa Indica Group]
Length=363

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTVA +  +L+F+VGDA N 
Sbjct  228  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNG  287

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFAG  T KVP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VS
Sbjct  288  CHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVS  347

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+  ++
Sbjct  348  LCGPVLDQVKVQPLK  362



>ref|XP_008231461.1| PREDICTED: uncharacterized protein LOC103330638 [Prunus mume]
Length=454

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 109/135 (81%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ Q+ RTV  K  +L+F+VGDA N
Sbjct  319  GWIIESLKAVKFIDSQHFNVPFGKGAVELVAGRESAIAQVLRTVPNKIYNLSFVVGDARN  378

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+A + RTR+ F+S++YHTR DD+ 
Sbjct  379  GCHGSMMVEAFAGKDTLKVPFTSQGKGGFKAASLKFKAASPRTRITFYSSFYHTRVDDYG  438

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D V++  V
Sbjct  439  ALCGPILDQVRVYPV  453



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 2/139 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAV+YID++HF+VP G+RAVELVAG+ES+V Q+ +TV GK  DL F VGDA N
Sbjct  231  GWMVESLKAVRYIDSDHFAVPEGKRAVELVAGRESSVAQVVKTVPGKDYDLEFYVGDARN  290

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGSM++E  A  ST  VPYESKG+GG K A LRF+A   RTR+ F S+YYH +SD   
Sbjct  291  MCEGSMLVEVNASNSTFYVPYESKGKGGSKLALLRFKAETGRTRIRFLSSYYHMKSDFSG  350

Query  304  SLCGPVVDFVKLVSVRNPH  248
            SLCGPVVD V+L  VR PH
Sbjct  351  SLCGPVVDGVRL--VRVPH  367



>ref|XP_003564086.1| PREDICTED: uncharacterized protein LOC100845370 [Brachypodium 
distachyon]
Length=393

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAV+YIDA HFSVP G  AVELVAG+ESA+ Q+ RTV  +  +++F VGDA N
Sbjct  257  GWIIESLKAVRYIDAAHFSVPSGNYAVELVAGRESAIAQVIRTVPNRAYNVSFAVGDAKN  316

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ES G+GG+K A LRF A   RTRV F+S+YYHT++ D V
Sbjct  317  GCHGSMLVEAFAGNVTLKVPFESAGKGGFKTASLRFVAGGVRTRVTFYSSYYHTKATDGV  376

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VK+  ++
Sbjct  377  SLCGPVLDQVKIQPLK  392



>ref|NP_001051644.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|AAP21410.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99455.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13558.1| Os03g0807700 [Oryza sativa Japonica Group]
 gb|EAZ28993.1| hypothetical protein OsJ_13041 [Oryza sativa Japonica Group]
 dbj|BAG86944.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTVA +  +L+F+VGDA N 
Sbjct  258  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVANRAYNLSFVVGDAKNG  317

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFAG  T KVP+ES G GG+KPA  RF A   RTRV F+S+YYHT+  D VS
Sbjct  318  CHGSMLVEAFAGNVTQKVPFESVGNGGFKPASFRFVAAGVRTRVTFYSSYYHTKVSDGVS  377

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+  ++
Sbjct  378  LCGPVLDQVKVQPLK  392



>ref|XP_008461812.1| PREDICTED: uncharacterized protein LOC103500323 [Cucumis melo]
Length=368

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G  A+ELVAG+ESAV QI RT+  K   L F VGDA N
Sbjct  233  GWIIESLKAVKFIDSKHFNVPDGEAAIELVAGRESAVAQIIRTIPNKVYSLKFKVGDAKN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T+KVP++S+G+G YK A L+F AT+ RTR+ FFS+YYHTR+DDF 
Sbjct  293  GCHGSMMVEAFAAKETVKVPFQSEGKGLYKDAILKFTATSPRTRITFFSSYYHTRTDDFG  352

Query  304  SLCGPVVDFVKL  269
            SLCGPV+D V +
Sbjct  353  SLCGPVLDDVSV  364



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   175 bits (443),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID+ HF+VP G+RA+ELVAGKESA+ Q+  T  G+   LTF VGD+ N
Sbjct  236  GWIIESLKAVKYIDSNHFAVPEGQRAIELVAGKESALAQVVFTKPGRLYALTFSVGDSKN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+V+EAFAG  TLKVPYES G+GG+K A+L F A    TRVMF S++Y   +D   
Sbjct  296  SCEGSLVVEAFAGKDTLKVPYESMGKGGFKRARLLFTAVETHTRVMFLSSFYTMSADHSG  355

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  356  SLCGPVIDDVKLLSVR  371



>ref|XP_007201993.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
 gb|EMJ03192.1| hypothetical protein PRUPE_ppa024647mg [Prunus persica]
Length=384

 Score =   175 bits (443),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 103/137 (75%), Gaps = 0/137 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HF VP G  A+ELVAG+ESA+ QI RT+  KF +LTF +GDA N
Sbjct  247  GWIIESLKPVKYIDKKHFQVPGGLAAIELVAGRESAIAQIIRTIPNKFYNLTFTIGDAKN  306

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVPY S+G+GG+K A  +F+AT+ RTR+ F+S YYHT+  DF 
Sbjct  307  ACHGSMMVEAFAGKETLKVPYMSQGKGGFKTASFKFQATSPRTRITFYSAYYHTKLHDFG  366

Query  304  SLCGPVVDFVKLVSVRN  254
             +CGPV+D V ++ V +
Sbjct  367  HMCGPVLDNVIVLPVSS  383



>ref|XP_007052493.1| F17A17.37 protein [Theobroma cacao]
 gb|EOX96650.1| F17A17.37 protein [Theobroma cacao]
Length=385

