BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036P15

Length=660
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349290.1|  PREDICTED: uncharacterized protein LOC102579219    298   4e-96   Solanum tuberosum [potatoes]
ref|XP_004230423.1|  PREDICTED: uncharacterized protein LOC101259085    294   1e-94   Solanum lycopersicum
ref|XP_011092268.1|  PREDICTED: uncharacterized protein LOC105172507    294   1e-93   Sesamum indicum [beniseed]
gb|KJB08617.1|  hypothetical protein B456_001G093200                    290   4e-93   Gossypium raimondii
ref|XP_002528868.1|  conserved hypothetical protein                     284   3e-92   
ref|XP_007022850.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    286   1e-91   Theobroma cacao [chocolate]
gb|KFK43315.1|  hypothetical protein AALP_AA1G108500                    285   4e-91   Arabis alpina [alpine rockcress]
ref|XP_002268014.1|  PREDICTED: uncharacterized protein LOC100250508    283   8e-91   Vitis vinifera
ref|XP_006417483.1|  hypothetical protein EUTSA_v10007760mg             284   1e-90   Eutrema salsugineum [saltwater cress]
ref|XP_008452226.1|  PREDICTED: uncharacterized protein LOC103493...    283   1e-90   Cucumis melo [Oriental melon]
ref|XP_008452225.1|  PREDICTED: uncharacterized protein LOC103493...    283   2e-90   Cucumis melo [Oriental melon]
emb|CBI29648.3|  unnamed protein product                                283   2e-90   Vitis vinifera
ref|NP_172499.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    283   2e-90   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892557.1|  predicted protein                                  283   2e-90   Arabidopsis lyrata subsp. lyrata
emb|CDY31036.1|  BnaA08g25860D                                          282   3e-90   Brassica napus [oilseed rape]
emb|CDX93443.1|  BnaA06g06050D                                          282   4e-90   
ref|XP_010490870.1|  PREDICTED: uncharacterized protein LOC104768...    282   6e-90   Camelina sativa [gold-of-pleasure]
ref|XP_009144462.1|  PREDICTED: uncharacterized protein LOC103868...    282   7e-90   Brassica rapa
ref|XP_010273586.1|  PREDICTED: uncharacterized protein LOC104609074    282   8e-90   Nelumbo nucifera [Indian lotus]
ref|XP_009144461.1|  PREDICTED: uncharacterized protein LOC103868...    282   8e-90   Brassica rapa
emb|CDY20644.1|  BnaC08g14140D                                          281   1e-89   Brassica napus [oilseed rape]
ref|XP_009148352.1|  PREDICTED: uncharacterized protein LOC103871798    281   1e-89   Brassica rapa
ref|XP_010475888.1|  PREDICTED: uncharacterized protein LOC104755237    281   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010490863.1|  PREDICTED: uncharacterized protein LOC104768...    281   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010458365.1|  PREDICTED: uncharacterized protein LOC104739637    281   1e-89   Camelina sativa [gold-of-pleasure]
ref|XP_006385195.1|  hypothetical protein POPTR_0003s00960g             280   2e-89   Populus trichocarpa [western balsam poplar]
ref|XP_006303228.1|  hypothetical protein CARUB_v10012092mg             281   2e-89   Capsella rubella
ref|XP_011047853.1|  PREDICTED: uncharacterized protein LOC105142093    280   2e-89   Populus euphratica
emb|CDX94911.1|  BnaC05g07600D                                          280   3e-89   
gb|KDP42488.1|  hypothetical protein JCGZ_00285                         280   3e-89   Jatropha curcas
gb|KHN39690.1|  hypothetical protein glysoja_020768                     275   5e-89   Glycine soja [wild soybean]
ref|XP_004134258.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    278   1e-88   
ref|XP_004163997.1|  PREDICTED: uncharacterized LOC101215808            278   2e-88   
ref|XP_010065247.1|  PREDICTED: uncharacterized protein LOC104452469    278   2e-88   Eucalyptus grandis [rose gum]
ref|XP_004503749.1|  PREDICTED: uncharacterized protein LOC101509...    276   2e-88   Cicer arietinum [garbanzo]
emb|CAN60261.1|  hypothetical protein VITISV_020168                     278   4e-88   Vitis vinifera
ref|XP_010682059.1|  PREDICTED: uncharacterized protein LOC104896962    278   6e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007148589.1|  hypothetical protein PHAVU_006G221200g             276   6e-88   Phaseolus vulgaris [French bean]
ref|XP_006598780.1|  PREDICTED: uncharacterized protein LOC100796...    276   9e-88   Glycine max [soybeans]
gb|ABE91847.1|  Protein of unknown function DUF266, plant               277   1e-87   Medicago truncatula
ref|XP_004503748.1|  PREDICTED: uncharacterized protein LOC101509...    276   3e-87   Cicer arietinum [garbanzo]
gb|KHN11046.1|  hypothetical protein glysoja_044070                     272   3e-87   Glycine soja [wild soybean]
ref|XP_008218660.1|  PREDICTED: uncharacterized protein LOC103318965    274   7e-87   
gb|KDO42566.1|  hypothetical protein CISIN_1g039454mg                   267   1e-86   Citrus sinensis [apfelsine]
ref|XP_003540132.1|  PREDICTED: uncharacterized protein LOC100793763    273   1e-86   
ref|XP_007221893.1|  hypothetical protein PRUPE_ppa016090mg             271   5e-86   Prunus persica
ref|XP_009800326.1|  PREDICTED: uncharacterized protein LOC104246...    271   7e-86   Nicotiana sylvestris
ref|XP_009800325.1|  PREDICTED: uncharacterized protein LOC104246...    271   8e-86   Nicotiana sylvestris
ref|XP_009601484.1|  PREDICTED: uncharacterized protein LOC104096770    271   1e-85   Nicotiana tomentosiformis
ref|XP_011028389.1|  PREDICTED: uncharacterized protein LOC105128426    270   2e-85   Populus euphratica
gb|ACU18530.1|  unknown                                                 270   2e-85   Glycine max [soybeans]
ref|XP_006385074.1|  hypothetical protein POPTR_0004s23660g             270   3e-85   Populus trichocarpa [western balsam poplar]
ref|XP_006431491.1|  hypothetical protein CICLE_v10001419mg             268   9e-85   Citrus clementina [clementine]
ref|XP_010682058.1|  PREDICTED: uncharacterized protein LOC104896961    270   9e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009791972.1|  PREDICTED: uncharacterized protein LOC104239130    269   1e-84   Nicotiana sylvestris
ref|XP_010553652.1|  PREDICTED: uncharacterized protein LOC104823674    268   2e-84   Tarenaya hassleriana [spider flower]
ref|XP_009414639.1|  PREDICTED: uncharacterized protein LOC103995706    266   5e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399147.1|  PREDICTED: uncharacterized protein LOC103983624    266   8e-84   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS73540.1|  hypothetical protein M569_01216                         267   2e-83   Genlisea aurea
ref|XP_008357658.1|  PREDICTED: uncharacterized protein LOC103421405    265   2e-83   
ref|XP_009355369.1|  PREDICTED: uncharacterized protein LOC103946396    265   3e-83   Pyrus x bretschneideri [bai li]
ref|XP_009410706.1|  PREDICTED: uncharacterized protein LOC103992641    263   1e-82   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006470991.1|  PREDICTED: uncharacterized protein LOC102625...    262   2e-82   Citrus sinensis [apfelsine]
ref|XP_010927836.1|  PREDICTED: uncharacterized protein LOC105049787    262   3e-82   
ref|XP_006836850.1|  hypothetical protein AMTR_s00099p00078200          262   3e-82   Amborella trichopoda
ref|XP_006470990.1|  PREDICTED: uncharacterized protein LOC102625...    261   1e-81   Citrus sinensis [apfelsine]
ref|XP_008812747.1|  PREDICTED: uncharacterized protein LOC103723571    260   2e-81   
ref|XP_010907977.1|  PREDICTED: uncharacterized protein LOC105034483    259   4e-81   Elaeis guineensis
ref|XP_006659748.1|  PREDICTED: uncharacterized protein LOC102714034    258   6e-81   Oryza brachyantha
gb|EYU33292.1|  hypothetical protein MIMGU_mgv1a007588mg                259   7e-81   Erythranthe guttata [common monkey flower]
ref|XP_008775897.1|  PREDICTED: uncharacterized protein LOC103696141    258   8e-81   Phoenix dactylifera
ref|XP_004301567.1|  PREDICTED: uncharacterized protein LOC101308879    259   9e-81   Fragaria vesca subsp. vesca
ref|XP_010099779.1|  hypothetical protein L484_010966                   257   2e-80   Morus notabilis
emb|CDO97644.1|  unnamed protein product                                254   3e-79   Coffea canephora [robusta coffee]
gb|EAZ41277.1|  hypothetical protein OsJ_25784                          251   3e-79   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009411881.1|  PREDICTED: uncharacterized protein LOC103993515    253   6e-79   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ05353.1|  hypothetical protein OsI_27557                          251   8e-78   Oryza sativa Indica Group [Indian rice]
ref|NP_001060819.1|  Os08g0110400                                       251   8e-78   
gb|EMS61782.1|  hypothetical protein TRIUR3_23279                       246   3e-77   Triticum urartu
ref|XP_002444900.1|  hypothetical protein SORBIDRAFT_07g001090          249   4e-77   Sorghum bicolor [broomcorn]
ref|XP_004972466.1|  PREDICTED: uncharacterized protein LOC101769924    248   1e-76   Setaria italica
ref|XP_003573284.1|  PREDICTED: uncharacterized protein LOC100833185    248   1e-76   Brachypodium distachyon [annual false brome]
ref|NP_001143222.1|  uncharacterized protein LOC100275738               247   3e-76   Zea mays [maize]
ref|NP_001143215.1|  uncharacterized protein LOC100275720               247   4e-76   
emb|CAH67921.1|  OSIGBa0138E08-OSIGBa0161L23.2                          236   5e-72   Oryza sativa [red rice]
ref|NP_001052347.1|  Os04g0272400                                       236   5e-72   
ref|XP_009341368.1|  PREDICTED: uncharacterized protein LOC103933398    234   3e-71   Pyrus x bretschneideri [bai li]
ref|XP_008786440.1|  PREDICTED: uncharacterized protein LOC103704...    230   3e-71   Phoenix dactylifera
ref|XP_008786439.1|  PREDICTED: uncharacterized protein LOC103704...    230   6e-70   Phoenix dactylifera
ref|XP_008786442.1|  PREDICTED: uncharacterized protein LOC103704784    227   8e-70   
ref|XP_010916432.1|  PREDICTED: uncharacterized protein LOC105041249    230   9e-70   Elaeis guineensis
ref|XP_008377912.1|  PREDICTED: uncharacterized protein LOC103440993    223   2e-69   
ref|XP_010453221.1|  PREDICTED: uncharacterized protein LOC104735185    227   7e-69   Camelina sativa [gold-of-pleasure]
ref|XP_009415010.1|  PREDICTED: uncharacterized protein LOC103995962    227   9e-69   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006286517.1|  hypothetical protein CARUB_v10001158mg             226   1e-68   Capsella rubella
ref|XP_002871492.1|  hypothetical protein ARALYDRAFT_909140             226   2e-68   Arabidopsis lyrata subsp. lyrata
ref|XP_010491917.1|  PREDICTED: uncharacterized protein LOC104769408    226   2e-68   Camelina sativa [gold-of-pleasure]
ref|XP_004141306.1|  PREDICTED: uncharacterized protein LOC101205668    226   3e-68   Cucumis sativus [cucumbers]
ref|NP_196734.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    226   3e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003567325.1|  PREDICTED: uncharacterized protein LOC100845991    226   4e-68   Brachypodium distachyon [annual false brome]
ref|XP_008452696.1|  PREDICTED: uncharacterized protein LOC103493641    225   5e-68   Cucumis melo [Oriental melon]
ref|XP_010419754.1|  PREDICTED: uncharacterized protein LOC104705440    225   6e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010930512.1|  PREDICTED: uncharacterized protein LOC105051676    225   6e-68   
ref|XP_006394845.1|  hypothetical protein EUTSA_v10004382mg             225   6e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006399687.1|  hypothetical protein EUTSA_v10013787mg             224   8e-68   Eutrema salsugineum [saltwater cress]
ref|XP_006355313.1|  PREDICTED: uncharacterized protein LOC102601627    224   9e-68   Solanum tuberosum [potatoes]
ref|XP_004165595.1|  PREDICTED: uncharacterized protein LOC101231487    224   1e-67   
ref|XP_006645101.1|  PREDICTED: uncharacterized protein LOC102713419    224   1e-67   Oryza brachyantha
ref|XP_010519868.1|  PREDICTED: uncharacterized protein LOC104799181    224   2e-67   Tarenaya hassleriana [spider flower]
ref|XP_009763004.1|  PREDICTED: uncharacterized protein LOC104214...    219   2e-67   Nicotiana sylvestris
ref|XP_010942042.1|  PREDICTED: uncharacterized protein LOC105060...    221   2e-67   
ref|XP_009601239.1|  PREDICTED: uncharacterized protein LOC104096562    223   2e-67   Nicotiana tomentosiformis
ref|XP_007222675.1|  hypothetical protein PRUPE_ppa008602mg             221   2e-67   
ref|XP_008795296.1|  PREDICTED: uncharacterized protein LOC103711078    223   3e-67   Phoenix dactylifera
ref|XP_006426464.1|  hypothetical protein CICLE_v100272021mg            218   3e-67   
dbj|BAK04145.1|  predicted protein                                      223   3e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010227722.1|  PREDICTED: uncharacterized protein LOC104581568    223   4e-67   Brachypodium distachyon [annual false brome]
ref|XP_008796992.1|  PREDICTED: uncharacterized protein LOC103712290    223   5e-67   Phoenix dactylifera
ref|XP_006842358.1|  hypothetical protein AMTR_s00079p00180800          217   5e-67   
gb|EMS55277.1|  hypothetical protein TRIUR3_33067                       224   5e-67   Triticum urartu
ref|NP_001173628.1|  Os03g0731050                                       218   7e-67   
ref|XP_010942037.1|  PREDICTED: uncharacterized protein LOC105060...    222   8e-67   Elaeis guineensis
ref|XP_006485819.1|  PREDICTED: uncharacterized protein LOC102611796    223   8e-67   Citrus sinensis [apfelsine]
ref|XP_007217120.1|  hypothetical protein PRUPE_ppa015089m1g            216   8e-67   
ref|XP_002872192.1|  hypothetical protein ARALYDRAFT_910666             222   9e-67   Arabidopsis lyrata subsp. lyrata
gb|ADE76813.1|  unknown                                                 221   9e-67   Picea sitchensis
ref|XP_009131226.1|  PREDICTED: uncharacterized protein LOC103855927    221   1e-66   Brassica rapa
ref|XP_010108861.1|  hypothetical protein L484_027054                   222   1e-66   Morus notabilis
ref|XP_002872191.1|  hypothetical protein ARALYDRAFT_351610             221   1e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_009337144.1|  PREDICTED: uncharacterized protein LOC103929645    221   1e-66   
ref|XP_004959909.1|  PREDICTED: uncharacterized protein LOC101775358    222   2e-66   Setaria italica
gb|KDP29447.1|  hypothetical protein JCGZ_18368                         220   2e-66   Jatropha curcas
ref|XP_008220437.1|  PREDICTED: uncharacterized protein LOC103320525    221   2e-66   Prunus mume [ume]
ref|XP_004245124.1|  PREDICTED: uncharacterized protein LOC101267146    221   3e-66   Solanum lycopersicum
ref|XP_010941940.1|  PREDICTED: uncharacterized protein LOC105060052    221   3e-66   Elaeis guineensis
ref|XP_006842356.1|  hypothetical protein AMTR_s00079p00179880          220   4e-66   
ref|XP_008393663.1|  PREDICTED: uncharacterized protein LOC103455...    220   4e-66   
ref|XP_008393665.1|  PREDICTED: uncharacterized protein LOC103455...    220   4e-66   
ref|XP_004981886.1|  PREDICTED: uncharacterized protein LOC101780921    220   4e-66   Setaria italica
ref|XP_010265065.1|  PREDICTED: uncharacterized protein LOC104602904    221   5e-66   Nelumbo nucifera [Indian lotus]
ref|XP_009361651.1|  PREDICTED: uncharacterized protein LOC103951891    220   5e-66   
gb|KJB18563.1|  hypothetical protein B456_003G060300                    219   6e-66   Gossypium raimondii
ref|XP_006853920.1|  hypothetical protein AMTR_s00036p00191120          218   6e-66   
ref|XP_004291015.1|  PREDICTED: uncharacterized protein LOC101301742    220   6e-66   Fragaria vesca subsp. vesca
ref|XP_007222895.1|  hypothetical protein PRUPE_ppa006723mg             220   6e-66   Prunus persica
ref|XP_009772023.1|  PREDICTED: uncharacterized protein LOC104222493    219   9e-66   Nicotiana sylvestris
ref|XP_006442617.1|  hypothetical protein CICLE_v10020320mg             220   9e-66   Citrus clementina [clementine]
ref|XP_008806040.1|  PREDICTED: uncharacterized protein LOC103718829    219   9e-66   Phoenix dactylifera
ref|XP_011081713.1|  PREDICTED: uncharacterized protein LOC105164695    219   9e-66   Sesamum indicum [beniseed]
gb|KFK25431.1|  hypothetical protein AALP_AA8G114400                    219   1e-65   Arabis alpina [alpine rockcress]