 Score =   175 bits (443),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G+ AVELVAG+ESA+ QI RTV  +  DLTF++GDA N
Sbjct  250  GWIIESLKAVKFIDSKHFNVPAGKAAVELVAGRESAIAQILRTVPNQLYDLTFIIGDARN  309

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G M++EAFA  +T+KVP+ S+G+G +K A L+F+A   RTR+ FFS+YYHTR +DF 
Sbjct  310  GCHGEMMVEAFADKNTVKVPFTSRGKGEFKTASLKFKAVTARTRITFFSSYYHTRINDFG  369

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V++  V
Sbjct  370  SLCGPVLDEVRVSPV  384



>ref|XP_010057181.1| PREDICTED: uncharacterized protein LOC104445070 [Eucalyptus grandis]
 gb|KCW90190.1| hypothetical protein EUGRSUZ_A02362 [Eucalyptus grandis]
Length=370

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ES+K VKY+D +HF VP G  AVELVAG+ESA+ QI RTV  KF +LTF VGDA N
Sbjct  235  GWIIESMKPVKYVDRKHFFVPSGLAAVELVAGRESAMAQIIRTVPNKFYNLTFTVGDAKN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   TLKVPYES  +GG K A L+F+AT+ RTR+ FFS YYHT+  D+ 
Sbjct  295  GCHGSMMVEAFAAKDTLKVPYESTSKGGSKTANLKFQATSTRTRITFFSAYYHTKLHDYG  354

Query  304  SLCGPVVDFVKLVSVR  257
             +CGPV+D VK+V V+
Sbjct  355  HMCGPVLDDVKVVPVK  370



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLKAV+Y+D   F+VP GRRAVEL+AG+E AV Q+ RTV G+   L+F VGDA N
Sbjct  235  GWMVESLKAVRYVDGGSFAVPRGRRAVELLAGREGAVAQVVRTVPGRRYALSFTVGDAGN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GS+V+EA+AG  ++KV YES+G+GG + A L FRA A RTR++FFS++Y TRSDD  
Sbjct  295  ACRGSLVVEAYAGRESVKVAYESEGKGGARRAVLPFRAAAARTRIVFFSSFYSTRSDDLS  354

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V +VSVR
Sbjct  355  SLCGPVLDDVAVVSVR  370



>gb|KJB19256.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=307

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HFSVP G  AVELVAG+ESA+ QI RTV  KF  LTF VGDA N
Sbjct  172  GWIIESLKPVKYIDKKHFSVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKN  231

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM+++AFAG  TL+VPY S+G+GG K A  RF+A + RTR+ FFS YYHT+ DD+ 
Sbjct  232  GCHGSMMVQAFAGKETLQVPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYG  291

Query  304  SLCGPVVDFV  275
             +CGPV+D V
Sbjct  292  HICGPVLDDV  301



>dbj|BAJ89665.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=393

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV+YIDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  +  +L+++VGDA N 
Sbjct  258  WIIESLKAVRYIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNG  317

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFA   T KVP+ES G+GG+K + LRF A   RTRV F+S+YYHT+  D VS
Sbjct  318  CHGSMLVEAFAANVTQKVPFESTGKGGFKASSLRFVAAGARTRVTFYSSYYHTKVTDGVS  377

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+V ++
Sbjct  378  LCGPVLDQVKIVPLK  392



>gb|EMT25156.1| hypothetical protein F775_26385 [Aegilops tauschii]
Length=397

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV+YIDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  +  +L+++VGDA N 
Sbjct  262  WIIESLKAVRYIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSYVVGDAKNG  321

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFA   T KVP+ES G+GG+K A LRF A   RTRV F+S+YYHT+  D VS
Sbjct  322  CHGSMLVEAFAANVTQKVPFESTGKGGFKAASLRFVAAGVRTRVTFYSSYYHTKVTDGVS  381

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+V ++
Sbjct  382  LCGPVLDQVKIVPMK  396



>gb|KJB24990.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=385

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT+  K  ++TF++GDA N
Sbjct  250  GWIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARN  309

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G M++EAFA   T+KVP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF 
Sbjct  310  GCNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFG  369

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V++  +
Sbjct  370  SLCGPVLDEVRVYPI  384



>ref|XP_002466246.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
 gb|EER93244.1| hypothetical protein SORBIDRAFT_01g004270 [Sorghum bicolor]
Length=386

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  +  +L+F VGDA N 
Sbjct  251  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNG  310

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFAG  T KVP+ES G+GG+K A  RF A   RTR+ F+S+YYHT+  D VS
Sbjct  311  CHGSMLVEAFAGNVTQKVPFESAGKGGFKAAAFRFVAAGARTRLTFYSSYYHTKVTDGVS  370

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+V V+
Sbjct  371  LCGPVLDQVKVVPVK  385



>ref|XP_006845336.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
 gb|ERN07011.1| hypothetical protein AMTR_s00141p00085330 [Amborella trichopoda]
Length=369

 Score =   173 bits (439),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ES+KAV+Y+D+ HF+VP G  AVELVAG+ESA+ Q+ RTV  K   L+F+VGDA N
Sbjct  235  GWIIESIKAVRYLDSHHFTVPLGAAAVELVAGRESAIAQLIRTVPKKVYTLSFIVGDAKN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  T+KVP+ES+GQGGYK  K+RF A   RTR+ FFS++YHT+ DD  
Sbjct  295  GCHGSMLVEAFAGKDTVKVPFESRGQGGYKVGKMRFMALEPRTRITFFSSFYHTKVDDPG  354

Query  304  SLCGPVVDFVKL  269
            ++CGP+VD VK+
Sbjct  355  TMCGPIVDEVKV  366



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID+ HF+VP G+ AVELVAG+ESA+ QI RTV  K   L+F VGDA N
Sbjct  234  GWIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKVP+ SKG+GG+K A  RF+A + RTR+ FFS+YYHT+  D+ 
Sbjct  294  GCQGSMMVEAFAGKDTLKVPFASKGKGGFKKASFRFKAVSIRTRITFFSSYYHTK--DYG  351

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D VK+  V
Sbjct  352  ALCGPILDEVKVSPV  366



>gb|KJB19257.1| hypothetical protein B456_003G091800 [Gossypium raimondii]
Length=341

 Score =   172 bits (436),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 98/130 (75%), Gaps = 0/130 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HFSVP G  AVELVAG+ESA+ QI RTV  KF  LTF VGDA N
Sbjct  206  GWIIESLKPVKYIDKKHFSVPSGLFAVELVAGRESAIAQIIRTVPNKFYTLTFTVGDAKN  265

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM+++AFAG  TL+VPY S+G+GG K A  RF+A + RTR+ FFS YYHT+ DD+ 
Sbjct  266  GCHGSMMVQAFAGKETLQVPYVSQGKGGLKTASFRFQAISARTRITFFSAYYHTKLDDYG  325

Query  304  SLCGPVVDFV  275
             +CGPV+D V
Sbjct  326  HICGPVLDDV  335



>gb|KJB24991.1| hypothetical protein B456_004G171200 [Gossypium raimondii]
Length=414

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT+  K  ++TF++GDA N
Sbjct  279  GWIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFIIGDARN  338

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G M++EAFA   T+KVP+ S+G+G +K A L F+A   RTRV F+S+YYHTRSDDF 
Sbjct  339  GCNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRVTFYSSYYHTRSDDFG  398

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V++  +
Sbjct  399  SLCGPVLDEVRVYPI  413



>ref|XP_002517797.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44604.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G  AVELVAG+ESA+ QI RT+  K  DLTF VGDA N
Sbjct  230  GWIIESLKAVKFIDSKHFNVPFGLAAVELVAGRESAIAQILRTIPNKVYDLTFSVGDAKN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T KVP+ES+G+G +K     F+A + RTR+ F+S+YYHTR DDF 
Sbjct  290  GCHGSMMVEAFAAKDTFKVPFESQGKGKFKTVSFNFKAVSARTRITFYSSYYHTRIDDFG  349

Query  304  SLCGPVVDFVKL  269
            SLCGPV+D V++
Sbjct  350  SLCGPVLDQVRV  361



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D  HF+VP G RA+ELVAGKESA++QI RT   +F  LTF VGDA +
Sbjct  230  GWIIESLKAVKYVDKAHFAVPEGHRAIELVAGKESAISQIVRTSLNQFYALTFNVGDARD  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M++EAFAG S + V Y SKG+GG+   KL F+A + RTRV F ST+YH +SD   
Sbjct  290  TCEGPMIVEAFAGRSKIMVDYVSKGKGGFTQGKLVFKAVSTRTRVTFLSTFYHMKSDHSG  349

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V+LV++R
Sbjct  350  SLCGPVIDDVRLVAIR  365



>ref|XP_011016219.1| PREDICTED: uncharacterized protein LOC105119742 [Populus euphratica]
Length=369

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID++HF VP G  A+E+VAG+ESA+ QI RT+  KF +L+F +GDA N
Sbjct  234  GWIIESLKPVKYIDSKHFFVPTGFAAIEMVAGRESAIAQIIRTIPNKFYNLSFTIGDAKN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVPY S+G+GGYK A LRF+A ++RTR+ F+S YYHT+  D+ 
Sbjct  294  ACHGSMMVEAFAGRETLKVPYVSRGKGGYKTATLRFKAISSRTRITFYSGYYHTKLHDYG  353

Query  304  SLCGPVVDFVKL  269
             +CGPV+D V++
Sbjct  354  HMCGPVLDDVRV  365



>gb|KHG12815.1| DNA-directed RNA polymerase subunit beta'' [Gossypium arboreum]
Length=385

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT+  K  ++TF++GDA N
Sbjct  250  GWIIESLKAVKFIDAKHFNVPAGHSAVELVAGRESAIAQILRTIPNKSYNMTFVIGDARN  309

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G M++EAFA   T+KVP+ S+G+G +K A L F+A   RTR+ F+S+YYHTRSDDF 
Sbjct  310  GCNGEMMVEAFAAKHTVKVPFTSRGKGEFKAASLMFKADTARTRITFYSSYYHTRSDDFG  369

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V++  +
Sbjct  370  SLCGPVLDEVRVYPI  384



>ref|XP_010067858.1| PREDICTED: uncharacterized protein LOC104454644 [Eucalyptus grandis]
 gb|KCW66091.1| hypothetical protein EUGRSUZ_G03366 [Eucalyptus grandis]
Length=369

 Score =   172 bits (436),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 106/135 (79%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ Q+ RT+  K  +LTF VGDA N
Sbjct  232  GWIIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQMIRTLPSKCYNLTFAVGDARN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   TLKVP++S+G+G +K A L+F+A + RTR+ FFS++YHTR DDF 
Sbjct  292  GCHGSMMVEAFAAKDTLKVPFQSQGKGRFKTASLKFKALSARTRLTFFSSFYHTRIDDFG  351

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V++V +
Sbjct  352  SLCGPVLDEVRVVPL  366



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 104/136 (76%), Gaps = 1/136 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID++HFSVP G RA+ELV GKESA+ Q+  T+ GK   LTF VGD++N
Sbjct  224  GWIIESLKAVKYIDSKHFSVPEGWRAIELV-GKESALAQVVFTLPGKLYALTFTVGDSNN  282

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEGS+V+EAFAG   LKVPY+SKG+GG+K  +  F A   RTR+MF+ST+Y   +D   
Sbjct  283  ACEGSLVVEAFAGKDILKVPYQSKGRGGFKRXRFLFTAVGPRTRIMFYSTFYTMAADHSG  342

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+SVR
Sbjct  343  SLCGPVIDDVKLLSVR  358