ref|XP_010648315.1|  PREDICTED: uncharacterized protein LOC100249300    219   1e-65   Vitis vinifera
ref|XP_010033803.1|  PREDICTED: uncharacterized protein LOC104423043    219   1e-65   Eucalyptus grandis [rose gum]
emb|CDX69735.1|  BnaA10g20840D                                          219   1e-65   
emb|CBI33634.3|  unnamed protein product                                216   2e-65   Vitis vinifera
emb|CBI26990.3|  unnamed protein product                                216   2e-65   Vitis vinifera
ref|XP_008243270.1|  PREDICTED: uncharacterized protein LOC103341513    219   2e-65   Prunus mume [ume]
ref|XP_009357077.1|  PREDICTED: uncharacterized protein LOC103947833    219   2e-65   Pyrus x bretschneideri [bai li]
ref|XP_008339646.1|  PREDICTED: uncharacterized protein LOC103402673    219   2e-65   
ref|XP_002466519.1|  hypothetical protein SORBIDRAFT_01g009210          219   2e-65   Sorghum bicolor [broomcorn]
gb|KHG10617.1|  Putative non-structural 4                               218   2e-65   Gossypium arboreum [tree cotton]
ref|XP_007024391.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    218   3e-65   
gb|EEE59868.1|  hypothetical protein OsJ_12453                          218   3e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010099264.1|  hypothetical protein L484_015454                   219   3e-65   Morus notabilis
ref|NP_197969.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    218   3e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008812373.1|  PREDICTED: uncharacterized protein LOC103723273    218   3e-65   Phoenix dactylifera
gb|KJB70318.1|  hypothetical protein B456_011G068900                    218   3e-65   Gossypium raimondii
gb|ABK28713.1|  unknown                                                 218   3e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CAN70606.1|  hypothetical protein VITISV_040196                     218   3e-65   Vitis vinifera
ref|XP_009778079.1|  PREDICTED: uncharacterized protein LOC104227520    218   4e-65   Nicotiana sylvestris
gb|AFO66494.1|  hypothetical protein                                    218   4e-65   Brassica napus [oilseed rape]
ref|XP_006651782.1|  PREDICTED: uncharacterized protein LOC102702183    216   4e-65   
ref|XP_008663766.1|  PREDICTED: uncharacterized protein LOC103642231    219   4e-65   
gb|AFW60050.1|  hypothetical protein ZEAMMB73_108408                    219   5e-65   
ref|XP_009763003.1|  PREDICTED: uncharacterized protein LOC104214...    218   5e-65   Nicotiana sylvestris
emb|CDP08214.1|  unnamed protein product                                214   5e-65   Coffea canephora [robusta coffee]
gb|AAT77886.1|  expressed protein                                       218   6e-65   Oryza sativa Japonica Group [Japonica rice]
emb|CDX97141.1|  BnaC09g44840D                                          217   7e-65   
ref|XP_010097098.1|  hypothetical protein L484_019537                   217   7e-65   Morus notabilis
ref|XP_010318628.1|  PREDICTED: uncharacterized protein LOC101267...    214   7e-65   
tpg|DAA51165.1|  TPA: hypothetical protein ZEAMMB73_778026              211   7e-65   
emb|CDX97139.1|  BnaC09g44860D                                          217   8e-65   
gb|AAD40142.1|AF149413_23  contains similarity to several Arabido...    218   8e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006466159.1|  PREDICTED: uncharacterized protein LOC102619633    217   8e-65   
ref|NP_001044966.1|  Os01g0875800                                       216   1e-64   
ref|XP_002280674.1|  PREDICTED: uncharacterized protein LOC100244641    217   1e-64   Vitis vinifera
ref|NP_001169393.1|  uncharacterized protein LOC100383262               217   1e-64   Zea mays [maize]
ref|XP_011019540.1|  PREDICTED: uncharacterized protein LOC105122240    216   1e-64   Populus euphratica
dbj|BAD82090.1|  unknown protein                                        216   1e-64   Oryza sativa Japonica Group [Japonica rice]
gb|KDO58674.1|  hypothetical protein CISIN_1g040146mg                   216   1e-64   Citrus sinensis [apfelsine]
gb|EEC76122.1|  hypothetical protein OsI_13390                          229   1e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_009624653.1|  PREDICTED: uncharacterized protein LOC104115679    217   1e-64   Nicotiana tomentosiformis
gb|KDP34129.1|  hypothetical protein JCGZ_07700                         216   1e-64   Jatropha curcas
ref|XP_010244357.1|  PREDICTED: uncharacterized protein LOC104588211    216   1e-64   
emb|CDM85189.1|  unnamed protein product                                216   2e-64   Triticum aestivum [Canadian hard winter wheat]
gb|KJB54739.1|  hypothetical protein B456_009G047200                    216   2e-64   Gossypium raimondii
ref|XP_010912680.1|  PREDICTED: uncharacterized protein LOC105038537    216   2e-64   Elaeis guineensis
gb|EAY76682.1|  hypothetical protein OsI_04637                          216   2e-64   Oryza sativa Indica Group [Indian rice]
ref|XP_008244554.1|  PREDICTED: uncharacterized protein LOC103342693    214   2e-64   Prunus mume [ume]
gb|EMT03400.1|  hypothetical protein F775_00930                         212   2e-64   
ref|XP_002279551.2|  PREDICTED: uncharacterized protein LOC100250702    217   2e-64   Vitis vinifera
emb|CDX70416.1|  BnaC03g05000D                                          217   2e-64   
ref|XP_010049161.1|  PREDICTED: uncharacterized protein LOC104437817    215   3e-64   Eucalyptus grandis [rose gum]
ref|XP_007044267.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    216   3e-64   
ref|XP_010230469.1|  PREDICTED: uncharacterized protein LOC100843610    215   3e-64   
gb|KHG11266.1|  Insulin-degrading enzyme                                214   4e-64   Gossypium arboreum [tree cotton]
emb|CDX78439.1|  BnaA03g03510D                                          216   4e-64   
gb|KCW83891.1|  hypothetical protein EUGRSUZ_B00742                     213   4e-64   Eucalyptus grandis [rose gum]
gb|KJB65609.1|  hypothetical protein B456_010G103300                    215   4e-64   Gossypium raimondii
ref|XP_009344746.1|  PREDICTED: uncharacterized protein LOC103936628    219   4e-64   
ref|XP_004986256.1|  PREDICTED: uncharacterized protein LOC101760830    216   4e-64   
ref|XP_009151114.1|  PREDICTED: uncharacterized protein LOC103874440    215   5e-64   Brassica rapa
gb|EYU20381.1|  hypothetical protein MIMGU_mgv1a0226482mg               209   5e-64   Erythranthe guttata [common monkey flower]
dbj|BAB86235.1|  P0648C09.24                                            217   6e-64   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010264609.1|  PREDICTED: uncharacterized protein LOC104602574    215   7e-64   Nelumbo nucifera [Indian lotus]
ref|XP_010999299.1|  PREDICTED: uncharacterized protein LOC105107168    214   8e-64   Populus euphratica
ref|XP_011007501.1|  PREDICTED: uncharacterized protein LOC105113...    215   8e-64   Populus euphratica
ref|XP_011007493.1|  PREDICTED: uncharacterized protein LOC105113...    215   9e-64   Populus euphratica
ref|XP_009345696.1|  PREDICTED: uncharacterized protein LOC103937474    214   1e-63   Pyrus x bretschneideri [bai li]
gb|KDP29448.1|  hypothetical protein JCGZ_18369                         210   1e-63   Jatropha curcas
gb|KHG05757.1|  hypothetical protein F383_31190                         214   1e-63   Gossypium arboreum [tree cotton]
ref|XP_004236422.2|  PREDICTED: uncharacterized protein LOC101267...    215   1e-63   Solanum lycopersicum
ref|XP_002515894.1|  conserved hypothetical protein                     214   1e-63   Ricinus communis
ref|XP_006450782.1|  hypothetical protein CICLE_v10008613mg             214   1e-63   
ref|XP_002315929.2|  hypothetical protein POPTR_0010s13160g             214   1e-63   
gb|KDP40817.1|  hypothetical protein JCGZ_24816                         213   1e-63   Jatropha curcas
gb|KHN20747.1|  hypothetical protein glysoja_019064                     211   2e-63   Glycine soja [wild soybean]
ref|XP_010936142.1|  PREDICTED: uncharacterized protein LOC105055840    213   2e-63   Elaeis guineensis
ref|XP_002466518.1|  hypothetical protein SORBIDRAFT_01g009200          213   2e-63   
ref|XP_002516477.1|  conserved hypothetical protein                     213   2e-63   
ref|XP_002309520.1|  hypothetical protein POPTR_0006s24970g             213   2e-63   Populus trichocarpa [western balsam poplar]
gb|ACF84653.1|  unknown                                                 210   3e-63   Zea mays [maize]
gb|AFO66521.1|  putative clathrin binding protein                       221   3e-63   Brassica napus [oilseed rape]
ref|XP_006353820.1|  PREDICTED: uncharacterized protein LOC102581987    211   3e-63   Solanum tuberosum [potatoes]
ref|XP_006369242.1|  hypothetical protein POPTR_0001s20050g             212   4e-63   Populus trichocarpa [western balsam poplar]
ref|XP_002466520.1|  hypothetical protein SORBIDRAFT_01g009220          212   4e-63   Sorghum bicolor [broomcorn]
ref|XP_007044265.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    213   4e-63   Theobroma cacao [chocolate]
ref|XP_009122883.1|  PREDICTED: LOW QUALITY PROTEIN: clathrin int...    221   4e-63   
ref|XP_002447391.1|  hypothetical protein SORBIDRAFT_06g034240          214   5e-63   Sorghum bicolor [broomcorn]
ref|XP_007012231.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    212   5e-63   
ref|XP_009625225.1|  PREDICTED: uncharacterized protein LOC104116132    212   5e-63   Nicotiana tomentosiformis
gb|KHN37013.1|  hypothetical protein glysoja_009041                     210   6e-63   Glycine soja [wild soybean]
ref|XP_006357367.1|  PREDICTED: uncharacterized protein LOC102582902    212   6e-63   Solanum tuberosum [potatoes]
ref|XP_009403975.1|  PREDICTED: uncharacterized protein LOC103987406    212   6e-63   Musa acuminata subsp. malaccensis [pisang utan]
tpg|DAA51164.1|  TPA: hypothetical protein ZEAMMB73_778026              212   7e-63   
emb|CBI15481.3|  unnamed protein product                                211   8e-63   Vitis vinifera
ref|XP_010926004.1|  PREDICTED: uncharacterized protein LOC105048408    212   8e-63   Elaeis guineensis
ref|XP_010062561.1|  PREDICTED: uncharacterized protein LOC104449935    212   9e-63   
ref|XP_010267069.1|  PREDICTED: uncharacterized protein LOC104604...    211   9e-63   Nelumbo nucifera [Indian lotus]
ref|XP_006344151.1|  PREDICTED: uncharacterized protein LOC102582712    209   1e-62   
dbj|BAK05476.1|  predicted protein                                      211   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003550286.1|  PREDICTED: uncharacterized protein LOC100785919    211   1e-62   Glycine max [soybeans]
ref|XP_010479681.1|  PREDICTED: uncharacterized protein LOC104758496    212   1e-62   Camelina sativa [gold-of-pleasure]
gb|KJB31441.1|  hypothetical protein B456_005G192100                    211   1e-62   Gossypium raimondii
ref|XP_003524367.1|  PREDICTED: uncharacterized protein LOC100815747    211   1e-62   Glycine max [soybeans]
ref|XP_011072929.1|  PREDICTED: uncharacterized protein LOC105158025    212   1e-62   Sesamum indicum [beniseed]
ref|XP_010536211.1|  PREDICTED: uncharacterized protein LOC104811254    211   1e-62   Tarenaya hassleriana [spider flower]
ref|NP_001143764.1|  uncharacterized protein LOC100276526               211   1e-62   
ref|XP_011081610.1|  PREDICTED: uncharacterized protein LOC105164614    211   2e-62   Sesamum indicum [beniseed]
gb|KHN21596.1|  hypothetical protein glysoja_023448                     211   2e-62   Glycine soja [wild soybean]
ref|XP_010045650.1|  PREDICTED: uncharacterized protein LOC104434412    211   2e-62   Eucalyptus grandis [rose gum]
gb|KEH44200.1|  core-2/I-branching enzyme                               211   2e-62   Medicago truncatula
ref|XP_002276828.1|  PREDICTED: uncharacterized protein LOC100247520    211   2e-62   
gb|AAM63616.1|  unknown                                                 211   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566682.1|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    211   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011469419.1|  PREDICTED: uncharacterized protein LOC105352951    211   2e-62   Fragaria vesca subsp. vesca
ref|XP_009367505.1|  PREDICTED: uncharacterized protein LOC103957137    211   2e-62   
ref|XP_008812111.1|  PREDICTED: uncharacterized protein LOC103723082    211   2e-62   
emb|CDX97140.1|  BnaC09g44850D                                          211   2e-62   
ref|XP_008790242.1|  PREDICTED: uncharacterized protein LOC103707505    210   2e-62   Phoenix dactylifera
ref|XP_010265068.1|  PREDICTED: uncharacterized protein LOC104602905    211   3e-62   Nelumbo nucifera [Indian lotus]
ref|XP_004238913.2|  PREDICTED: uncharacterized protein LOC101249916    209   3e-62   Solanum lycopersicum
ref|XP_006430742.1|  hypothetical protein CICLE_v10013811mg             208   3e-62   Citrus clementina [clementine]
gb|KDO59065.1|  hypothetical protein CISIN_1g042794mg                   208   3e-62   Citrus sinensis [apfelsine]
ref|XP_006482399.1|  PREDICTED: uncharacterized protein LOC102630459    208   3e-62   
ref|XP_010500763.1|  PREDICTED: uncharacterized protein LOC104778093    211   3e-62   Camelina sativa [gold-of-pleasure]
ref|XP_004300973.1|  PREDICTED: uncharacterized protein LOC101293399    211   4e-62   Fragaria vesca subsp. vesca
ref|XP_002891661.1|  hypothetical protein ARALYDRAFT_337332             210   4e-62   
ref|XP_011007447.1|  PREDICTED: uncharacterized protein LOC105113...    210   4e-62   Populus euphratica
ref|XP_010106109.1|  hypothetical protein L484_003112                   210   4e-62   Morus notabilis
ref|XP_011007454.1|  PREDICTED: uncharacterized protein LOC105113...    210   4e-62   
ref|XP_002883297.1|  hypothetical protein ARALYDRAFT_479651             209   4e-62   
gb|ACF85887.1|  unknown                                                 209   4e-62   
ref|NP_001130080.1|  uncharacterized protein LOC100191173               209   4e-62   
ref|XP_003530022.2|  PREDICTED: uncharacterized protein LOC100791882    209   4e-62   
ref|XP_008244747.1|  PREDICTED: uncharacterized protein LOC103342870    209   5e-62   
ref|XP_007215514.1|  hypothetical protein PRUPE_ppa007018mg             209   5e-62   
emb|CDY56916.1|  BnaCnng31370D                                          209   5e-62   
gb|EMT12183.1|  hypothetical protein F775_15181                         206   5e-62   
ref|XP_010094729.1|  hypothetical protein L484_019938                   211   5e-62   
ref|XP_002276490.2|  PREDICTED: uncharacterized protein LOC100266878    209   5e-62   
ref|XP_006299117.1|  hypothetical protein CARUB_v10015258mg             209   5e-62   
ref|XP_002535241.1|  conserved hypothetical protein                     206   6e-62   
ref|XP_009356238.1|  PREDICTED: uncharacterized protein LOC103947108    210   6e-62   
ref|XP_004252429.1|  PREDICTED: uncharacterized protein LOC101255566    207   6e-62   
ref|XP_002516755.1|  conserved hypothetical protein                     209   6e-62   
ref|XP_004241946.1|  PREDICTED: uncharacterized protein LOC101261829    209   6e-62   
emb|CBI15480.3|  unnamed protein product                                206   7e-62   
ref|NP_175588.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    210   7e-62   
gb|KEH39949.1|  core-2/I-branching enzyme                               209   7e-62   
gb|AAG50880.1|AC025294_18  hypothetical protein                         209   8e-62   
gb|ACL54529.1|  unknown                                                 210   8e-62   
ref|XP_002524909.1|  conserved hypothetical protein                     209   8e-62   
ref|NP_001143735.1|  uncharacterized protein LOC100276489               210   9e-62   
ref|XP_011014143.1|  PREDICTED: uncharacterized protein LOC105118003    209   9e-62   
ref|XP_008672591.1|  PREDICTED: uncharacterized protein LOC100276...    210   1e-61   
ref|XP_006341708.1|  PREDICTED: uncharacterized protein LOC102599552    209   1e-61   
ref|XP_004498923.1|  PREDICTED: uncharacterized protein LOC101515236    208   1e-61   
ref|XP_010678016.1|  PREDICTED: uncharacterized protein LOC104893585    209   1e-61   
ref|XP_002324745.2|  hypothetical protein POPTR_0018s04680g             209   1e-61   
ref|XP_011022393.1|  PREDICTED: uncharacterized protein LOC105124187    209   1e-61   
gb|EMS51218.1|  hypothetical protein TRIUR3_07068                       207   1e-61   
ref|XP_010466367.1|  PREDICTED: uncharacterized protein LOC104746558    208   1e-61   
ref|XP_009630467.1|  PREDICTED: uncharacterized protein LOC104120416    208   1e-61   
ref|XP_009768969.1|  PREDICTED: uncharacterized protein LOC104219898    209   1e-61   
ref|XP_003545368.1|  PREDICTED: uncharacterized protein LOC100819890    208   1e-61   
ref|XP_008380827.1|  PREDICTED: uncharacterized protein LOC103443716    208   2e-61   
ref|XP_010493855.1|  PREDICTED: uncharacterized protein LOC104771079    208   2e-61   
ref|XP_007033224.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    209   2e-61   
ref|XP_011011841.1|  PREDICTED: uncharacterized protein LOC105116265    208   2e-61   
ref|XP_009589451.1|  PREDICTED: uncharacterized protein LOC104086812    209   2e-61   
ref|XP_004137544.1|  PREDICTED: uncharacterized protein LOC101209845    205   2e-61   
ref|XP_002305172.2|  hypothetical protein POPTR_0004s09690g             207   3e-61   
ref|XP_006417407.1|  hypothetical protein EUTSA_v10009677mg             207   3e-61   
ref|XP_008374777.1|  PREDICTED: uncharacterized protein LOC103438016    208   3e-61   
ref|XP_002311468.2|  hypothetical protein POPTR_0008s12260g             207   3e-61   
ref|XP_010488146.1|  PREDICTED: uncharacterized protein LOC104766030    207   3e-61   
emb|CDY51451.1|  BnaA05g36680D                                          207   3e-61   
ref|XP_006286838.1|  hypothetical protein CARUB_v10003837mg             207   4e-61   
ref|XP_011076478.1|  PREDICTED: uncharacterized protein LOC105160693    207   4e-61   
ref|XP_007208909.1|  hypothetical protein PRUPE_ppa027107mg             204   4e-61   
ref|XP_007142937.1|  hypothetical protein PHAVU_007G029800g             208   4e-61   
ref|XP_002458851.1|  hypothetical protein SORBIDRAFT_03g041470          207   5e-61   
ref|XP_009348209.1|  PREDICTED: uncharacterized protein LOC103939820    207   5e-61   
ref|XP_007160978.1|  hypothetical protein PHAVU_001G033200g             207   5e-61   
ref|XP_008453432.1|  PREDICTED: uncharacterized protein LOC103494140    204   5e-61   
ref|XP_009402165.1|  PREDICTED: uncharacterized protein LOC103986...    207   5e-61   
ref|XP_010663889.1|  PREDICTED: uncharacterized protein LOC100252627    207   5e-61   
ref|XP_009145490.1|  PREDICTED: uncharacterized protein LOC103869...    206   5e-61   
ref|XP_007226202.1|  hypothetical protein PRUPE_ppa016185mg             207   5e-61   
ref|XP_010669159.1|  PREDICTED: uncharacterized protein LOC104886401    207   5e-61   
ref|XP_009338135.1|  PREDICTED: uncharacterized protein LOC103930517    207   6e-61   
ref|XP_004301820.1|  PREDICTED: uncharacterized protein LOC101311102    208   6e-61   
ref|XP_010421452.1|  PREDICTED: uncharacterized protein LOC104706914    207   6e-61   
ref|XP_007044266.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    207   7e-61   
gb|EMS50058.1|  hypothetical protein TRIUR3_05627                       203   7e-61   
ref|XP_006468735.1|  PREDICTED: uncharacterized protein LOC102627900    207   7e-61   
ref|XP_011035090.1|  PREDICTED: uncharacterized protein LOC105133011    206   8e-61   
ref|XP_002315928.1|  hypothetical protein POPTR_0010s13150g             206   9e-61   
ref|XP_008240316.1|  PREDICTED: uncharacterized protein LOC103338837    207   9e-61   
gb|EYU30001.1|  hypothetical protein MIMGU_mgv1a007596mg                207   1e-60   
ref|XP_003532515.1|  PREDICTED: uncharacterized protein LOC100782511    206   1e-60   
gb|KHN16548.1|  hypothetical protein glysoja_002645                     206   1e-60   
ref|XP_002321482.2|  hypothetical protein POPTR_0015s03840g             206   2e-60   
ref|XP_009145487.1|  PREDICTED: uncharacterized protein LOC103869...    206   2e-60   
gb|KHN06677.1|  hypothetical protein glysoja_021223                     206   2e-60   
ref|XP_004160451.1|  PREDICTED: uncharacterized protein LOC101227205    206   2e-60   
emb|CDP00652.1|  unnamed protein product                                202   2e-60   
gb|KFK35824.1|  hypothetical protein AALP_AA4G041900                    205   2e-60   
ref|XP_008391294.1|  PREDICTED: uncharacterized protein LOC103453537    205   3e-60   
gb|KCW86302.1|  hypothetical protein EUGRSUZ_B02994                     202   3e-60   
ref|XP_010066702.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    206   3e-60   
gb|EYU45841.1|  hypothetical protein MIMGU_mgv1a018710mg                204   4e-60   
ref|XP_011100115.1|  PREDICTED: uncharacterized protein LOC105178347    205   4e-60   
ref|XP_003533360.1|  PREDICTED: uncharacterized protein LOC100803748    206   5e-60   
ref|XP_004972519.1|  PREDICTED: uncharacterized protein LOC101756391    206   5e-60   
ref|XP_003536674.1|  PREDICTED: uncharacterized protein LOC100810724    205   5e-60   
emb|CDO98418.1|  unnamed protein product                                201   6e-60   
gb|KHF98579.1|  hypothetical protein F383_37748                         201   6e-60   
ref|XP_010690090.1|  PREDICTED: uncharacterized protein LOC104903696    204   7e-60   
ref|XP_002321483.2|  hypothetical protein POPTR_0015s03850g             204   8e-60   
ref|XP_009767015.1|  PREDICTED: uncharacterized protein LOC104218...    201   9e-60   
ref|XP_002977635.1|  hypothetical protein SELMODRAFT_107168             202   1e-59   
ref|XP_009786387.1|  PREDICTED: uncharacterized protein LOC104234513    203   1e-59   
ref|XP_009360137.1|  PREDICTED: uncharacterized protein LOC103950632    204   1e-59   
ref|XP_007160392.1|  hypothetical protein PHAVU_002G318000g             204   1e-59   
ref|XP_004297621.1|  PREDICTED: uncharacterized protein LOC101304278    203   1e-59   
ref|XP_009131527.1|  PREDICTED: uncharacterized protein LOC103856...    201   1e-59   
ref|XP_007036566.1|  Core-2/I-branching beta-1,6-N-acetylglucosam...    205   1e-59   
gb|EPS59287.1|  hypothetical protein M569_15522                         203   1e-59   
ref|XP_003614560.1|  hypothetical protein MTR_5g055480                  203   1e-59   
ref|XP_006647208.1|  PREDICTED: uncharacterized protein LOC102715175    204   1e-59   
gb|KJB08436.1|  hypothetical protein B456_001G081500                    203   1e-59   
ref|XP_006448426.1|  hypothetical protein CICLE_v10015505mg             203   2e-59   
ref|XP_009131528.1|  PREDICTED: uncharacterized protein LOC103856...    201   2e-59   
ref|XP_011070777.1|  PREDICTED: uncharacterized protein LOC105156363    203   2e-59   
ref|XP_009615448.1|  PREDICTED: uncharacterized protein LOC104108166    203   2e-59   
ref|XP_010046585.1|  PREDICTED: uncharacterized protein LOC104435558    203   2e-59   
ref|XP_004238911.1|  PREDICTED: uncharacterized protein LOC101249358    203   3e-59   
ref|XP_010693288.1|  PREDICTED: uncharacterized protein LOC104906249    202   3e-59   
gb|EYU40777.1|  hypothetical protein MIMGU_mgv1a007709mg                202   3e-59   
ref|XP_006392995.1|  hypothetical protein EUTSA_v10012322mg             202   3e-59   
ref|XP_003555913.1|  PREDICTED: uncharacterized protein LOC100779041    203   3e-59   
ref|XP_008393326.1|  PREDICTED: uncharacterized protein LOC103455513    203   3e-59   
ref|XP_008812383.1|  PREDICTED: uncharacterized protein LOC103723284    202   3e-59   
emb|CDP02764.1|  unnamed protein product                                199   4e-59   
ref|XP_002871706.1|  hypothetical protein ARALYDRAFT_326063             202   4e-59   
ref|XP_006344154.1|  PREDICTED: uncharacterized protein LOC102583596    202   5e-59   
emb|CDY19328.1|  BnaC05g08370D                                          202   5e-59   
ref|XP_010510112.1|  PREDICTED: uncharacterized protein LOC104786396    202   5e-59   
ref|XP_009601960.1|  PREDICTED: uncharacterized protein LOC104097139    201   5e-59   
emb|CDX78674.1|  BnaA03g05860D                                          202   5e-59   
ref|XP_004299046.1|  PREDICTED: uncharacterized protein LOC101307491    202   5e-59   
ref|XP_011097225.1|  PREDICTED: uncharacterized protein LOC105176192    199   6e-59   
ref|XP_010916430.1|  PREDICTED: uncharacterized protein LOC105041248    202   6e-59   
ref|XP_009767014.1|  PREDICTED: uncharacterized protein LOC104218...    202   7e-59   
ref|XP_006344302.1|  PREDICTED: uncharacterized protein LOC102604936    201   7e-59   
gb|KHG14930.1|  Putative DNA helicase ino80                             201   7e-59   
ref|XP_006343019.1|  PREDICTED: uncharacterized protein LOC102599337    201   8e-59   
gb|KJB61248.1|  hypothetical protein B456_009G347900                    201   8e-59   
ref|XP_004154808.1|  PREDICTED: uncharacterized protein LOC101228236    201   8e-59   
ref|XP_004146835.1|  PREDICTED: uncharacterized protein LOC101208492    201   9e-59   
dbj|BAF00442.1|  hypothetical protein                                   201   9e-59   
gb|ACU18543.1|  unknown                                                 202   1e-58   
ref|XP_010694626.1|  PREDICTED: uncharacterized protein LOC104907403    200   1e-58   
ref|XP_009780294.1|  PREDICTED: uncharacterized protein LOC104229...    199   1e-58   
emb|CDY20597.1|  BnaC08g14610D                                          199   1e-58   
emb|CAC01858.1|  putative protein                                       199   1e-58   
ref|XP_009131526.1|  PREDICTED: uncharacterized protein LOC103856...    202   1e-58   
ref|XP_010524350.1|  PREDICTED: uncharacterized protein LOC104802437    201   1e-58   
ref|XP_010415458.1|  PREDICTED: uncharacterized protein LOC104701464    201   1e-58   
ref|XP_004236394.1|  PREDICTED: uncharacterized protein LOC101257059    201   1e-58   
ref|XP_011072465.1|  PREDICTED: uncharacterized protein LOC105157713    201   1e-58   
ref|XP_006287845.1|  hypothetical protein CARUB_v10001069mg             201   2e-58   
ref|XP_006406285.1|  hypothetical protein EUTSA_v10021956mg             200   2e-58   
ref|XP_010094730.1|  hypothetical protein L484_019940                   200   2e-58   
emb|CDO98417.1|  unnamed protein product                                201   2e-58   
ref|XP_006469090.1|  PREDICTED: uncharacterized protein LOC102627718    200   2e-58   
ref|XP_009780287.1|  PREDICTED: uncharacterized protein LOC104229...    200   2e-58   
ref|XP_011008309.1|  PREDICTED: uncharacterized protein LOC105113714    200   2e-58   
ref|XP_008459241.1|  PREDICTED: uncharacterized protein LOC103498396    200   2e-58   
ref|XP_002975225.1|  hypothetical protein SELMODRAFT_102845             199   2e-58   
ref|XP_008447582.1|  PREDICTED: uncharacterized protein LOC103489998    200   3e-58   
gb|KEH27363.1|  core-2/I-branching enzyme                               200   3e-58   
ref|XP_004497066.1|  PREDICTED: uncharacterized protein LOC101490811    200   3e-58   
emb|CDX70676.1|  BnaC03g07600D                                          200   3e-58   
emb|CDO97949.1|  unnamed protein product                                200   3e-58   
ref|XP_009357886.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    202   3e-58   
dbj|BAJ98037.1|  predicted protein                                      201   4e-58   
ref|XP_006391143.1|  hypothetical protein EUTSA_v10019817mg             200   4e-58   
ref|XP_009767018.1|  PREDICTED: uncharacterized protein LOC104218270    200   4e-58   
gb|EPS62381.1|  hypothetical protein M569_12413                         199   4e-58   
ref|XP_010537457.1|  PREDICTED: uncharacterized protein LOC104812147    200   4e-58   
ref|NP_197121.2|  core-2/I-branching beta-1,6-N-acetylglucosaminy...    200   4e-58   
ref|XP_010453774.1|  PREDICTED: uncharacterized protein LOC104735642    200   4e-58   
emb|CDX87842.1|  BnaC06g09040D                                          199   4e-58   
emb|CDY59035.1|  BnaCnng34190D                                          200   4e-58   
gb|KDO76927.1|  hypothetical protein CISIN_1g046575mg                   200   4e-58   
gb|EPS68648.1|  hypothetical protein M569_06120                         198   5e-58   
gb|EYU41282.1|  hypothetical protein MIMGU_mgv1a010939mg                196   5e-58   
ref|XP_011095814.1|  PREDICTED: uncharacterized protein LOC105175...    198   5e-58   
ref|XP_009615449.1|  PREDICTED: uncharacterized protein LOC104108167    199   6e-58   
ref|XP_002442608.1|  hypothetical protein SORBIDRAFT_08g022900          199   6e-58   
tpg|DAA47679.1|  TPA: hypothetical protein ZEAMMB73_259148              199   6e-58   
gb|KJB08433.1|  hypothetical protein B456_001G081300                    199   7e-58   
ref|NP_001170302.1|  uncharacterized protein LOC100384266               199   7e-58   
ref|XP_009144879.1|  PREDICTED: uncharacterized protein LOC103868547    199   7e-58   
gb|EYU44620.1|  hypothetical protein MIMGU_mgv1a022082mg                196   7e-58   
ref|XP_008645560.1|  PREDICTED: uncharacterized protein LOC103626979    201   7e-58   
ref|XP_004516650.1|  PREDICTED: uncharacterized protein LOC101496316    199   7e-58   
ref|XP_010513660.1|  PREDICTED: uncharacterized protein LOC104789704    199   1e-57   
ref|XP_010420299.1|  PREDICTED: uncharacterized protein LOC104705...    199   1e-57   
ref|XP_007224741.1|  hypothetical protein PRUPE_ppa024535mg             199   1e-57   
emb|CBI20612.3|  unnamed protein product                                194   2e-57   
ref|XP_011095742.1|  PREDICTED: uncharacterized protein LOC105175...    198   2e-57   
ref|XP_009393005.1|  PREDICTED: uncharacterized protein LOC103978798    197   2e-57   
ref|XP_008351921.1|  PREDICTED: uncharacterized protein LOC103415361    195   2e-57   
emb|CDX69465.1|  BnaA10g18140D                                          198   2e-57   
ref|XP_009415632.1|  PREDICTED: uncharacterized protein LOC103996435    196   2e-57   
gb|EYU21409.1|  hypothetical protein MIMGU_mgv1a007990mg                197   2e-57   
ref|XP_003620433.1|  hypothetical protein MTR_6g083830                  198   2e-57   
ref|XP_009121508.1|  PREDICTED: uncharacterized protein LOC103846350    198   2e-57   
gb|AES76651.2|  core-2/I-branching enzyme                               198   2e-57   
ref|XP_004161852.1|  PREDICTED: uncharacterized LOC101207320            197   2e-57   
ref|XP_004510336.1|  PREDICTED: uncharacterized protein LOC101496152    197   2e-57   
dbj|BAJ98929.1|  predicted protein                                      199   2e-57   
ref|XP_010470788.1|  PREDICTED: uncharacterized protein LOC104750...    198   2e-57   
ref|XP_009413609.1|  PREDICTED: uncharacterized protein LOC103994882    197   3e-57   
ref|XP_007152746.1|  hypothetical protein PHAVU_004G156000g             199   3e-57   
ref|XP_006448428.1|  hypothetical protein CICLE_v10017943mg             197   4e-57   
ref|XP_006400149.1|  hypothetical protein EUTSA_v10013684mg             197   4e-57   
ref|XP_006302341.1|  hypothetical protein CARUB_v10020398mg             197   4e-57   
ref|XP_004299045.1|  PREDICTED: uncharacterized protein LOC101307203    197   5e-57   
gb|EYU44621.1|  hypothetical protein MIMGU_mgv1a022423mg                194   5e-57   
gb|KJB77167.1|  hypothetical protein B456_012G124200                    191   5e-57   
ref|XP_002887179.1|  hypothetical protein ARALYDRAFT_475958             197   7e-57   
ref|XP_010470787.1|  PREDICTED: uncharacterized protein LOC104750...    198   8e-57   
ref|XP_011097027.1|  PREDICTED: uncharacterized protein LOC105176048    197   8e-57   
ref|XP_009105384.1|  PREDICTED: uncharacterized protein LOC103831252    196   1e-56   
gb|KFK41255.1|  hypothetical protein AALP_AA2G105500                    196   1e-56   
gb|KHN45589.1|  hypothetical protein glysoja_043015                     189   2e-56   
ref|XP_003579091.1|  PREDICTED: uncharacterized protein LOC100825359    196   2e-56   
emb|CDX81507.1|  BnaC02g18110D                                          195   3e-56   
ref|XP_008461555.1|  PREDICTED: uncharacterized protein LOC103500127    195   4e-56   
dbj|BAJ90641.1|  predicted protein                                      195   4e-56   
ref|XP_008462376.1|  PREDICTED: uncharacterized protein LOC103500748    194   4e-56   
ref|XP_008467193.1|  PREDICTED: uncharacterized protein LOC103504601    194   6e-56   
ref|XP_003560217.1|  PREDICTED: uncharacterized protein LOC100835983    194   6e-56   
ref|XP_007208880.1|  hypothetical protein PRUPE_ppa026447mg             195   7e-56   
ref|NP_001067359.2|  Os12g0635500                                       188   8e-56   
ref|XP_004141671.1|  PREDICTED: uncharacterized protein LOC101216165    194   8e-56   