>ref|XP_009354784.1| PREDICTED: uncharacterized protein LOC103945912 [Pyrus x bretschneideri]
 ref|XP_009354785.1| PREDICTED: uncharacterized protein LOC103945913 [Pyrus x bretschneideri]
Length=367

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID+ HF+VP G+ AVELVAG+ESA+ QI RTV  K   L+F VGDA N
Sbjct  234  GWIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKVP+ SKG+GG+K A  RF+A + RTR+ FFS++YHT+  D+ 
Sbjct  294  GCQGSMMVEAFAGKETLKVPFASKGKGGFKKASFRFKAVSIRTRITFFSSFYHTK--DYG  351

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D VK+  V
Sbjct  352  ALCGPILDEVKVSPV  366



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 105/135 (78%), Gaps = 2/135 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKA+K+IDA+HF+VP G+ AVELVAG+ESA+ Q+ RTV  K   L+F VGDA N
Sbjct  234  GWIIESLKAIKFIDAKHFNVPFGKGAVELVAGRESAIAQVLRTVPNKLYSLSFTVGDARN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ SKG+GG+K A  RF+A + RTR+ FFS++YHT+  D+ 
Sbjct  294  GCHGSMMVEAFAGKETLKVPFTSKGKGGFKTASFRFKAVSIRTRITFFSSFYHTK--DYG  351

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D VK+  V
Sbjct  352  ALCGPILDEVKVSPV  366



>gb|KDP43556.1| hypothetical protein JCGZ_16843 [Jatropha curcas]
Length=365

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID++HF+VP G  AVELVAG+ESA+ QI RT+  K   LTF VGDA N
Sbjct  230  GWIIESLKAVKFIDSKHFNVPFGLAAVELVAGRESAIAQILRTIPNKVYGLTFSVGDAKN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T KVP+ES+G+G +K    +F+A + RTR+ F+S+YYHTR DDF 
Sbjct  290  GCHGSMMVEAFAAKDTFKVPFESQGKGKFKTVSFKFKAVSARTRITFYSSYYHTRIDDFG  349

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V++  +
Sbjct  350  SLCGPVLDQVRVFPI  364



>ref|NP_001144239.1| uncharacterized protein LOC100277106 precursor [Zea mays]
 gb|ACG38935.1| hypothetical protein [Zea mays]
Length=390

 Score =   172 bits (435),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  +  +L+F VGDA N 
Sbjct  255  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDARNG  314

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFAG  T KVP++S G+GG+K A  RF A+  RTR+ F+S+YYHT+  D VS
Sbjct  315  CHGSMLVEAFAGNVTQKVPFDSTGKGGFKTAAFRFVASGVRTRLTFYSSYYHTKVTDGVS  374

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+V V+
Sbjct  375  LCGPVLDQVKVVPVK  389



>ref|XP_006411450.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
 gb|ESQ52903.1| hypothetical protein EUTSA_v10016825mg [Eutrema salsugineum]
Length=370

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/136 (58%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLK VKYID  HF+VP G  A+E++AG+ESA+ QI RTVAGK+  L+F+VGDA N
Sbjct  235  GWIVESLKPVKYIDNGHFNVPSGHAAIEIIAGRESAIAQIIRTVAGKYYILSFVVGDAHN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG ST K+ +ES G+G  K  + RFRA +NRTR+ F+S +YHT+  DF 
Sbjct  295  GCHGSMMVEAFAGRSTFKLRFESNGKGAVKVGRFRFRADSNRTRITFYSGFYHTKLHDFG  354

Query  304  SLCGPVVDFVKLVSVR  257
             LCGPV+D V++V  R
Sbjct  355  HLCGPVLDNVRVVMTR  370



>gb|KDP26060.1| hypothetical protein JCGZ_21093 [Jatropha curcas]
Length=370

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ Q+ RTVA KF +LTF +GDA N
Sbjct  234  GWIIESLKPVKYIDNKHFSVPSGFAAIELVAGRESALAQVIRTVANKFYNLTFTIGDAKN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV+EAFA   TLKVP+ES+ +G +K A  +F+A +NRTR+ F+S  YHT+  DF 
Sbjct  294  GCHGSMVVEAFAAKETLKVPFESQSKGEFKTASFKFQAISNRTRITFYSANYHTKLHDFG  353

Query  304  SLCGPVVDFVKLVSVR  257
             +CGP++D V +  +R
Sbjct  354  HMCGPILDNVSVFPIR  369



>gb|AFK44456.1| unknown [Lotus japonicus]
Length=177

 Score =   165 bits (418),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP G  AVELVAG+ESA+ QI RT A K  ++TF VGDA N
Sbjct  42   GWIIESLKAVKFIDAKHFNVPFGLGAVELVAGRESAIAQIIRTEANKVYNITFSVGDAKN  101

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T KVP++S G+G +      F+A A RTR+ F+S+YYHTR+DDF 
Sbjct  102  GCHGSMMVEAFAAKDTFKVPFKSVGKGKFVTVSFEFKAIAPRTRLTFYSSYYHTRTDDFG  161

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V +  V
Sbjct  162  SLCGPVLDRVIVFPV  176



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 103/136 (76%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID +HFSVP GRRAVELVAGKESA+TQ+ +T   K   L+F VGDA N
Sbjct  232  GWIIESLKAVKYIDLKHFSVPEGRRAVELVAGKESALTQVVKTEVNKTYALSFAVGDAGN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G++ +EA+AG   +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD   
Sbjct  292  GCAGTLGVEAYAGRDNVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSG  351

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D VKL+  R
Sbjct  352  SLCGPVIDDVKLLVAR  367



>ref|XP_004981346.1| PREDICTED: uncharacterized protein LOC101768647 [Setaria italica]
Length=389

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  +  +L+F VGDA N 
Sbjct  252  WIIESLKAVRFIDAAHFSVPEGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDAKNG  311