>ref|XP_006349290.1| PREDICTED: uncharacterized protein LOC102579219 [Solanum tuberosum]
Length=397

 Score =   298 bits (762),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  S HSF+ESYDDP+RYGRGRYN  MKPDIKL +WRKGSQWFEM
Sbjct  218  ESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRHMKPDIKLPDWRKGSQWFEM  277

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +VS+TK+Y +F+++C+P+CYPDEHYIPT+++L HG +NANR+VTYVDWSLGGP
Sbjct  278  NRTLAVRVVSDTKYYDIFRRFCKPACYPDEHYIPTFIRLFHGPLNANRTVTYVDWSLGGP  337

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+++A NITEGF+Q IR+NGT+C+YN  KT +CYLFARKF PSALEPL  LS KVM F
Sbjct  338  HPAAFSAVNITEGFLQLIRNNGTACAYNSEKTHVCYLFARKFNPSALEPLLNLSSKVMEF  397



>ref|XP_004230423.1| PREDICTED: uncharacterized protein LOC101259085 [Solanum lycopersicum]
Length=406

 Score =   294 bits (753),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  S HSF+ESYDDP+RYGRGRYN  M+PDIKL +WRKGSQWFEM
Sbjct  227  ESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRHMRPDIKLPDWRKGSQWFEM  286

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +VS+TK+Y +F+++C+P+CYPDEHYIPT ++L HG +NANR+VTYVDWSLGGP
Sbjct  287  NRTLAVRVVSDTKYYDLFERFCKPACYPDEHYIPTLIRLFHGPLNANRTVTYVDWSLGGP  346

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+++A NITEGF+Q IR+NGT+C+YN  KT +CYLFARKF PSALEPL  LS KVM +
Sbjct  347  HPAAFSAVNITEGFLQLIRNNGTACAYNSEKTHVCYLFARKFNPSALEPLLNLSSKVMEY  406



>ref|XP_011092268.1| PREDICTED: uncharacterized protein LOC105172507 [Sesamum indicum]
Length=477

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 156/180 (87%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYL ES HSF+ESYDDPTRYGRGRY+  MKPDI L EWRKGSQWFEM
Sbjct  299  ESCIPIYNFPTVYKYLVESAHSFVESYDDPTRYGRGRYSRWMKPDITLSEWRKGSQWFEM  358

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV++TK+Y +F+KYC+PSCYPDEHYIPTYL+  HG +N+NR+VTYVDWS   P
Sbjct  359  HRTLAVKIVADTKYYMLFRKYCKPSCYPDEHYIPTYLRKFHGALNSNRTVTYVDWSEMAP  418

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPAS+TAAN+TEGFIQS+R+NGT CSYN GKT ICYLFARKF PSALEPL   + +VMGF
Sbjct  419  HPASFTAANVTEGFIQSLRNNGT-CSYNSGKTPICYLFARKFDPSALEPLLSFASQVMGF  477



>gb|KJB08617.1| hypothetical protein B456_001G093200 [Gossypium raimondii]
Length=394

 Score =   290 bits (742),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  ST+SF+ESYDDPTRYGRGRYN +M P IKL++WRKGSQWFEM
Sbjct  215  ESCIPVYNFPTVYKYLIGSTYSFVESYDDPTRYGRGRYNRKMLPHIKLYQWRKGSQWFEM  274

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R++A  IVS+TK+Y +FKKYC+P+CYPDEHYIPTYL + HG +NANR++T+VDWS+GGP
Sbjct  275  QRSVATYIVSDTKYYNLFKKYCKPACYPDEHYIPTYLNMFHGSLNANRTITWVDWSMGGP  334

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y   N+TEGFIQSIR+NGT CSYN   T +CYLFARKF PSALEPL  LS  VM F
Sbjct  335  HPAKYEGVNVTEGFIQSIRNNGTLCSYNDELTSVCYLFARKFAPSALEPLLNLSSTVMNF  394



>ref|XP_002528868.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33542.1| conserved hypothetical protein [Ricinus communis]
Length=282

 Score =   284 bits (726),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL  S +SF+ESYDDPTRYGRGRYN +M PDI+L++WRKGSQWFE+
Sbjct  100  ESCIPVYNFPTVYRYLIHSEYSFVESYDDPTRYGRGRYNRKMLPDIRLYQWRKGSQWFEI  159

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             RALA+ +VS+TK+Y++FK+YCRP+CYPDEHYIPTYL + HG +NANR+VT+VDWS GGP
Sbjct  160  QRALAVYMVSDTKYYSIFKRYCRPACYPDEHYIPTYLNMFHGSLNANRTVTWVDWSFGGP  219

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   N+TE FIQSIR+N T CSYN   T +CYLFARKF PSALEPL  L+  V G 
Sbjct  220  HPATYMGINVTESFIQSIRNNKTQCSYNSEMTSVCYLFARKFHPSALEPLLNLTSTVPGI  279



>ref|XP_007022850.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY25472.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=390

 Score =   286 bits (731),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  ST+SF+ESYDDP+RYGRGRY+ +M PDIKL++WRKGSQWFEM
Sbjct  211  ESCIPVYNFPTVYKYLIGSTYSFVESYDDPSRYGRGRYSRKMLPDIKLYQWRKGSQWFEM  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI I+S+TK+Y +F+KYCRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGP
Sbjct  271  HRLVAIYIISDTKYYTLFRKYCRPACYPDEHYIPTFLNMFHGSLNANRSVTWVDWSMGGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +  ANITEGFIQ+IR NGT CSYN  +T  CYLFARKF PSALE L  LS  VM F
Sbjct  331  HPAMHGGANITEGFIQAIRKNGTLCSYNEEQTSACYLFARKFAPSALESLLNLSSTVMEF  390



>gb|KFK43315.1| hypothetical protein AALP_AA1G108500 [Arabis alpina]
Length=409

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  230  ESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  289

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  290  NRKLAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  349

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITEGF+QSIR+N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  350  HPATYAAANITEGFLQSIRNNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  409



>ref|XP_002268014.1| PREDICTED: uncharacterized protein LOC100250508 [Vitis vinifera]
Length=379

 Score =   283 bits (725),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VYKYL  S +SF+ESYDDP+RYGRGRY+  M P+IKL++WRKGSQWFE+
Sbjct  197  ESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPNIKLYQWRKGSQWFEL  256

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV++TK+Y +FKKYC+PSCYPDEHYI T+L + +G +NANRSVT+VDWS+GGP
Sbjct  257  SRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGP  316

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+  AANITEGFIQ++R+NGT C YN  KT +CYLFARKF PSALEPL  L+ KVMGF
Sbjct  317  HPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLLNLTSKVMGF  376



>ref|XP_006417483.1| hypothetical protein EUTSA_v10007760mg [Eutrema salsugineum]
 gb|ESQ35836.1| hypothetical protein EUTSA_v10007760mg [Eutrema salsugineum]
Length=413

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  234  ESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  293

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S+TK+Y++FK++CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGP
Sbjct  294  NRKIAIYIISDTKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGP  353

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  354  HPATYDAANITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  413



>ref|XP_008452226.1| PREDICTED: uncharacterized protein LOC103493307 isoform X2 [Cucumis 
melo]
Length=389

 Score =   283 bits (725),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY YLT S HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE+
Sbjct  210  ESCIPVYNFQTVYDYLTNSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFEL  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RALAI IV++TK+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGP
Sbjct  270  SRALAIYIVADTKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGP  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  330  HPAMYGPANITESFIESIRNNGTECLYNSEITSVCYLFARKFAPSTLEPLLNLTSSVMKF  389



>ref|XP_008452225.1| PREDICTED: uncharacterized protein LOC103493307 isoform X1 [Cucumis 
melo]
Length=394

 Score =   283 bits (724),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY YLT S HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE+
Sbjct  215  ESCIPVYNFQTVYDYLTNSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFEL  274

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RALAI IV++TK+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGP
Sbjct  275  SRALAIYIVADTKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGP  334

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  335  HPAMYGPANITESFIESIRNNGTECLYNSEITSVCYLFARKFAPSTLEPLLNLTSSVMKF  394



>emb|CBI29648.3| unnamed protein product [Vitis vinifera]
Length=409

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VYKYL  S +SF+ESYDDP+RYGRGRY+  M P+IKL++WRKGSQWFE+
Sbjct  227  ESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPNIKLYQWRKGSQWFEL  286

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV++TK+Y +FKKYC+PSCYPDEHYI T+L + +G +NANRSVT+VDWS+GGP
Sbjct  287  SRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGP  346

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+  AANITEGFIQ++R+NGT C YN  KT +CYLFARKF PSALEPL  L+ KVMGF
Sbjct  347  HPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLLNLTSKVMGF  406



>ref|NP_172499.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AAD32878.1|AC005489_16 F14N23.16 [Arabidopsis thaliana]
 gb|ABK32109.1| At1g10280 [Arabidopsis thaliana]
 gb|AEE28561.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38956.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=412

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  233  ESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  292

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  293  NRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  352

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  353  HPATYAAANITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  412



>ref|XP_002892557.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68816.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=412

 Score =   283 bits (725),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  233  ESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  292

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  293  NRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  352

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  353  HPATYAAANITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  412



>emb|CDY31036.1| BnaA08g25860D [Brassica napus]
Length=377

 Score =   282 bits (721),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  198  ESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  257

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FKK+CRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGP
Sbjct  258  NRKIAIYIISDSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGP  317

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  318  HPATYGADNITEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  377



>emb|CDX93443.1| BnaA06g06050D [Brassica napus]
Length=384

 Score =   282 bits (721),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  205  ESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGP
Sbjct  265  NRKLAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGP  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  325  HPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  384



>ref|XP_010490870.1| PREDICTED: uncharacterized protein LOC104768553 isoform X2 [Camelina 
sativa]
 ref|XP_010490885.1| PREDICTED: uncharacterized protein LOC104768578 [Camelina sativa]
Length=415

 Score =   282 bits (722),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  236  ESCVPVYNFSTVYNYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  295

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  296  NRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  355

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL+PL  LS  VMGF
Sbjct  356  HPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALDPLMNLSSTVMGF  415



>ref|XP_009144462.1| PREDICTED: uncharacterized protein LOC103868108 isoform X2 [Brassica 
rapa]
Length=404

 Score =   282 bits (721),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  225  ESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  284

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FKK+CRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGP
Sbjct  285  NRKIAIYIISDSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGP  344

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  345  HPATYGADNITEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  404



>ref|XP_010273586.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
 ref|XP_010273587.1| PREDICTED: uncharacterized protein LOC104609074 [Nelumbo nucifera]
Length=405

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVYDF TVYKYL  S +SF++SYDDP+RYGRGRY+ +M PDIKL +WRKGSQWFE+
Sbjct  226  ESCIPVYDFLTVYKYLINSAYSFVDSYDDPSRYGRGRYSRKMLPDIKLFQWRKGSQWFEL  285

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+Y++F+KYC+PSCYPDEHY+PT+L + +G MNANRSVT+VDWS GGP
Sbjct  286  NRTLAVNIVADDKYYSLFRKYCKPSCYPDEHYLPTFLNMFYGSMNANRSVTWVDWSRGGP  345

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITEGFIQSI++NGT+CSYN  +T +CYLFARKF PSALEPL  L+  V+ F
Sbjct  346  HPATFGKEDITEGFIQSIKNNGTTCSYNSEQTLVCYLFARKFAPSALEPLLNLTSTVLRF  405



>ref|XP_009144461.1| PREDICTED: uncharacterized protein LOC103868108 isoform X1 [Brassica 
rapa]
Length=413

 Score =   282 bits (721),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  234  ESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  293

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FKK+CRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGP
Sbjct  294  NRKIAIYIISDSKYYSLFKKFCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGP  353

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  354  HPATYGADNITEGFLQSIRKNDTDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  413



>emb|CDY20644.1| BnaC08g14140D [Brassica napus]
Length=390

 Score =   281 bits (719),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  211  ESCVPVYNFTTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHNWRKGSQWFEV  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK+YCRP+CYPDEHYIPT L + HG +NANRSVT+VDWS+GGP
Sbjct  271  NRKIAIYIISDSKYYSLFKQYCRPACYPDEHYIPTLLNMFHGSVNANRSVTWVDWSIGGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  331  HPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  390



>ref|XP_009148352.1| PREDICTED: uncharacterized protein LOC103871798 [Brassica rapa]
Length=414

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  235  ESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  294

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGP
Sbjct  295  NRKLAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGP  354

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  355  HPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  414



>ref|XP_010475888.1| PREDICTED: uncharacterized protein LOC104755237 [Camelina sativa]
Length=407

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  228  ESCVPVYNFSTVYNYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  287

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  288  NRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  347

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  348  HPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  407



>ref|XP_010490863.1| PREDICTED: uncharacterized protein LOC104768553 isoform X1 [Camelina 
sativa]
Length=415

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  236  ESCVPVYNFSTVYNYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  295

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  296  NRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  355

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  356  HPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  415



>ref|XP_010458365.1| PREDICTED: uncharacterized protein LOC104739637 [Camelina sativa]
Length=419

 Score =   281 bits (720),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  240  ESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  299

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  300  NRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  359

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITE F+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  360  HPATYAAANITEEFLQSIRKNETDCLYNDEPTSLCFLFARKFSPSALAPLMNLSSTVMGF  419



>ref|XP_006385195.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
 gb|ERP62992.1| hypothetical protein POPTR_0003s00960g [Populus trichocarpa]
Length=392

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYL  S +SF+ESYD+PTRYGRGRY+ +M PDI L++WRKGSQWFE+
Sbjct  213  ESCIPIYNFPTVYKYLIRSEYSFVESYDEPTRYGRGRYSRKMLPDIHLYQWRKGSQWFEI  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+ IVS+TK+Y +FKKYCRP+CYPDEHYIPTYL + HG +N+NRSVT+VDWS+GGP
Sbjct  273  QRDLAVYIVSDTKYYTIFKKYCRPACYPDEHYIPTYLNMFHGSLNSNRSVTWVDWSIGGP  332

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y   NITE FIQSIR+NGT CSYN   T +CYLFARKF PSAL PL  L+  VM F
Sbjct  333  HPARYGGGNITEDFIQSIRNNGTQCSYNSEMTSVCYLFARKFAPSALVPLLSLTSTVMEF  392



>ref|XP_006303228.1| hypothetical protein CARUB_v10012092mg [Capsella rubella]
 gb|EOA36126.1| hypothetical protein CARUB_v10012092mg [Capsella rubella]
Length=411

 Score =   281 bits (718),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  232  ESCVPVYNFSTVYTYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  291

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +AI I+S++K+Y++FK++CRP+CYPDEHYIPT+L + HG MNANRSVT+VDWS+GGP
Sbjct  292  NRKIAIYIISDSKYYSLFKQFCRPACYPDEHYIPTFLNMFHGSMNANRSVTWVDWSIGGP  351

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y AANITEGF+ SIR N T C YN   T +C+LFARKF PSAL PL  LS  V+GF
Sbjct  352  HPATYAAANITEGFLLSIRKNETDCLYNEEPTSLCFLFARKFSPSALAPLMNLSSTVLGF  411



>ref|XP_011047853.1| PREDICTED: uncharacterized protein LOC105142093 [Populus euphratica]
 ref|XP_011003712.1| PREDICTED: uncharacterized protein LOC105110387 [Populus euphratica]
Length=392

 Score =   280 bits (716),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/180 (70%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYL  S +SF+ESYD+PTRYGRGRY+ +M PDI L++WRKGSQWFE+
Sbjct  213  ESCIPIYNFPTVYKYLIRSEYSFVESYDEPTRYGRGRYSRKMLPDIHLYQWRKGSQWFEI  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+ IVS+TK+Y +FKKYCRP CYPDEHYIPTYL + HG +N+NRSVT+VDWS+GGP
Sbjct  273  QRDLAVYIVSDTKYYTIFKKYCRPVCYPDEHYIPTYLNMFHGSLNSNRSVTWVDWSIGGP  332

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NITE FIQSIR+NGT CSYN   T +CYLFARKF PSAL PL  L+  VM F
Sbjct  333  HPATYGGGNITEDFIQSIRNNGTQCSYNSEMTSVCYLFARKFAPSALVPLLSLTSTVMEF  392



>emb|CDX94911.1| BnaC05g07600D [Brassica napus]
Length=385

 Score =   280 bits (715),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F TVY YL  S +SF++SYD+PTRYGRGRY+ +M PDIKLH WRKGSQWFE+
Sbjct  206  ESCVPVYNFSTVYSYLINSAYSFVDSYDEPTRYGRGRYSRKMLPDIKLHHWRKGSQWFEV  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+S++K+Y +FK +CRP+CYPDEHYIPT+L + HG +NANRSVT+VDWS+GGP
Sbjct  266  NRKLAIYIISDSKYYLLFKLFCRPACYPDEHYIPTFLNMFHGSVNANRSVTWVDWSIGGP  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NITEGF+QSIR N T C YN   T +C+LFARKF PSAL PL  LS  VMGF
Sbjct  326  HPATYGADNITEGFLQSIRKNETDCLYNEEPTSLCFLFARKFAPSALAPLMNLSSTVMGF  385



>gb|KDP42488.1| hypothetical protein JCGZ_00285 [Jatropha curcas]
Length=392

 Score =   280 bits (716),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYL  S HSF+ESYD+PTRYGRGRYN  M PDI+L++WRKGSQWFE+
Sbjct  213  ESCIPIYNFPTVYKYLIGSEHSFVESYDEPTRYGRGRYNRNMFPDIQLYQWRKGSQWFEI  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             RALA+ ++++TK+Y++FKKYC+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGP
Sbjct  273  QRALAVYVLADTKYYSIFKKYCKPACYPDEHYIPTYLNMFHGPLNSNRTVTWVDWSVGGP  332

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   N+TE FIQSIR+N T CSYN   T +CYLFARKF PSALEPL  L+  VM F
Sbjct  333  HPATYWGINVTESFIQSIRNNETQCSYNSEMTSVCYLFARKFHPSALEPLLNLTSTVMEF  392



>gb|KHN39690.1| hypothetical protein glysoja_020768 [Glycine soja]
Length=266

 Score =   275 bits (703),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I+L  WRKGSQWFE+
Sbjct  87   ESCIPVYNFPTVYRYLTNSSLSFVESYDEPTRYGRGRYSRNMLPHIQLRHWRKGSQWFEL  146

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NRALA+ IVS+T +Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GP
Sbjct  147  NRALAVYIVSDTNYYSLFRKYCKPACYPDEHYIPTFLNMFHGSLNSNRTVTWVDWSMLGP  206

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y  ANIT GFIQSIR+NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  207  HPATYGRANITAGFIQSIRNNGSLCRYNSEITSICYLFARKFDPSALEPLLNLSSEVMNF  266



>ref|XP_004134258.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101215808 
[Cucumis sativus]
Length=394

 Score =   278 bits (712),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL  S HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE+
Sbjct  215  ESCIPVYNFQTVYEYLINSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFEL  274

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RALA+ IV++ K+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGP
Sbjct  275  SRALAVYIVADIKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGP  334

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  335  HPAMYGPANITESFIESIRNNGTECLYNSEITYVCYLFARKFAPSTLEPLLNLTSSVMKF  394



>ref|XP_004163997.1| PREDICTED: uncharacterized LOC101215808 [Cucumis sativus]
 gb|KGN56275.1| hypothetical protein Csa_3G110720 [Cucumis sativus]
Length=394

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL  S HSF+ESYD+PTRYGRGRY+ +M PDIKL  WRKGSQWFE+
Sbjct  215  ESCIPVYNFQTVYEYLINSAHSFVESYDEPTRYGRGRYSRQMLPDIKLQHWRKGSQWFEL  274

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RALA+ IV++ K+Y +FKK+C+P+CYPDEHYIPTYL + HG +N+NR+VT+VDWS+GGP
Sbjct  275  SRALAVYIVADIKYYTLFKKFCKPACYPDEHYIPTYLNMFHGSLNSNRTVTWVDWSMGGP  334

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y  ANITE FI+SIR+NGT C YN   T +CYLFARKF PS LEPL  L+  VM F
Sbjct  335  HPAMYGPANITESFIESIRNNGTECLYNSEITYVCYLFARKFAPSTLEPLLNLTSSVMKF  394



>ref|XP_010065247.1| PREDICTED: uncharacterized protein LOC104452469 [Eucalyptus grandis]
 gb|KCW62594.1| hypothetical protein EUGRSUZ_G00083 [Eucalyptus grandis]
Length=391

 Score =   278 bits (711),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYLT S HSF+ESYDDP+RYGRGRY+  M P I+LH+WRKGSQWFEM
Sbjct  212  ESCIPVYNFPTVYKYLTGSDHSFVESYDDPSRYGRGRYSRSMLPYIRLHQWRKGSQWFEM  271

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA  IVS+TK+Y++F+KYC+P+CYPDEHYIPTYL + HG  N+NRSVT+VDWSLGGP
Sbjct  272  TRNLAAYIVSDTKYYSLFEKYCKPACYPDEHYIPTYLNMFHGSKNSNRSVTWVDWSLGGP  331

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  +NITE FI++IR+N T C YN GKT +CYLFARKF PSAL PL  LS  VM F
Sbjct  332  HPATFRKSNITEDFIRAIRNNATRCWYNSGKTSLCYLFARKFDPSALVPLLNLSSIVMEF  391



>ref|XP_004503749.1| PREDICTED: uncharacterized protein LOC101509636 isoform X2 [Cicer 
arietinum]
Length=350

 Score =   276 bits (706),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYLT S HSF+ESYDDP+RYGRGRY+  M PDI+L  WRKGSQWFE+
Sbjct  171  ESCIPVYNFPTVYKYLTNSAHSFVESYDDPSRYGRGRYSRSMLPDIQLKHWRKGSQWFEL  230

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             RALA+ IVS+T++Y++F+KYC+P+CYPDEHYIPT+L + H  +N+NR+VT+VDWS+ GP
Sbjct  231  KRALAVYIVSDTRYYSLFRKYCKPACYPDEHYIPTFLNMFHASLNSNRTVTWVDWSMLGP  290

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NIT GFIQ+IR+NG+ C YN   T +CYLFARKF P+ALEPL  LS +VM F
Sbjct  291  HPATYGRDNITVGFIQAIRNNGSLCGYNSDTTSLCYLFARKFDPTALEPLLNLSSEVMNF  350



>emb|CAN60261.1| hypothetical protein VITISV_020168 [Vitis vinifera]
Length=430

 Score =   278 bits (712),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VYKYL  S +SF+ESYDDP+RYGRGRY+  M PDIKL++WRKGSQWFE+
Sbjct  228  ESCIPIYNFPIVYKYLINSDYSFVESYDDPSRYGRGRYSRNMLPDIKLYQWRKGSQWFEL  287

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV++TK+Y +FKKYC+PSCYPDEHYI T+L + +G +NANRSVT+VDWS+GGP
Sbjct  288  SRELAVNIVADTKYYTLFKKYCKPSCYPDEHYIQTFLNMFYGSLNANRSVTWVDWSMGGP  347

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
            HPA+  AANITEGFIQ++R+NGT C YN  KT +CYLFARKF PSALEPL  L+ K++
Sbjct  348  HPATLGAANITEGFIQALRNNGTVCPYNSEKTSVCYLFARKFAPSALEPLLNLTSKML  405



>ref|XP_010682059.1| PREDICTED: uncharacterized protein LOC104896962 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   278 bits (710),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYLTESTH+F+ESYDDPTR+GRGRY+  M+P I + +WRKG+QWFE+
Sbjct  242  ESCIPIYNFQTVYKYLTESTHTFVESYDDPTRFGRGRYDRHMRPSIMIDQWRKGAQWFEI  301

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NRAL I I+S+ K+Y +F+KYC P C+PDEHYIPTYL + H   N+NR++T VDWSLGGP
Sbjct  302  NRALGIEIISDYKYYDLFRKYCHPPCFPDEHYIPTYLNIFHAPFNSNRTLTKVDWSLGGP  361

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP ++   NITEGFIQ+IR+N   C YN   T +CYLFARKF PSALEPL  LSLKVMGF
Sbjct  362  HPTTFVRDNITEGFIQNIRNNKKKCLYNSKSTTVCYLFARKFAPSALEPLLDLSLKVMGF  421



>ref|XP_007148589.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
 gb|ESW20583.1| hypothetical protein PHAVU_006G221200g [Phaseolus vulgaris]
Length=392

 Score =   276 bits (707),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVY+YLT+S HSF+ESYDDPTRYGRGRY+  M P I+L  WRKGSQWFE+
Sbjct  213  ESCIPIYNFPTVYRYLTDSAHSFVESYDDPTRYGRGRYSRSMLPHIQLRHWRKGSQWFEL  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR+LA+ I+S+TK+Y +F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GP
Sbjct  273  NRSLAVYIISDTKYYTLFRKYCKPACYPDEHYIPTFLNMFHGPLNSNRTVTWVDWSMLGP  332

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPAS+  ANIT  FIQ+IR+NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  333  HPASFGRANITAHFIQAIRNNGSLCRYNSEMTSICYLFARKFDPSALEPLLNLSSQVMNF  392



>ref|XP_006598780.1| PREDICTED: uncharacterized protein LOC100796634 isoform X1 [Glycine 
max]
 ref|XP_006598781.1| PREDICTED: uncharacterized protein LOC100796634 isoform X2 [Glycine 
max]
 ref|XP_006598782.1| PREDICTED: uncharacterized protein LOC100796634 isoform X3 [Glycine 
max]
 ref|XP_006598783.1| PREDICTED: uncharacterized protein LOC100796634 isoform X4 [Glycine 
max]
 ref|XP_006598784.1| PREDICTED: uncharacterized protein LOC100796634 isoform X5 [Glycine 
max]
 ref|XP_006598785.1| PREDICTED: uncharacterized protein LOC100796634 isoform X6 [Glycine 
max]
Length=394

 Score =   276 bits (706),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 124/180 (69%), Positives = 151/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I+L  WRKGSQWFE+
Sbjct  215  ESCIPVYNFPTVYRYLTNSSLSFVESYDEPTRYGRGRYSRNMLPHIQLRHWRKGSQWFEL  274

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NRALA+ IVS+T +Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GP
Sbjct  275  NRALAVYIVSDTNYYSLFRKYCKPACYPDEHYIPTFLNMFHGSLNSNRTVTWVDWSMLGP  334

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y  ANIT GFIQSIR+NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  335  HPATYGRANITAGFIQSIRNNGSLCRYNSEITSICYLFARKFDPSALEPLLNLSSEVMNF  394



>gb|ABE91847.1| Protein of unknown function DUF266, plant [Medicago truncatula]
 gb|ABE91963.1| Protein of unknown function DUF266, plant [Medicago truncatula]
 gb|KEH36410.1| core-2/I-branching enzyme [Medicago truncatula]
Length=438

 Score =   277 bits (709),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 152/180 (84%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL +S HSF+ESYDDP+RYGRGRY+  M PDI+L  WRKGSQWFE+
Sbjct  259  ESCIPVYNFPTVYRYLIDSAHSFVESYDDPSRYGRGRYSRNMLPDIQLKHWRKGSQWFEL  318

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NRALA+ IVS+T+++++F+KYC+P+CYPDEHY+PT+L + HG +N+NR+VT+VDWS+ GP
Sbjct  319  NRALAVYIVSDTQYFSLFRKYCKPACYPDEHYLPTFLNMFHGSLNSNRTVTWVDWSMLGP  378

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NIT GFIQ+IR+NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  379  HPATYGRDNITVGFIQAIRNNGSLCPYNSDMTSICYLFARKFDPSALEPLLDLSSEVMNF  438



>ref|XP_004503748.1| PREDICTED: uncharacterized protein LOC101509636 isoform X1 [Cicer 
arietinum]
Length=420

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYLT S HSF+ESYDDP+RYGRGRY+  M PDI+L  WRKGSQWFE+
Sbjct  241  ESCIPVYNFPTVYKYLTNSAHSFVESYDDPSRYGRGRYSRSMLPDIQLKHWRKGSQWFEL  300

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             RALA+ IVS+T++Y++F+KYC+P+CYPDEHYIPT+L + H  +N+NR+VT+VDWS+ GP
Sbjct  301  KRALAVYIVSDTRYYSLFRKYCKPACYPDEHYIPTFLNMFHASLNSNRTVTWVDWSMLGP  360

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NIT GFIQ+IR+NG+ C YN   T +CYLFARKF P+ALEPL  LS +VM F
Sbjct  361  HPATYGRDNITVGFIQAIRNNGSLCGYNSDTTSLCYLFARKFDPTALEPLLNLSSEVMNF  420



>gb|KHN11046.1| hypothetical protein glysoja_044070, partial [Glycine soja]
Length=308

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIPVYDF TVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I L  WRKGSQWFE+
Sbjct  129  ETCIPVYDFPTVYRYLTHSSLSFVESYDEPTRYGRGRYSRHMLPHIHLRHWRKGSQWFEL  188

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR+LA+ IVS+TK+Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GP
Sbjct  189  NRSLAVYIVSDTKYYSLFRKYCKPACYPDEHYIPTFLHMFHGSLNSNRTVTWVDWSMLGP  248

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ANIT  F+QSIR+NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  249  HPATFGRANITAAFLQSIRNNGSLCPYNSEMTSICYLFARKFDPSALEPLLNLSSEVMNF  308



>ref|XP_008218660.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218661.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
 ref|XP_008218662.1| PREDICTED: uncharacterized protein LOC103318965 [Prunus mume]
Length=393

 Score =   274 bits (700),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  S HSF+ESYDDP RYGRGRY+ +M P+I+L++WRKGSQWFE+
Sbjct  214  ESCIPVYNFPTVYKYLIGSNHSFVESYDDPGRYGRGRYSRKMLPEIELYQWRKGSQWFEL  273

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IVSETK+Y +F +YC P+CYPDEHY+PTY  + HG +N+NR+VT+VDWSLGGP
Sbjct  274  SRTLAIYIVSETKYYTLFSRYCMPACYPDEHYMPTYFNMFHGSLNSNRTVTWVDWSLGGP  333

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NITE F++SIR+NG  C YN   T ICYLFARKF PSALEPL +L+  VM F
Sbjct  334  HPATYGGDNITEDFVRSIRNNGALCQYNSEMTSICYLFARKFAPSALEPLLELASSVMEF  393



>gb|KDO42566.1| hypothetical protein CISIN_1g039454mg, partial [Citrus sinensis]
Length=214

 Score =   267 bits (683),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 149/181 (82%), Gaps = 1/181 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM
Sbjct  34   ESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEM  93

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R +AI I+S+TK+  +F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT+VDWS+ GP
Sbjct  94   QRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGP  153

Query  298  HPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL K+S KVM 
Sbjct  154  HPAMYKKENITEEFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPLLKISSKVME  213

Query  121  F  119
            F
Sbjct  214  F  214



>ref|XP_003540132.1| PREDICTED: uncharacterized protein LOC100793763 [Glycine max]
Length=383

 Score =   273 bits (697),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIPVYDF TVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I L  WRKGSQWFE+
Sbjct  204  ETCIPVYDFPTVYRYLTHSSLSFVESYDEPTRYGRGRYSRHMLPHIHLRHWRKGSQWFEL  263

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR+LA+ IVS+TK+Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+VT+VDWS+ GP
Sbjct  264  NRSLAVYIVSDTKYYSLFRKYCKPACYPDEHYIPTFLHMFHGSLNSNRTVTWVDWSMLGP  323

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ANIT  F+QSIR+NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  324  HPATFGRANITAAFLQSIRNNGSLCPYNSEMTSICYLFARKFDPSALEPLLNLSSEVMNF  383



>ref|XP_007221893.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
 gb|EMJ23092.1| hypothetical protein PRUPE_ppa016090mg [Prunus persica]
Length=393

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  S HSF+ESYDDP RYGRGRY+ +M P+I+L++WRKGSQWFE+
Sbjct  214  ESCIPVYNFPTVYKYLIGSNHSFVESYDDPGRYGRGRYSRKMLPEIELYQWRKGSQWFEL  273

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IVSETK+Y +F +YC P+CYPDEHY+PTY  + HG +N+NR+VT+VDWSLGGP
Sbjct  274  SRTLAIYIVSETKYYTLFSRYCLPACYPDEHYMPTYFNMFHGSLNSNRTVTWVDWSLGGP  333

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NITE F++SIR++G  C YN   T ICYLFARKF PSALEPL +L+  VM F
Sbjct  334  HPATYGGDNITEDFVRSIRNSGALCQYNSEMTSICYLFARKFAPSALEPLLELASSVMEF  393



>ref|XP_009800326.1| PREDICTED: uncharacterized protein LOC104246253 isoform X2 [Nicotiana 
sylvestris]
Length=391

 Score =   271 bits (693),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGR--YNTRMKPDIKLHEWRKGSQWF  485
            +SCIP+Y F TVYKYL  S HSF+ESYDDP+ YGRGR  YN  M+PDIKL +WRKGSQWF
Sbjct  210  DSCIPLYSFPTVYKYLIGSIHSFVESYDDPSSYGRGRGRYNHHMQPDIKLSDWRKGSQWF  269