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFAG  T KVP+ES G+G +K A  RF A+  RTR+ F+S+YYHT++ D VS
Sbjct  312  CHGSMLVEAFAGNVTQKVPFESAGKGAFKAAGFRFVASGVRTRLTFYSSYYHTKASDGVS  371

Query  301  LCGPVVDFVKLVSV  260
            LCGPV+D VK+V +
Sbjct  372  LCGPVLDQVKVVPL  385



>ref|XP_011048055.1| PREDICTED: uncharacterized protein LOC105142230 [Populus euphratica]
Length=365

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID++HF VP G  A+ELVAG+ESAV QI RT+  KF +LTF VGDA N
Sbjct  230  GWIIESLKPVKYIDSKHFFVPEGFAAIELVAGRESAVAQIIRTIPDKFYNLTFTVGDAKN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T+KVPY S+G+GGYK A LRF+A + RTR+ F+S YYHT+  D+ 
Sbjct  290  ACHGSMMVEAFAAKETVKVPYVSQGKGGYKTAILRFQAISARTRITFYSAYYHTKLHDYG  349

Query  304  SLCGPVVDFVKL  269
             +CGPV+D V +
Sbjct  350  HMCGPVLDDVSV  361



>ref|XP_002299934.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
 gb|ABK94155.1| unknown [Populus trichocarpa]
 gb|EEE84739.2| hypothetical protein POPTR_0001s27110g [Populus trichocarpa]
Length=365

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ QI RT+  K   LTF VGDA N
Sbjct  230  GWMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTVGDARN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF 
Sbjct  290  GCHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFG  349

Query  304  SLCGPVVDFVKLVSV  260
            SLCGP++D V++  +
Sbjct  350  SLCGPILDEVRVFPI  364



>gb|KJB36028.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36029.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
 gb|KJB36030.1| hypothetical protein B456_006G137000 [Gossypium raimondii]
Length=371

 Score =   170 bits (431),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 102/135 (76%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VK+ID +HFSVP G+ A+E+VAG+ESA+ Q+ RTV  K   LTF VGDA N
Sbjct  236  GWIIESLKPVKFIDKKHFSVPSGQFAIEMVAGRESAIAQVIRTVPNKDYTLTFTVGDAKN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVPY S+G+GG+K +  RF+A + RTR+ F+S YYHT+  DF 
Sbjct  296  DCHGSMMVEAFAGKGTLKVPYVSQGKGGFKTSSFRFQAISARTRITFYSAYYHTKLHDFG  355

Query  304  SLCGPVVDFVKLVSV  260
             +CGPV+D VK++ V
Sbjct  356  HMCGPVLDDVKVLPV  370



>tpg|DAA52069.1| TPA: hypothetical protein ZEAMMB73_133538 [Zea mays]
Length=390

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  661  WTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNK  482
            W +ESLKAV++IDA HFSVP G+ AVELVAG+ESA+ Q+ RTV  +  +L+F VGDA N 
Sbjct  255  WIIESLKAVRFIDAAHFSVPAGQYAVELVAGRESAIAQVIRTVPNRAYNLSFAVGDARNG  314

Query  481  CEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVS  302
            C GSM++EAFAG  T KVP++S G+GG+K A  RF A   RTR+ F+S+YYHT+  D VS
Sbjct  315  CHGSMLVEAFAGNVTQKVPFDSAGKGGFKTAAFRFVAGGVRTRLTFYSSYYHTKVTDGVS  374

Query  301  LCGPVVDFVKLVSVR  257
            LCGPV+D VK+V V+
Sbjct  375  LCGPVLDQVKVVPVK  389



>ref|XP_002308027.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
 gb|EEE91550.2| hypothetical protein POPTR_0006s04880g [Populus trichocarpa]
Length=369

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HF VP G  A+E+VAG+ESA+ Q+ RT+  KF +LTF +GDA N
Sbjct  234  GWIIESLKPVKYIDNKHFFVPTGFAAIEMVAGRESAIAQVIRTIPDKFYNLTFTIGDAKN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   TLKVPY S+G+GGYK A LRFRA + RTR+ F+S YYHT+  D+ 
Sbjct  294  ACHGSMMVEAFAARETLKVPYVSQGKGGYKTATLRFRAISARTRITFYSAYYHTKLHDYG  353

Query  304  SLCGPVVDFVKL  269
             +CGPV+D V++
Sbjct  354  HMCGPVLDDVRV  365



>ref|XP_011047367.1| PREDICTED: uncharacterized protein LOC105141733 [Populus euphratica]
Length=365

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ QI RT+  K   LTF +GDA N
Sbjct  230  GWMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF 
Sbjct  290  GCHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFG  349

Query  304  SLCGPVVDFVKLVSV  260
            SLCGP++D V++  +
Sbjct  350  SLCGPILDEVRVFPI  364



>emb|CDP07813.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 102/136 (75%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA HF+VP GR A+EL+ G+ES + QI RTV  K  +LTF VGD  N
Sbjct  241  GWIIESLKAVKFIDAMHFNVPSGRAAIELLGGRESVIAQIIRTVPNKEYNLTFSVGDGKN  300

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA  STLKVP++S G+G YK    +F A + RTR+ FFS++YHT+ DD+ 
Sbjct  301  GCHGSMMVEAFAAKSTLKVPFQSVGKGQYKTVSFKFTAISARTRLTFFSSFYHTKIDDYG  360

Query  304  SLCGPVVDFVKLVSVR  257
            +LCGPV+D VK+V+ R
Sbjct  361  ALCGPVLDNVKVVTAR  376



>gb|KHG07966.1| Imidazolonepropionase [Gossypium arboreum]
Length=371

 Score =   170 bits (430),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VK+ID +HFSVP G+ A+E+VAG+ESA+ Q+ RT   K   LTF VGDA N
Sbjct  236  GWIIESLKPVKFIDKKHFSVPSGQFAIEMVAGRESAIAQVIRTAPNKDYTLTFTVGDAKN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVPY S+G+GG+K A  RF+A + RTR+ F+S YYHT+  DF 
Sbjct  296  DCHGSMMVEAFAGKGTLKVPYVSQGKGGFKTASFRFQAISARTRITFYSAYYHTKLHDFG  355