Query  484  EMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLG  305
            EMNR LA+ IV +TK+Y +F+KYC P+CYPDEHYIPTY++L +G  NANR+VTYVDWSLG
Sbjct  270  EMNRKLAVRIVLDTKYYNIFRKYCTPTCYPDEHYIPTYIRLFYGPSNANRTVTYVDWSLG  329

Query  304  GPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
              HPA+++A NITEGFI+S+R+NG +CSYN  K  ICYLFAR F PSAL+PL  LS KV+
Sbjct  330  ASHPATFSAVNITEGFIESLRNNGAACSYNSEKAHICYLFARMFDPSALKPLLNLSSKVL  389

Query  124  GF  119
             F
Sbjct  390  KF  391



>ref|XP_009800325.1| PREDICTED: uncharacterized protein LOC104246253 isoform X1 [Nicotiana 
sylvestris]
Length=392

 Score =   271 bits (693),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 124/182 (68%), Positives = 149/182 (82%), Gaps = 2/182 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGR--YNTRMKPDIKLHEWRKGSQWF  485
            +SCIP+Y F TVYKYL  S HSF+ESYDDP+ YGRGR  YN  M+PDIKL +WRKGSQWF
Sbjct  211  DSCIPLYSFPTVYKYLIGSIHSFVESYDDPSSYGRGRGRYNHHMQPDIKLSDWRKGSQWF  270

Query  484  EMNRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLG  305
            EMNR LA+ IV +TK+Y +F+KYC P+CYPDEHYIPTY++L +G  NANR+VTYVDWSLG
Sbjct  271  EMNRKLAVRIVLDTKYYNIFRKYCTPTCYPDEHYIPTYIRLFYGPSNANRTVTYVDWSLG  330

Query  304  GPHPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
              HPA+++A NITEGFI+S+R+NG +CSYN  K  ICYLFAR F PSAL+PL  LS KV+
Sbjct  331  ASHPATFSAVNITEGFIESLRNNGAACSYNSEKAHICYLFARMFDPSALKPLLNLSSKVL  390

Query  124  GF  119
             F
Sbjct  391  KF  392



>ref|XP_009601484.1| PREDICTED: uncharacterized protein LOC104096770 [Nicotiana tomentosiformis]
Length=402

 Score =   271 bits (693),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  S HSF+ESYDDP+RYGRGRYN RMKPDIKL +WRKGSQWFEM
Sbjct  223  ESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRRMKPDIKLSDWRKGSQWFEM  282

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +VS+TK+Y MF++ C P+CYPDEHYIPT+++L +G +NANR+VTYVDWS+GGP
Sbjct  283  NRTLAVRVVSDTKYYDMFRRLCTPACYPDEHYIPTFIRLFYGPLNANRTVTYVDWSVGGP  342

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++ A NITEGF+QSIR+NGT+CSYN  K+ ICYLFARKF PSALEPL  LS  V+ F
Sbjct  343  HPATFGAVNITEGFLQSIRNNGTACSYNSEKSHICYLFARKFEPSALEPLLNLSSSVLEF  402



>ref|XP_011028389.1| PREDICTED: uncharacterized protein LOC105128426 [Populus euphratica]
Length=392

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y F  VYKYL  S HSF+ESYD PTRY RGRYN +M PDI L++WRKGSQWFE+
Sbjct  213  ESCIPIYKFSIVYKYLIRSKHSFVESYDAPTRYARGRYNQKMLPDIHLYQWRKGSQWFEI  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+ +VS+TK++ +FKKYCRP+CYPDEHYIPTYL + HG +NANR+VT+VDWS+  P
Sbjct  273  QRELAVYLVSDTKYHTIFKKYCRPACYPDEHYIPTYLNMFHGSLNANRTVTWVDWSIVAP  332

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP +Y   +ITEGFIQSIR+ G  CSYN   T +CYLFARKF PSAL PL  L+  VMGF
Sbjct  333  HPPTYDGIDITEGFIQSIRNKGNHCSYNSEMTSVCYLFARKFAPSALVPLLNLTSTVMGF  392



>gb|ACU18530.1| unknown [Glycine max]
Length=383

 Score =   270 bits (689),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIPVYDF TVY+YLT S+ SF+ESYD+PTRYGRGRY+  M P I L  WRKGSQWFE+
Sbjct  204  ETCIPVYDFPTVYRYLTHSSLSFVESYDEPTRYGRGRYSRHMLPHIHLRHWRKGSQWFEL  263

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR+LA+ IVS+TK+Y++F+KYC+P+CYPDEHYIPT+L + HG +N+NR+ T+VDWS+ GP
Sbjct  264  NRSLAVYIVSDTKYYSLFRKYCKPACYPDEHYIPTFLHMFHGSLNSNRTDTWVDWSMLGP  323

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ANIT  F+QSIR+NG+ C YN   T ICYLFARKF PSALEPL  LS +VM F
Sbjct  324  HPATFGRANITAAFLQSIRNNGSLCPYNSEMTSICYLFARKFDPSALEPLLNLSSEVMNF  383



>ref|XP_006385074.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
 gb|ERP62871.1| hypothetical protein POPTR_0004s23660g [Populus trichocarpa]
Length=392

 Score =   270 bits (689),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/180 (66%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y F  VYKYL  S HSF+ESYD PTRY RGRYN +M PDI L++WRKGSQWFE+
Sbjct  213  ESCIPIYKFSIVYKYLIRSKHSFVESYDAPTRYARGRYNQKMLPDIHLYQWRKGSQWFEI  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+ +VS+TK++ +FKKYCRP+CYPDEHYIPTYL + HG +NANR+VT+VDWS+  P
Sbjct  273  QRDLAVYLVSDTKYHTIFKKYCRPACYPDEHYIPTYLNMFHGSLNANRTVTWVDWSIVAP  332

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP +Y   ++TEGFIQSIR+ G  CSYN   T +CYLFARKF PSAL PL  L+  VMGF
Sbjct  333  HPPTYDGIDVTEGFIQSIRNKGNQCSYNSEMTSVCYLFARKFAPSALVPLLNLTSTVMGF  392



>ref|XP_006431491.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
 gb|ESR44731.1| hypothetical protein CICLE_v10001419mg [Citrus clementina]
Length=393

 Score =   268 bits (686),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 123/181 (68%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM
Sbjct  213  ESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEM  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R +AI I+S+TK+ ++F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT+VDWS+ GP
Sbjct  273  QRKVAIYIISDTKYLSLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGP  332

Query  298  HPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL K+S KVM 
Sbjct  333  HPAMYKKENITEEFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPLLKISSKVME  392

Query  121  F  119
            F
Sbjct  393  F  393



>ref|XP_010682058.1| PREDICTED: uncharacterized protein LOC104896961 [Beta vulgaris 
subsp. vulgaris]
Length=425

 Score =   270 bits (689),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 132/180 (73%), Positives = 155/180 (86%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKY+TES HSF+ESYDDP+RYGRGRY+ RM PDIKL +WRKGSQWFE+
Sbjct  246  ESCIPVYNFQTVYKYITESVHSFVESYDDPSRYGRGRYSRRMGPDIKLRQWRKGSQWFEI  305

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R+LAI I+S+ K+Y +F+KYC PSCYPDEHYIPTYLQ+ H  +N+NR+VT+VDWSLGGP
Sbjct  306  TRSLAIEIISDYKYYDLFRKYCHPSCYPDEHYIPTYLQIFHPLLNSNRTVTWVDWSLGGP  365

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPAS+   NITEGFIQ+IR+NGT C YN  +T ICYLFARKF PSALEPL  +S KVMGF
Sbjct  366  HPASFGRENITEGFIQNIRNNGTECWYNFQRTPICYLFARKFDPSALEPLLNISSKVMGF  425



>ref|XP_009791972.1| PREDICTED: uncharacterized protein LOC104239130 [Nicotiana sylvestris]
Length=403

 Score =   269 bits (687),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/180 (72%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYL  S HSF+ESYDDP+RYGRGRYN RMKPDIKL +WRKGSQWFEM
Sbjct  224  ESCIPVYNFPTVYKYLIGSIHSFVESYDDPSRYGRGRYNRRMKPDIKLSDWRKGSQWFEM  283

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +VS+TK+Y +F++ C P+CYPDEHYIPT+++L +G +NANR+VTYVDWSLGGP
Sbjct  284  NRTLAVRVVSDTKYYDIFRRLCTPACYPDEHYIPTFIRLFYGPLNANRTVTYVDWSLGGP  343

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+++A NITEGF++SIR+NGT+CSYN  KT +C+LFARKF PSALEPL  LS  V+ F
Sbjct  344  HPATFSAVNITEGFLKSIRNNGTACSYNYEKTHVCHLFARKFEPSALEPLLNLSSNVLEF  403



>ref|XP_010553652.1| PREDICTED: uncharacterized protein LOC104823674 [Tarenaya hassleriana]
Length=402

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 146/180 (81%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F TVY+YL  S +SF+ESYD+PTRYGRGRY+ +M P IKLH+WRKGSQWFE 
Sbjct  224  ESCIPIHNFPTVYRYLIGSNYSFVESYDEPTRYGRGRYSRKMLPHIKLHQWRKGSQWFEA  283

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR +A  I+S+TK+Y++FKKYCRP+CYPDEHYIPT+L + HG  NANR+VT+VDWS GGP
Sbjct  284  NRKIATYIISDTKYYSLFKKYCRPACYPDEHYIPTFLNMFHGSDNANRTVTWVDWSFGGP  343

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A NITE FIQ IRSNG SC YN   T +CYLFARKF P+AL PL  LS  VM F
Sbjct  344  HPARYNAENITESFIQQIRSNG-SCLYNGEVTSLCYLFARKFAPNALAPLMNLSSTVMEF  402



>ref|XP_009414639.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414640.1| PREDICTED: uncharacterized protein LOC103995706 [Musa acuminata 
subsp. malaccensis]
Length=386

 Score =   266 bits (680),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 148/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL  S HSF+ESYD+ ++ GRGRY+  M P IKLH+WRKGS+WFE+
Sbjct  207  ESCIPVYNFPTVYEYLINSAHSFVESYDENSQQGRGRYSRHMFPTIKLHQWRKGSEWFEL  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V++ K+Y++F KYC+PSCYPDEHYIPT+L + HG +NANR++T+VDWS GGP
Sbjct  267  NRELAVNVVADYKYYSIFSKYCKPSCYPDEHYIPTFLNMFHGSLNANRTITWVDWSRGGP  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A NIT  FIQSIR+NGTSC YN   T +C+LFARKF PS+L+PL  L+  VMGF
Sbjct  327  HPATYGAPNITPDFIQSIRNNGTSCMYNSRPTSVCFLFARKFAPSSLDPLLNLTSTVMGF  386



>ref|XP_009399147.1| PREDICTED: uncharacterized protein LOC103983624 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   266 bits (679),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY F TVY+YL  S HSF++SYD   +  RGRYN RM P IKL +WRKGS+WFE+
Sbjct  208  ESCIPVYSFPTVYEYLVNSAHSFVDSYDKDIQQARGRYNWRMSPKIKLSQWRKGSEWFEL  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV+E  +Y++F+KYC+PSCYPDEHYIPTYL + HG +NANRSVT+VDWS GG 
Sbjct  268  NRGLAIDIVAEHTYYSLFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRSVTWVDWSRGGS  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y AANIT  FIQSIR+NGTSC YN   T +C+LFARKF PSAL PL  +S  VMGF
Sbjct  328  HPARYGAANITVEFIQSIRNNGTSCMYNSRSTSVCFLFARKFAPSALAPLLNVSSTVMGF  387



>gb|EPS73540.1| hypothetical protein M569_01216 [Genlisea aurea]
Length=466

 Score =   267 bits (683),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+YDF TVY+YL  S  SFI+SYDDP+R GRGRY++ MKP ++L EWRKGS+WFEM
Sbjct  286  ESCIPIYDFKTVYRYLVGSKQSFIQSYDDPSRQGRGRYSSWMKPYVRLSEWRKGSEWFEM  345

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IVSETK+Y++F++YC+PSCYPDEHYIPTY+   +G +NANRSVTYVDWSL GP
Sbjct  346  HRDLAVRIVSETKYYSVFRRYCKPSCYPDEHYIPTYVAKFYGILNANRSVTYVDWSLMGP  405

Query  298  HPASYTAANITEGFIQSIRSNGT-SCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA++TAAN+T GFI+S+RSN T  CSYN G T +C+LFARKF   AL+PL  ++   MG
Sbjct  406  HPATFTAANVTRGFIESLRSNATRRCSYNAGTTPVCFLFARKFDSGALQPLLDVASGTMG  465

Query  121  F  119
            F
Sbjct  466  F  466



>ref|XP_008357658.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357660.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357661.1| PREDICTED: uncharacterized protein LOC103421405 [Malus domestica]
 ref|XP_008357662.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
 ref|XP_008357663.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
 ref|XP_008357664.1| PREDICTED: uncharacterized protein LOC103421406 [Malus domestica]
Length=390

 Score =   265 bits (677),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYL  S HS++ESYD+P RYGRGRY+  M PDI+L++WRKGSQWFE+
Sbjct  211  ESCIPIYNFPTVYKYLIGSNHSYVESYDNPGRYGRGRYSREMFPDIQLYQWRKGSQWFEL  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RAL++  VSETK+Y +F KYC P+CYPDEHY+PTY  + HG++N+NR+VT+VDWSLGGP
Sbjct  271  SRALSVYJVSETKYYTIFSKYCLPACYPDEHYLPTYFNMFHGWLNSNRTVTWVDWSLGGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NITE F++SIR+NG  C YN   T ICYLFARKF P+AL PL + +  VM +
Sbjct  331  HPATYGGDNITEDFVRSIRNNGALCQYNAEMTSICYLFARKFAPTALGPLLEFAASVMEY  390



>ref|XP_009355369.1| PREDICTED: uncharacterized protein LOC103946396 [Pyrus x bretschneideri]
 ref|XP_009355370.1| PREDICTED: uncharacterized protein LOC103946396 [Pyrus x bretschneideri]
Length=390

 Score =   265 bits (676),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYL  S HS++ESYD+P RYGRGRY+  M PDI+L++WRKGSQWFE+
Sbjct  211  ESCIPIYNFPTVYKYLIGSNHSYVESYDNPGRYGRGRYSREMFPDIQLYQWRKGSQWFEL  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RAL++ IVSET++Y +F KYC P+CYPDEHY+PTY  + HG++N+NR+VT+VDWSLGGP
Sbjct  271  SRALSVYIVSETRYYTIFSKYCLPACYPDEHYLPTYFNMFHGWLNSNRTVTWVDWSLGGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   NITE F++SIR+NG  C YN   T ICYLFARKF P+AL PL + +  VM +
Sbjct  331  HPATYGGDNITEDFVRSIRNNGALCQYNAEMTSICYLFARKFAPTALGPLLEFAASVMEY  390



>ref|XP_009410706.1| PREDICTED: uncharacterized protein LOC103992641 [Musa acuminata 
subsp. malaccensis]
Length=391

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL  S HSF+ESYD+ TR GRGRY+ RM P I L++WRKGS+WFE+
Sbjct  212  ESCIPVYNFPTVYEYLINSAHSFVESYDENTRQGRGRYSWRMAPKIMLYQWRKGSEWFEL  271

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV+E K+Y +F+KYC+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GG 
Sbjct  272  NRELATNIVAEHKYYPLFRKYCKPSCYPDEHYIPTYLNMFHGALNANRSLTWVDWSRGGS  331

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A NIT  FIQSIR+NGT C YN   T IC+LFARKF PSAL PL  L+  VMGF
Sbjct  332  HPARYGAPNITVEFIQSIRNNGTFCLYNSVPTSICFLFARKFAPSALAPLLNLTSTVMGF  391



>ref|XP_006470991.1| PREDICTED: uncharacterized protein LOC102625510 isoform X2 [Citrus 
sinensis]
Length=392

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 146/178 (82%), Gaps = 1/178 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM
Sbjct  213  ESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEM  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R +AI I+S+TK+  +F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT+VDWS+ GP
Sbjct  273  QRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGP  332

Query  298  HPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  128
            HP  Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL K+S KV
Sbjct  333  HPVMYKKENITEQFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPLLKISSKV  390



>ref|XP_010927836.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927837.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
 ref|XP_010927838.1| PREDICTED: uncharacterized protein LOC105049787 [Elaeis guineensis]
Length=388

 Score =   262 bits (669),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL  S HSF+ESYD+ +  GRGRYN  M P IKL++WRKGS+WFE+
Sbjct  209  ESCIPVYNFPTVYEYLINSEHSFVESYDEDSPQGRGRYNRYMAPHIKLYQWRKGSEWFEL  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V++ K+YA+F+KYC+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GGP
Sbjct  269  NRELAVTMVADYKYYALFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRSLTWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y A +IT GFIQ+IR+NGT C YN   T IC+LFARKF P+ALE L  L+  VM F
Sbjct  329  HPATYGAPSITAGFIQAIRNNGTFCMYNSRPTSICFLFARKFAPNALESLLNLTSTVMDF  388



>ref|XP_006836850.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
 gb|ERM99703.1| hypothetical protein AMTR_s00099p00078200 [Amborella trichopoda]
Length=401

 Score =   262 bits (670),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 146/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVY YL  S  SF++SYDDP+RYGRGRY+  M PDIKLH+WRKGSQWFE 
Sbjct  222  ESCIPMYNFPTVYNYLITSKESFVDSYDDPSRYGRGRYSRNMAPDIKLHQWRKGSQWFEA  281

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +A+ IVS++K+Y +FKKYC+PSCYPDEHYIPTYL + +G +N+NRSVT+VDWS GGP
Sbjct  282  HRDVAVNIVSDSKYYTIFKKYCKPSCYPDEHYIPTYLNMFYGSLNSNRSVTWVDWSRGGP  341

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE FI +IR+NGT+C +N   T +CYLFARKF PSAL PL  LS  VM F
Sbjct  342  HPATFGGPDITEDFIFAIRNNGTTCFHNSEPTSLCYLFARKFAPSALGPLLNLSSTVMEF  401



>ref|XP_006470990.1| PREDICTED: uncharacterized protein LOC102625510 isoform X1 [Citrus 
sinensis]
Length=404

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 145/177 (82%), Gaps = 1/177 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVYKYLT S +SF+ESYDDP+RYGRGRY+  M+PDIK+++WRKGSQWFEM
Sbjct  213  ESCIPIYNFPTVYKYLTGSPYSFVESYDDPSRYGRGRYSRWMRPDIKIYQWRKGSQWFEM  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R +AI I+S+TK+  +F+KYC+PSCYPDEHYIPTYL + HG + ANRSVT+VDWS+ GP
Sbjct  273  QRKVAIYIISDTKYLTLFRKYCKPSCYPDEHYIPTYLNIFHGSLMANRSVTWVDWSMLGP  332

Query  298  HPASYTAANITEGFIQSIR-SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLK  131
            HP  Y   NITE FIQS+R SNG+ C YN  +T  CYLFARKF P+ LEPL K+S K
Sbjct  333  HPVMYKKENITEQFIQSLRNSNGSLCLYNEQRTSRCYLFARKFAPNTLEPLLKISSK  389



>ref|XP_008812747.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
 ref|XP_008812748.1| PREDICTED: uncharacterized protein LOC103723571 [Phoenix dactylifera]
Length=388

 Score =   260 bits (664),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVY+YL  S HSF+ESYD+ +  GRGRY+  M P IKL++WRKGS+WFE+
Sbjct  209  ESCIPVYNFPTVYEYLINSEHSFVESYDEDSPQGRGRYSRYMAPHIKLYQWRKGSEWFEL  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V++ K+Y +F+KYCRPSCYPDEHYIPTYL + HG +NANRSVT+VDWS GGP
Sbjct  269  NRELAVTVVADYKYYTLFRKYCRPSCYPDEHYIPTYLNMFHGSLNANRSVTWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A  IT  FIQ+IR+NGT C YN   T IC+LFARKF P+ALE L  L+  VMGF
Sbjct  329  HPARYGAPTITAEFIQAIRNNGTFCMYNSRPTSICFLFARKFAPNALESLLNLTSSVMGF  388



>ref|XP_010907977.1| PREDICTED: uncharacterized protein LOC105034483 [Elaeis guineensis]
Length=388

 Score =   259 bits (661),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 145/180 (81%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VY+YL  S HSF+ESYD+ +  GRGRY   M P IKL++WRKGS+WFE+
Sbjct  209  ESCIPIYNFPAVYEYLINSHHSFVESYDEDSLQGRGRYRRGMSPHIKLYQWRKGSEWFEL  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+YA+F+K+C+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GGP
Sbjct  269  NRELAVTIVADYKYYAIFRKHCKPSCYPDEHYIPTYLNMFHGSLNANRSLTWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A+N+T  FIQ++R+NGT C YN   T IC+LFARKF P+ALEPL  L+  VMGF
Sbjct  329  HPARYGASNVTPEFIQALRNNGTFCMYNSRPTSICFLFARKFAPNALEPLLNLTSTVMGF  388



>ref|XP_006659748.1| PREDICTED: uncharacterized protein LOC102714034 [Oryza brachyantha]
Length=372

 Score =   258 bits (659),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  193  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFEL  252

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR+VT+VDWS GGP
Sbjct  253  NRELAVQIVADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTVTWVDWSRGGP  312

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y AANITE FIQ+IR+NGTSC+YN   T +CYLFARKF PSAL PL  L+  V+ F
Sbjct  313  HPARYGAANITEEFIQAIRNNGTSCTYNSKPTSLCYLFARKFAPSALGPLMNLTSTVLDF  372



>gb|EYU33292.1| hypothetical protein MIMGU_mgv1a007588mg [Erythranthe guttata]
Length=402

 Score =   259 bits (661),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 125/180 (69%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E CIP+Y+F TV+KYLTES HSFI+SYDDP+RYGRGRYN RM+PDI+L EWRKGSQWFE 
Sbjct  223  ERCIPIYNFATVHKYLTESLHSFIDSYDDPSRYGRGRYNRRMQPDIRLAEWRKGSQWFEA  282

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV++ K+Y++F+KYCRPSCYPDEHYIPTY++  +G +N+NRS+TYVDWS+ GP
Sbjct  283  HRTLAVKIVADFKYYSIFRKYCRPSCYPDEHYIPTYVRKFYGALNSNRSLTYVDWSMMGP  342

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++TA NIT  F+Q +R+NGT CSYN  KT ICYLFARKF  SALEPL  +S +VMGF
Sbjct  343  HPATFTAVNITTQFLQLLRNNGTMCSYNSEKTNICYLFARKFDESALEPLLSISSQVMGF  402



>ref|XP_008775897.1| PREDICTED: uncharacterized protein LOC103696141 [Phoenix dactylifera]
Length=391

 Score =   258 bits (660),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 145/180 (81%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F  VY+YL  S HSF+ESYDD +  GRGRY+  M P IKL++WRKGS+WFE+
Sbjct  213  ESCIPVHNFPAVYEYLINSEHSFVESYDDDSSQGRGRYSRYMAPHIKLYQWRKGSEWFEL  272

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ ++YA+F+KYC+PSCYPDEHYIPTYL + HG +NANRS+T+VDWS GGP
Sbjct  273  NRDLAVTIVADYRYYAIFRKYCKPSCYPDEHYIPTYLNMFHGSLNANRSLTWVDWSRGGP  332

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A NIT  FIQ+IR+NGT C YN   T +C+LFARKF P+ALEPL  L+  VMGF
Sbjct  333  HPARYGAPNITAEFIQAIRNNGTFCMYNSRPTSVCFLFARKFAPNALEPLLNLT-SVMGF  391



>ref|XP_004301567.1| PREDICTED: uncharacterized protein LOC101308879 [Fragaria vesca 
subsp. vesca]
Length=407

 Score =   259 bits (661),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 144/180 (80%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F TVYKYLT S +SF+ESYDD  R+GRGRY+ RM PDI+L++WRKGSQWFE+
Sbjct  228  ESCIPVYNFPTVYKYLTGSKYSFVESYDDAGRFGRGRYSRRMLPDIQLYQWRKGSQWFEL  287

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA IIV++ ++Y +F KYC P+CYPDEHY+ TY  + HG +N+NR+VT+VDWS+GGP
Sbjct  288  SRTLAAIIVADVRYYTVFSKYCLPACYPDEHYMATYFNMFHGSLNSNRTVTWVDWSVGGP  347

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y   N+TE F++SIR+NG  C YN   T IC LFARKF P+ALEPL +L+  VM F
Sbjct  348  HPAMYGGENVTEDFVRSIRNNGALCQYNSEMTSICNLFARKFAPTALEPLLELASSVMEF  407



>ref|XP_010099779.1| hypothetical protein L484_010966 [Morus notabilis]
 gb|EXB80397.1| hypothetical protein L484_010966 [Morus notabilis]
Length=395

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 150/180 (83%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F T+Y YL  ST SF+++YD+PTRYGRGRY+ RM PDIKL++WRKGSQWFE+
Sbjct  216  ESCIPVYNFSTIYNYLIGSTQSFVQAYDEPTRYGRGRYSRRMLPDIKLYQWRKGSQWFEL  275

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NRALA+ IVS+TK+Y +FKKYC P+CYPDEHY+PTY+ + HG +N+NR+VT+V+WS+GGP
Sbjct  276  NRALAVYIVSDTKYYTLFKKYCLPACYPDEHYLPTYINMFHGPLNSNRTVTWVNWSIGGP  335

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP +Y  AN+T  FIQ+IR+NGT C YN   T ICYLFARKF PSALEPL  LS  VM F
Sbjct  336  HPVTYGEANVTVDFIQAIRNNGTPCQYNTQTTSICYLFARKFAPSALEPLLNLSSSVMKF  395



>emb|CDO97644.1| unnamed protein product [Coffea canephora]
Length=400

 Score =   254 bits (649),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/179 (69%), Positives = 152/179 (85%), Gaps = 1/179 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY+F  VY YLT S HSF++SYDDP+RYGRGRY+ RM+PDI+L +WRKGSQWFE+
Sbjct  220  ESCIPVYNFPAVYGYLTGSMHSFVQSYDDPSRYGRGRYSRRMQPDIRLADWRKGSQWFEL  279

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA I+V+ETK+Y++FKK+CRPSCYPDEHY+PT+L   +G  NANR+VTYVDWS+  P
Sbjct  280  NRYLAAIVVAETKYYSIFKKHCRPSCYPDEHYLPTFLHKFYGATNANRTVTYVDWSVIAP  339

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYN-RGKTQICYLFARKFFPSALEPLEKLSLKVM  125
            HP ++TA N+TEGFI+SIR+NGT+CSYN +  T +CYLFARKF P ALEPL  LS +VM
Sbjct  340  HPGTFTAVNVTEGFIRSIRNNGTACSYNLKSTTTVCYLFARKFTPDALEPLLNLSSEVM  398



>gb|EAZ41277.1| hypothetical protein OsJ_25784 [Oryza sativa Japonica Group]
Length=295

 Score =   251 bits (641),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  116  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFEL  175

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ I+++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  176  NRELALRIIADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGP  235

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A+NI+E FIQ+IR+NGT C+YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  236  HPARYGASNISEEFIQAIRNNGTRCTYNSKPTSVCYLFARKFAPSALGPLMNLTSTILDF  295



>ref|XP_009411881.1| PREDICTED: uncharacterized protein LOC103993515 [Musa acuminata 
subsp. malaccensis]
Length=387

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 143/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PVY+F +VY+YL  S HSF+ESYD+ +  GRGRY+  M P+I+ ++W KGS+WFE+
Sbjct  208  ESCVPVYNFPSVYEYLINSAHSFVESYDEDSPQGRGRYSQNMAPEIQEYQWMKGSEWFEL  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+Y++F+KYC+PSCYPDEHYIPTYL + HG +NANRSVT+VDWS GGP
Sbjct  268  NRELAVNIVADYKYYSIFRKYCKPSCYPDEHYIPTYLNMFHGALNANRSVTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y   NIT GFIQ+IR+N T C YN   T IC+LFARKF PSAL PL  ++  VMGF
Sbjct  328  HPARYGDPNITVGFIQAIRNNATFCMYNSRPTPICFLFARKFAPSALVPLLDMASTVMGF  387



>gb|EAZ05353.1| hypothetical protein OsI_27557 [Oryza sativa Indica Group]
Length=407

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  228  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFEL  287

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ I+++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  288  NRELALRIIADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGP  347

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A+NI+E FIQ+IR+NGT C+YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  348  HPARYGASNISEEFIQAIRNNGTRCTYNSKPTSVCYLFARKFAPSALGPLMNLTSTILDF  407



>ref|NP_001060819.1| Os08g0110400 [Oryza sativa Japonica Group]
 dbj|BAD09537.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22733.1| Os08g0110400 [Oryza sativa Japonica Group]
 dbj|BAG94403.1| unnamed protein product [Oryza sativa Japonica Group]
Length=407

 Score =   251 bits (641),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 142/180 (79%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  228  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHILPSQWRKGSEWFEL  287

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ I+++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  288  NRELALRIIADNKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGP  347

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A+NI+E FIQ+IR+NGT C+YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  348  HPARYGASNISEEFIQAIRNNGTRCTYNSKPTSVCYLFARKFAPSALGPLMNLTSTILDF  407



>gb|EMS61782.1| hypothetical protein TRIUR3_23279 [Triticum urartu]
 gb|EMT25870.1| hypothetical protein F775_27169 [Aegilops tauschii]
Length=295

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  116  ESCIPVFNFPTVYEYLINSEHSFVESYNIDTPQSAGRYNRRMAPHILPEQWRKGSEWFEL  175

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  176  NRELAVRVVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGP  235

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y A NI   FI++IR+NGT C YN   T +CYLFARKF PSAL PL  L+  V+ F
Sbjct  236  HPARYGAGNINVDFIKAIRNNGTQCLYNSKHTSVCYLFARKFAPSALGPLMNLTSTVLDF  295



>ref|XP_002444900.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
 gb|EES14395.1| hypothetical protein SORBIDRAFT_07g001090 [Sorghum bicolor]
Length=412

 Score =   249 bits (637),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  233  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQSAGRYNRRMAPHIMADQWRKGSEWFEL  292

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  293  NRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGP  352

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPASY AA+ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L  ++  V+ F
Sbjct  353  HPASYGAADITEDFIQAIRNNGTQCFYNSKPTSVCYLFARKFAPNALGRLMNMTSTVLDF  412



>ref|XP_004972466.1| PREDICTED: uncharacterized protein LOC101769924 [Setaria italica]
Length=410

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 141/180 (78%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  231  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHIMADQWRKGSEWFEL  290

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  291  NRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGP  350

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPASY AA+ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L  L+  V+ F
Sbjct  351  HPASYGAADITEEFIQTIRNNGTQCFYNSKPTSVCYLFARKFAPNALGRLMNLTSTVLDF  410



>ref|XP_003573284.1| PREDICTED: uncharacterized protein LOC100833185 [Brachypodium 
distachyon]
Length=406

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 112/180 (62%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  227  ESCIPVFNFPTVYEYLINSEHSFVESYNIDTPQSAGRYNRRMAPHILPDQWRKGSEWFEL  286

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  287  NRELAVRVVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGSLNANRTITWVDWSRGGP  346

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA Y AANI   FIQ+IR+NGT C YN   T +CYLFARKF PSAL PL  L+  ++ F
Sbjct  347  HPARYGAANINVEFIQAIRNNGTQCLYNSKHTSVCYLFARKFAPSALGPLMNLTSTILDF  406



>ref|NP_001143222.1| uncharacterized protein LOC100275738 [Zea mays]
 gb|ACG29937.1| hypothetical protein [Zea mays]
 gb|ACN25800.1| unknown [Zea mays]
 gb|ACN28199.1| unknown [Zea mays]
 gb|AFW74275.1| hypothetical protein ZEAMMB73_796456 [Zea mays]
Length=414

 Score =   247 bits (631),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  235  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHIMADQWRKGSEWFEL  294

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  295  NRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGP  354

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPASY A +ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L  L+  V+ F
Sbjct  355  HPASYGATDITEDFIQAIRNNGTQCFYNSKPTSVCYLFARKFAPNALPRLMNLTSTVLDF  414



>ref|NP_001143215.1| uncharacterized protein LOC100275720 [Zea mays]
 gb|ACG29786.1| hypothetical protein [Zea mays]
Length=414

 Score =   247 bits (630),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 140/180 (78%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY+YL  S HSF+ESY+  T    GRYN RM P I   +WRKGS+WFE+
Sbjct  235  ESCIPVFNFPTVYEYLINSAHSFVESYNIDTPQCAGRYNRRMAPHIMADQWRKGSEWFEL  294

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++ K+Y++F+K+CRPSCYPDEHYIPTYL L HG +NANR++T+VDWS GGP
Sbjct  295  NRELAVQIVADYKYYSIFRKHCRPSCYPDEHYIPTYLHLFHGPLNANRTITWVDWSRGGP  354

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPASY A +ITE FIQ+IR+NGT C YN   T +CYLFARKF P+AL  L  L+  V+ F
Sbjct  355  HPASYGATDITEEFIQAIRNNGTQCFYNSKPTSVCYLFARKFAPNALPRLMNLTSTVLDF  414



>emb|CAH67921.1| OSIGBa0138E08-OSIGBa0161L23.2 [Oryza sativa Indica Group]
Length=412

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S  S++ESY+       GRYN RM PD+   +WRKGS+WFEM
Sbjct  233  ESCVPVFNFPTVYEYLVNSAQSYVESYNIDVPQCAGRYNPRMAPDVLEEQWRKGSEWFEM  292

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA  IV++ K++A+F+K+C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGP
Sbjct  293  SRDLAADIVADRKYHAIFRKHCTPSCYPDEHYIPTYLHLRHGARNANRTVTWVDWSRGGP  352

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +  A +T  F+Q+IR+NGT C+YN   T +CYLFARKF PSAL PL  +S  ++ F
Sbjct  353  HPARFGKATVTPAFVQAIRNNGTRCAYNGKPTTVCYLFARKFAPSALGPLLNMSTTLLEF  412