Query  304  SLCGPVVDFVKLVSV  260
             +CGPV+D VK++ V
Sbjct  356  HMCGPVLDDVKVLPV  370



>ref|XP_011013325.1| PREDICTED: uncharacterized protein LOC105117377 [Populus euphratica]
Length=365

 Score =   170 bits (430),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID +HF+VP G  AVELVAG+ESA+ QI RT+  K   LTF +GDA N
Sbjct  230  GWMIESLKAVKFIDKKHFNVPFGLAAVELVAGRESAIAQILRTIPDKVYGLTFTIGDARN  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T KVP+ESKG+G +K    +F+A   RTR+ F+S+YYHTR DDF 
Sbjct  290  GCHGSMMVEAFAAKDTFKVPFESKGKGEFKTVSFKFKAVTARTRITFYSSYYHTRIDDFG  349

Query  304  SLCGPVVDFVKLVSV  260
            SLCGP++D V++  +
Sbjct  350  SLCGPILDEVRVFPI  364



>ref|XP_002276894.1| PREDICTED: uncharacterized protein LOC100258445 [Vitis vinifera]
Length=368

 Score =   169 bits (429),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 102/138 (74%), Gaps = 0/138 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID +HF+VP G  AVEL+AG+ESA+ Q+ RTV  K  +LTF +GD  N
Sbjct  231  GWIIESLKAVKFIDKKHFNVPFGLAAVELLAGRESAIAQVLRTVPNKLYNLTFSIGDGKN  290

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G M++EAFA   + K P++S+G+G +K    +F+A A RTR+ FFS++YHTR DDF 
Sbjct  291  GCHGDMMIEAFAAKDSFKAPFKSRGKGEFKTVSFKFKAIAARTRLTFFSSFYHTRIDDFG  350

Query  304  SLCGPVVDFVKLVSVRNP  251
            SLCGPV+D V++ S+R P
Sbjct  351  SLCGPVLDQVRVFSIRKP  368



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 104/135 (77%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             WT+ SLK+V+YID+ HFSVP GR+AVEL+AGKES ++Q A TV   +  LTFLVGDA+N
Sbjct  232  GWTILSLKSVRYIDSPHFSVPEGRKAVELLAGKESIISQTATTVPKAYYVLTFLVGDANN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM +EA+AG  +LKV YESKG GG+K AKL F A    TR +F+ST+Y TR+DD  
Sbjct  292  TCKGSMAVEAYAGRGSLKVDYESKGLGGFKRAKLVFVALEKVTRFVFYSTFYMTRTDDLS  351

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V+LV +
Sbjct  352  SLCGPVIDDVRLVPL  366



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 100/136 (74%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D  HF+VP G RA+ELV GKESA++QI RT   KF  LTF VGDA +
Sbjct  232  GWMIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFSVGDARD  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M +EAFAG   + V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD   
Sbjct  292  GCEGPMTVEAFAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSG  351

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D V+LV+VR
Sbjct  352  SLCGPVIDDVRLVAVR  367



>gb|ACL52831.1| unknown [Zea mays]
Length=138

 Score =   161 bits (408),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 96/122 (79%), Gaps = 0/122 (0%)
 Frame = -3

Query  655  VESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASNKCE  476
            VESLKA+KYID E F+VP GRRAVEL+AG+ESA+ Q+ RTV G+   L+F +GDASN C 
Sbjct  2    VESLKAIKYIDGESFAVPRGRRAVELLAGRESAIAQVIRTVPGRQYVLSFTIGDASNACR  61

Query  475  GSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFVSLC  296
            GS+++EA+AG  + KV YES G+GG K A L FRA + RTR++FFS++Y TRSDD  SLC
Sbjct  62   GSLMVEAYAGRESTKVAYESAGKGGVKRAVLPFRAASARTRLVFFSSFYSTRSDDLSSLC  121

Query  295  GP  290
            GP
Sbjct  122  GP  123



>ref|XP_002308942.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
 gb|EEE92465.2| hypothetical protein POPTR_0006s04890g [Populus trichocarpa]
Length=373

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID++HF VP G  A+ELVAG+ESA+ Q+ RT+  KF +LTF VGDA N
Sbjct  238  GWIIESLKPVKYIDSKHFFVPEGFAAIELVAGRESAIAQVIRTIPDKFYNLTFTVGDAKN  297

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   T+KVPY S+G+GGYK A LRF+A + RTR+ F+S YYH +  D+ 
Sbjct  298  ACHGSMMVEAFAAKETVKVPYVSQGKGGYKTAILRFQAVSARTRITFYSAYYHNKQHDYG  357

Query  304  SLCGPVVDFVKL  269
             +CGPV+D V +
Sbjct  358  HMCGPVLDDVSV  369



>ref|XP_010695068.1| PREDICTED: uncharacterized protein LOC104907775 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID  HF+VP GR A+ELVAG+ESA+ Q+ RTV  K  +LTF +GDA N
Sbjct  233  GWVIESLKAVKYIDKRHFNVPFGRSAIELVAGRESAIAQVIRTVPNKVYNLTFTIGDAKN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLK P+ S+G G ++   ++F+A ++RTR+ FFS+YYH+++D F 
Sbjct  293  SCKGSMLVEAFAGRDTLKAPFLSQGLGKFQTVSMKFKAISDRTRITFFSSYYHSKADGFG  352

Query  304  SLCGPVVDFVKL  269
             LCGPV+D V++
Sbjct  353  ILCGPVLDEVRV  364



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 104/135 (77%), Gaps = 2/135 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+ID+ HF+VP G+ AVELVAG+ESA+ QI RTV  K   L+F VGDA N
Sbjct  234  GWIIESLKAVKFIDSNHFNVPVGKGAVELVAGRESAIAQIIRTVPNKLYSLSFTVGDARN  293

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C+GSM++EAFAG  TLKVP+ SKG+ G+K A  RF+A + RTR+ FFS++YHT+  D+ 
Sbjct  294  GCQGSMMVEAFAGKDTLKVPFASKGKCGFKKASFRFKAVSIRTRITFFSSFYHTK--DYG  351

Query  304  SLCGPVVDFVKLVSV  260
            +LCGP++D VK+  V
Sbjct  352  ALCGPILDEVKVSPV  366



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   168 bits (425),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D  HF+VP G RA+ELV GKESA++QI RT   KF  LTF VGDA +
Sbjct  231  GWMIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSLNKFYALTFNVGDARD  290

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M++EAFAG   + V Y SKG+GG++  +L F+A + RTRV F ST+YH +SD   
Sbjct  291  GCEGPMIVEAFAGQGKVMVDYASKGKGGFRRGRLVFKAVSARTRVTFLSTFYHMKSDHSG  350

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V+LV+V
Sbjct  351  SLCGPVIDDVRLVAV  365



>ref|XP_008392232.1| PREDICTED: uncharacterized protein LOC103454416 [Malus domestica]
Length=366

 Score =   167 bits (424),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HF+VP G  A+ELVAG+ESA+ QI RTV  K  +L F +GDA N
Sbjct  231  GWIIESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKN  290

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ S G+GG+K A L+F+AT+ RTR+ F+S YYHT+ DD+ 
Sbjct  291  GCHGSMMVEAFAGKETLKVPFVSAGKGGFKTAILKFQATSFRTRLTFYSAYYHTKLDDYG  350

Query  304  SLCGPVVDFVKLVSV  260
             +CGPV+D V +  V
Sbjct  351  HMCGPVLDNVIVFPV  365



>ref|XP_003534397.1| PREDICTED: uncharacterized protein LOC100812299 [Glycine max]
Length=367

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP G+ AVEL+AG+ES + QI RTV  K  ++ F +GDA N
Sbjct  232  GWMIESLKAVKFIDAKHFNVPFGQGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDARN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   TLKVP++S+G+G +K    +FRA  NRTR+ F+S++YHTR  D+ 
Sbjct  292  GCHGSMMIEAFAAKDTLKVPFKSEGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDYG  351

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V +  V
Sbjct  352  SLCGPVIDQVIVYPV  366



>gb|KHN11697.1| hypothetical protein glysoja_006150 [Glycine soja]
Length=367

 Score =   167 bits (423),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/135 (56%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVK+IDA+HF+VP G+ AVEL+AG+ES + QI RTV  K  ++ F +GDA N
Sbjct  232  GWMIESLKAVKFIDAKHFNVPFGQGAVELIAGRESVIAQILRTVPNKIYNMKFTIGDARN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFA   TLKVP++S+G+G +K    +FRA  NRTR+ F+S++YHTR  D+ 
Sbjct  292  GCHGSMMIEAFAAKDTLKVPFKSEGKGEFKTVSFKFRAIENRTRITFYSSFYHTRIHDYG  351

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V +  V
Sbjct  352  SLCGPVIDQVIVYPV  366



>ref|XP_009379646.1| PREDICTED: uncharacterized protein LOC103968043 [Pyrus x bretschneideri]
Length=576

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 101/135 (75%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ Q  RTV  KF +L F VGDA N
Sbjct  440  GWIIESLKPVKYIDRKHFSVPKGLAAIELVAGRESAIAQTIRTVPNKFYNLIFTVGDAKN  499

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ S+G+GG+K A L+F+AT+ RTR+ F+S YYHT+  D+ 
Sbjct  500  GCHGSMMVEAFAGKETLKVPFVSEGKGGFKTAILKFQATSMRTRLTFYSAYYHTKLHDYG  559

Query  304  SLCGPVVDFVKLVSV  260
             LCGPV+D V +  V
Sbjct  560  HLCGPVLDNVIVFPV  574



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 101/133 (76%), Gaps = 0/133 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKYID +HF VP GRRA+ELVAGKESA+TQ+ +T   K   L+F VGDA N
Sbjct  232  GWIIESLKAVKYIDLKHFFVPEGRRAIELVAGKESALTQVVKTEVNKTYALSFAVGDAGN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C G++ +EA+AG   +KV Y SKG+GG+K A LRF+A + RTR+MF ST+Y+ +SD   
Sbjct  292  GCAGTLGVEAYAGRENVKVTYASKGKGGFKKALLRFKAVSPRTRIMFLSTFYNMQSDSSG  351

Query  304  SLCGPVVDFVKLV  266
            SLCGPV+D VKL+
Sbjct  352  SLCGPVIDDVKLL  364



>ref|XP_009355525.1| PREDICTED: uncharacterized protein LOC103946533 [Pyrus x bretschneideri]
Length=367

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/135 (58%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLK VKYID +HF+VP G  A+ELVAG+ESA+ QI RTV  K  +L F +GDA N
Sbjct  232  GWIVESLKPVKYIDRKHFAVPRGLAAIELVAGRESAIAQIIRTVPNKSYNLIFTIGDAKN  291

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLK P+ S G+GG+K A L+F+AT+ RTR+ F+S YYHT+ DD+ 
Sbjct  292  GCHGSMMVEAFAGKETLKAPFVSAGKGGFKTAILKFQATSIRTRLTFYSAYYHTKLDDYG  351

Query  304  SLCGPVVDFVKLVSV  260
             +CGPV+D V +  V
Sbjct  352  HMCGPVLDNVIVFPV  366



>dbj|BAD52536.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD61499.1| unknown protein [Oryza sativa Japonica Group]
Length=299

 Score =   164 bits (416),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 99/136 (73%), Gaps = 2/136 (1%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
            AW + S KAVKY+DA HF+VP G RAVELV GKESA+ Q  RTV G    L+F VGDA +
Sbjct  156  AWMIMSSKAVKYVDAAHFAVPQGARAVELVGGKESALVQEVRTVPGWTYRLSFAVGDARD  215

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSMV EA+A  +++KVPYESKG GGYK A L F A ANRTRV+F ST+YHT +D   
Sbjct  216  GCAGSMVAEAYAARASIKVPYESKGTGGYKRAVLEFAAIANRTRVVFQSTFYHTMTDG--  273

Query  304  SLCGPVVDFVKLVSVR  257
            SLCGPV+D   LV +R
Sbjct  274  SLCGPVIDDASLVGLR  289



>ref|XP_007028767.1| F17A17.37 protein [Theobroma cacao]
 gb|EOY09269.1| F17A17.37 protein [Theobroma cacao]
Length=368

 Score =   166 bits (421),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/135 (57%), Positives = 100/135 (74%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID +HFSVP G  A+ELVAG+ESA+ Q+ RTV  KF  L F VGDA N
Sbjct  233  GWIIESLKPVKYIDKKHFSVPSGLYAIELVAGRESAMAQVIRTVPNKFYTLAFTVGDAKN  292

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG  TLKVP+ S+G+G +K A  +F+A + RTR+ F+S YYHT+  DF 
Sbjct  293  GCHGSMMVEAFAGKETLKVPFVSQGKGVFKTASFKFQAISARTRITFYSAYYHTKLHDFG  352

Query  304  SLCGPVVDFVKLVSV  260
             +CGPV+D V+++ V
Sbjct  353  HMCGPVLDDVRVLPV  367



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D  HF+VP G RA+ELVAGKESA++QI RT   KF  LTF VGDA +
Sbjct  230  GWIIESLKAVKYVDKAHFAVPEGHRAIELVAGKESAISQIVRTSVNKFYALTFNVGDARD  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M +EA AG     V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   
Sbjct  290  GCEGPMTVEALAGRGKAMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSG  349

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V+LV+V
Sbjct  350  SLCGPVIDDVRLVAV  364



>ref|XP_009142779.1| PREDICTED: uncharacterized protein LOC103866589 [Brassica rapa]
Length=370

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLK VKYID+ HF VP G  AVELVAG+ESA+ QI RTVAG+   L+F VGDA N
Sbjct  235  GWIIESLKPVKYIDSRHFEVPSGLAAVELVAGRESAIAQIIRTVAGRNYMLSFAVGDAQN  294

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG +  K+ +ES G+G +K  + RFRA +NRTR+ F+S +YHT+  DF 
Sbjct  295  GCHGSMMVEAFAGKAAFKLRFESNGKGAFKVGRFRFRADSNRTRLTFYSGFYHTKLHDFG  354

Query  304  SLCGPVVDFVKLVSVR  257
             LCGPV+D V +V  R
Sbjct  355  HLCGPVLDSVSVVMTR  370



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 98/135 (73%), Gaps = 0/135 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D  HF+VP G RA+ELV GKESA++QI RT   KF  LTF VGDA +
Sbjct  230  GWIIESLKAVKYVDKAHFAVPEGHRAIELVGGKESAISQIVRTSVNKFYALTFNVGDARD  289

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M++EA AG     V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   
Sbjct  290  GCEGPMIVEALAGRGKTMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSG  349

Query  304  SLCGPVVDFVKLVSV  260
            SLCGPV+D V+LV+V
Sbjct  350  SLCGPVIDGVRLVAV  364



>ref|XP_006296392.1| hypothetical protein CARUB_v10025565mg [Capsella rubella]
 gb|EOA29290.1| hypothetical protein CARUB_v10025565mg [Capsella rubella]
Length=371

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 77/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W VESLK VKYID  HF VP G  A+E+VAG+ESA+ QI RTVAG+   L+F+VGDA N
Sbjct  236  GWIVESLKPVKYIDNRHFKVPSGLAAIEIVAGRESAIAQIIRTVAGRNYILSFVVGDAHN  295

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             C GSM++EAFAG +  KV ++S GQG +K  +  FRA +NRTR+ F+S +YHT+  DF 
Sbjct  296  GCHGSMMVEAFAGKAAFKVKFDSNGQGAFKAGRFAFRADSNRTRITFYSGFYHTKLHDFG  355

Query  304  SLCGPVVDFVKLVSVR  257
             LCGPV+D V++V  R
Sbjct  356  HLCGPVLDNVRVVLAR  371



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/136 (57%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = -3

Query  664  AWTVESLKAVKYIDAEHFSVPHGRRAVELVAGKESAVTQIARTVAGKFXDLTFLVGDASN  485
             W +ESLKAVKY+D  HF VP G+RA+ELV GKESA++QI RT       LTF VGDA +
Sbjct  239  GWIIESLKAVKYVDKAHFYVPEGQRAIELVGGKESAISQIVRTSVNNLYSLTFNVGDARD  298

Query  484  KCEGSMVLEAFAGPSTLKVPYESKGQGGYKPAKLRFRATANRTRVMFFSTYYHTRSDDFV  305
             CEG M++EAFAG   + V Y SKG+GG+K  +L F+A + RTRV F ST+YH +SD   
Sbjct  299  GCEGPMMVEAFAGGRKIMVDYASKGKGGFKRGRLVFKAASARTRVTFLSTFYHMKSDHSG  358

Query  304  SLCGPVVDFVKLVSVR  257
            S+CGPV+D V+LV+VR
Sbjct  359  SMCGPVIDDVRLVAVR  374



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1050626367960