>ref|NP_001052347.1| Os04g0272400 [Oryza sativa Japonica Group]
 emb|CAE01750.2| OSJNBb0056F09.13 [Oryza sativa Japonica Group]
 dbj|BAF14261.1| Os04g0272400 [Oryza sativa Japonica Group]
 gb|EAZ30027.1| hypothetical protein OsJ_14085 [Oryza sativa Japonica Group]
 dbj|BAH00498.1| unnamed protein product [Oryza sativa Japonica Group]
Length=412

 Score =   236 bits (602),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S  S++ESY+       GRYN RM PD+   +WRKGS+WFEM
Sbjct  233  ESCVPVFNFPTVYEYLVNSAQSYVESYNIDVPQCAGRYNPRMAPDVLEEQWRKGSEWFEM  292

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA  IV++ K++A+F+K+C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGP
Sbjct  293  SRDLAADIVADRKYHAIFRKHCTPSCYPDEHYIPTYLHLRHGARNANRTVTWVDWSRGGP  352

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +  A +T  F+Q+IR+NGT C+YN   T +CYLFARKF PSAL PL  +S  ++ F
Sbjct  353  HPARFGKATVTPAFVQAIRNNGTRCAYNGKPTTVCYLFARKFAPSALGPLLNMSTTLLEF  412



>ref|XP_009341368.1| PREDICTED: uncharacterized protein LOC103933398 [Pyrus x bretschneideri]
Length=390

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 139/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F TVY+YL  S HS+++SYDDP RYGRGRY   M PDI   +WRKGSQWFE+
Sbjct  211  ESCIPIYNFTTVYEYLVGSNHSYVQSYDDPGRYGRGRYRRNMFPDITPRQWRKGSQWFEL  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RAL++ IVSETK+Y +F  YC P+CYPDEHY+PTY+ +  G +N+NR+VT+VDWSL GP
Sbjct  271  SRALSVYIVSETKYYTIFSNYCLPACYPDEHYLPTYINMLQGSLNSNRTVTWVDWSLRGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP +Y   NITE F++ IR+NG  C YN     ICYLFARKF P+ALEPL KL+  VM +
Sbjct  331  HPTTYGGDNITEDFLRWIRNNGAPCQYNAEMKSICYLFARKFAPTALEPLLKLAAVVMEY  390



>ref|XP_008786440.1| PREDICTED: uncharacterized protein LOC103704783 isoform X2 [Phoenix 
dactylifera]
Length=284

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVYKYLT+S +SF++SYD+ +  G G YN+ + P+IKL +WRKGS+WFE+
Sbjct  105  ESCIPVFNFSTVYKYLTKSAYSFVQSYDENSFQGLGHYNSHLAPEIKLPQWRKGSRWFEI  164

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R+LA+ IV++ K+Y  F++YC+ +CYPDE YIPTYL + HG  NANR+VT+  WS+GG 
Sbjct  165  QRSLAVNIVADKKYYFFFREYCKTNCYPDEFYIPTYLNMFHGLSNANRTVTWAGWSIGGH  224

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   +ITE  I+SIRSNGT C+YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  225  HPATYGREDITESLIRSIRSNGTICTYNSKPSSLCFLFAMKFSPDALEPLLNLTSTVMKF  284



>ref|XP_008786439.1| PREDICTED: uncharacterized protein LOC103704783 isoform X1 [Phoenix 
dactylifera]
Length=384

 Score =   230 bits (586),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 138/180 (77%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVYKYLT+S +SF++SYD+ +  G G YN+ + P+IKL +WRKGS+WFE+
Sbjct  205  ESCIPVFNFSTVYKYLTKSAYSFVQSYDENSFQGLGHYNSHLAPEIKLPQWRKGSRWFEI  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R+LA+ IV++ K+Y  F++YC+ +CYPDE YIPTYL + HG  NANR+VT+  WS+GG 
Sbjct  265  QRSLAVNIVADKKYYFFFREYCKTNCYPDEFYIPTYLNMFHGLSNANRTVTWAGWSIGGH  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   +ITE  I+SIRSNGT C+YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  325  HPATYGREDITESLIRSIRSNGTICTYNSKPSSLCFLFAMKFSPDALEPLLNLTSTVMKF  384



>ref|XP_008786442.1| PREDICTED: uncharacterized protein LOC103704784 [Phoenix dactylifera]
Length=298

 Score =   227 bits (578),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 135/180 (75%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            + CIP+YDF T+Y+YL  S HSF+ SYD+ T  GRGRY+  + P IKL +WRKG+QWFE+
Sbjct  119  DGCIPLYDFVTIYRYLLRSDHSFVHSYDEDTENGRGRYSRHLAPAIKLSQWRKGAQWFEL  178

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R+LA+ IV++ K+Y +F+KY     YPDEHYIPT+L + +G   ANR++T+VDWS  GP
Sbjct  179  HRSLAVNIVADDKYYNLFRKYAGSLNYPDEHYIPTFLSMIYGASIANRTLTWVDWSTRGP  238

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   NITEGFIQSIR+N T+CSYN   T +C+LFARKF   ALEPL  +S  VM F
Sbjct  239  HPATFGRRNITEGFIQSIRNNATTCSYNFRPTSVCFLFARKFSRDALEPLLNISPTVMRF  298



>ref|XP_010916432.1| PREDICTED: uncharacterized protein LOC105041249 [Elaeis guineensis]
Length=399

 Score =   230 bits (586),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 138/180 (77%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  ST +++ SYDDP   GRGRYN RMKP +KL EWRKGSQWFE+
Sbjct  219  ESCIPLFNFSTIYSYLINSTQTYVSSYDDPGPNGRGRYNIRMKPRVKLQEWRKGSQWFEV  278

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RALAI I+S+ K++ +FKKYCRPSCY DEHY+ T++ +   + NANRS+T+VDWS GGP
Sbjct  279  DRALAIEIISDEKYFPVFKKYCRPSCYVDEHYLSTFVSMRFWWRNANRSLTWVDWSKGGP  338

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +   ++T   ++ +R NG++C+YN   T +C+LFARKF P++L  L + + +V+GF
Sbjct  339  HPARFGRLDVTTELLERMR-NGSTCNYNGRTTSVCFLFARKFLPNSLTRLMRFAPRVLGF  397



>ref|XP_008377912.1| PREDICTED: uncharacterized protein LOC103440993, partial [Malus 
domestica]
Length=220

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y+YL +S +S++ ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  42   ESCIPLYNFSVIYQYLMKSKYSYVGAFDDPGPYGRGRYNDNMAPEVSISKWRKGSQWFEV  101

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TKFY  FK++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGP
Sbjct  102  NRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGP  161

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F++ I      C+YN   + +C+LF RKF PSA+EPL  L+ K +GF
Sbjct  162  HPATFGRADITEEFLKRIFER-QRCTYNDRNSTVCFLFGRKFAPSAMEPLLHLAPKFLGF  220



>ref|XP_010453221.1| PREDICTED: uncharacterized protein LOC104735185 [Camelina sativa]
Length=387

 Score =   227 bits (579),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL+ S HSF+ ++DDP  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  209  ESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNGNMEPEVPLTKWRKGSQWFEI  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  269  NRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSITWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C+YN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  329  HPATFGRSDITEKFFERI-FDGRNCTYNGRNTSLCYLFARKFAPSALEPLLHIAPKILGF  387



>ref|XP_009415010.1| PREDICTED: uncharacterized protein LOC103995962 [Musa acuminata 
subsp. malaccensis]
Length=392

 Score =   227 bits (579),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPVY F TVYKYL  S HSF++S+D+ +  GRGRYN RM PDI L +WRKGS+W E+
Sbjct  214  ESCIPVYGFPTVYKYLIRSAHSFVQSFDENSPLGRGRYNHRMAPDIVLSQWRKGSEWLEL  273

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R+LA+ +V++ K++ +F+KYC+P CY DEHY PTY  + HG + ANRS+T+VDWS GGP
Sbjct  274  SRSLAVEVVADFKYHFLFRKYCQPPCYADEHYFPTYFNMFHGALIANRSITWVDWSRGGP  333

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
            HPA+Y   NIT+  IQSIR +   C YN G T +C+LFARKF   ALE L  L+  VM
Sbjct  334  HPATYGYQNITKDLIQSIRESKI-CKYNSGATTMCFLFARKFASDALELLLNLTSAVM  390



>ref|XP_006286517.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
 gb|EOA19415.1| hypothetical protein CARUB_v10001158mg [Capsella rubella]
Length=386

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL+ S HSF+ ++DDP  YGRGRYN+ M+P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNSNMEPEVPITKWRKGSQWFEI  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  268  NRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPEVLANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  +++TE F   I  +G +C+YN   T +CYLFARKF PSALEPL  +S K++GF
Sbjct  328  HPATFGRSDVTENFFVKI-FDGRNCTYNGRNTSMCYLFARKFAPSALEPLLSISPKILGF  386



>ref|XP_002871492.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47751.1| hypothetical protein ARALYDRAFT_909140 [Arabidopsis lyrata subsp. 
lyrata]
Length=387

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  209  ESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNGNMEPEVPLSKWRKGSQWFEV  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  269  DRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPTVLANRSLTWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +CSYN G T +CYLFARKF PS LEPL  ++ KV+GF
Sbjct  329  HPATFGRSDITEKFFERI-FDGRNCSYNGGNTSMCYLFARKFAPSTLEPLLHIAPKVLGF  387



>ref|XP_010491917.1| PREDICTED: uncharacterized protein LOC104769408 [Camelina sativa]
Length=387

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL+ S HSF+ ++DDP  YGRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  209  ESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPYGRGRYNGNMEPEVPVTKWRKGSQWFEI  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  269  NRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSITWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F   I  +G +C+YN   T ICYLFARKF PSALEPL  ++ K++GF
Sbjct  329  HPATFGRSDITEKFFGRI-FDGRNCTYNGRNTSICYLFARKFAPSALEPLLHIAPKILGF  387



>ref|XP_004141306.1| PREDICTED: uncharacterized protein LOC101205668 [Cucumis sativus]
 gb|KGN55314.1| hypothetical protein Csa_4G645880 [Cucumis sativus]
Length=386

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +YKYL ES +SF+ S+DD   YGRGRY   M P++ + EWRKGSQWFE+
Sbjct  208  ESCIPLFNFSVIYKYLKESKYSFVGSFDDLGPYGRGRYRDAMAPEVNITEWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TKFY  F+++CRP CY DEHY PT L +  G + ANRS+T+VDWS GGP
Sbjct  268  NRKLAISIVQDTKFYKKFEQFCRPPCYVDEHYFPTMLTIEAGDVIANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE  +  I  NG +CSYN G + IC LFARKF PS+L PL +L+L V G+
Sbjct  328  HPATFGRRDITEELLARI-VNGQNCSYNNGTSSICSLFARKFAPSSLRPLLRLALDVFGY  386



>ref|NP_196734.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 emb|CAB87691.1| putative protein [Arabidopsis thaliana]
 gb|AAM13183.1| putative protein [Arabidopsis thaliana]
 gb|AAP68292.1| At5g11730 [Arabidopsis thaliana]
 dbj|BAE99143.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91715.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38636.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=386

 Score =   226 bits (575),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  208  ESCIPLYNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNGNMEPEVPLTKWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  268  NRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPTVLANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F   I  +G +CSYN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  328  HPATFGRSDITENFFGKI-FDGRNCSYNGRNTSMCYLFARKFAPSALEPLLHIAPKILGF  386



>ref|XP_003567325.1| PREDICTED: uncharacterized protein LOC100845991 [Brachypodium 
distachyon]
Length=395

 Score =   226 bits (575),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 101/181 (56%), Positives = 129/181 (71%), Gaps = 1/181 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV  F  V+ YL  S HSF+E Y  P++  RGRYN RM PDI L +WRKGSQWFE+
Sbjct  215  ESCIPVQPFPVVHDYLVGSRHSFVEVYYVPSKQCRGRYNRRMAPDITLRQWRKGSQWFEL  274

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +A  ++++ K+Y +F+K+CRPSCYPDEHYIPT + + HG+ N+NR++T+VDWS GGP
Sbjct  275  SRDVATAVLADAKYYPLFRKHCRPSCYPDEHYIPTMVNMLHGHRNSNRTITFVDWSKGGP  334

Query  298  HPASYTAANITEGFIQSI-RSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA Y A ++T   IQ I R  G  C YN   T +C+LFARKF P  L PL  +S  VMG
Sbjct  335  HPAKYGAGDVTVELIQRIRRRTGRPCLYNSRPTSMCFLFARKFTPDMLGPLLNMSSAVMG  394

Query  121  F  119
            F
Sbjct  395  F  395



>ref|XP_008452696.1| PREDICTED: uncharacterized protein LOC103493641 [Cucumis melo]
Length=386

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +YKYL ES +SF+ S+DD   YGRGRY   M P++ + EWRKGSQWFE+
Sbjct  208  ESCIPLFNFSVIYKYLKESKYSFVGSFDDLGPYGRGRYRDAMAPEVNITEWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TK+Y  F+++CRP CY DEHY PT L +  G + ANRS+T+VDWS GGP
Sbjct  268  NRKLAISIVQDTKYYQKFEQFCRPPCYVDEHYFPTMLTIEAGDVIANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE  +  I  NG +CSYN G + IC LFARKF PS+L+PL +L+L V G+
Sbjct  328  HPATFGRRDITEELLARI-VNGQNCSYNNGTSSICSLFARKFAPSSLQPLLRLALDVFGY  386



>ref|XP_010419754.1| PREDICTED: uncharacterized protein LOC104705440 [Camelina sativa]
Length=387

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y Y++ S HSF+ ++DDP  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  209  ESCIPLYNFTTIYSYISRSKHSFMGAFDDPGPYGRGRYNGNMEPEVPLTKWRKGSQWFEI  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  269  NRDLAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSITWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F   I  +G +C+YN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  329  HPATFGRSDITEKFFGRI-FDGRNCTYNGRNTSMCYLFARKFAPSALEPLLHIAPKILGF  387



>ref|XP_010930512.1| PREDICTED: uncharacterized protein LOC105051676 [Elaeis guineensis]
Length=383

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 0/174 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVYKYL +S +SF++SYD+ +  G   YN+RM PDIKL +WRKGS+WFE+
Sbjct  206  ESCIPVFNFPTVYKYLIDSAYSFVQSYDENSNQGLRYYNSRMAPDIKLSQWRKGSRWFEI  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+ IV++ K+Y+ F+KYC+  C+PDE YIPTYL + HG  NANR+VT+  WS GG 
Sbjct  266  QRLLAVDIVADKKYYSFFRKYCKTGCFPDEFYIPTYLNMFHGLSNANRTVTWAGWSRGGH  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLS  137
            HPA+Y   +ITE  IQSIR+NG  C+YN   + +C+LFA KF P ALEPL  L+
Sbjct  326  HPATYGREDITESLIQSIRNNGIICTYNSKPSSVCFLFAMKFSPDALEPLLNLT  379



>ref|XP_006394845.1| hypothetical protein EUTSA_v10004382mg [Eutrema salsugineum]
 gb|ESQ32131.1| hypothetical protein EUTSA_v10004382mg [Eutrema salsugineum]
Length=387

 Score =   225 bits (573),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T++ Y+T+S HSF+ S+DDP+ YGRGRYN  M P++ ++EWRKGSQWFE+
Sbjct  209  ESCIPLFNFTTIHGYITKSKHSFMGSFDDPSPYGRGRYNGNMSPEVSINEWRKGSQWFEV  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ I+ +T +Y  FK++C P+CY DEHY PT L +      ANRS+T+VDWS GGP
Sbjct  269  NRELAVSIIKDTLYYPKFKEFCTPACYVDEHYFPTMLTIEKPAALANRSLTWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++++E F   I  NG +C+YN G T +CYLFARKF PSALEPL  ++ K++ F
Sbjct  329  HPATFGQSDVSEEFFARIL-NGDNCTYNGGNTSMCYLFARKFSPSALEPLIYIAPKILSF  387



>ref|XP_006399687.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
 gb|ESQ41140.1| hypothetical protein EUTSA_v10013787mg [Eutrema salsugineum]
Length=386

 Score =   224 bits (572),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL++S HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLFNFTTIYSYLSQSKHSFMGAFDDPGPFGRGRYNPNMEPEVPITKWRKGSQWFEI  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  268  NRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPVVLANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F   I  +G +C+YN   T +CYLFARKF PSALEPL  ++ K++GF
Sbjct  328  HPATFGRSDITENFFGKI-FDGRNCTYNGRNTSMCYLFARKFAPSALEPLLHIAPKILGF  386



>ref|XP_006355313.1| PREDICTED: uncharacterized protein LOC102601627 [Solanum tuberosum]
Length=388

 Score =   224 bits (572),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +YKY+++S HSF+ ++DDP  YGRGRY+  M P++ + +WRKGSQWFEM
Sbjct  210  ESCIPLYNFNVIYKYISQSKHSFVGAFDDPGPYGRGRYDENMLPEVNISQWRKGSQWFEM  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV +TKFY  F ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  270  SRKLALFIVEDTKFYPKFAEFCRPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F++ + + G +C+YN   T +CY+FARKF PSALEPL  L+ K +GF
Sbjct  330  HPATFGKSDITEEFMKRMLA-GPNCTYNDRNTSMCYIFARKFAPSALEPLFLLAPKYLGF  388



>ref|XP_004165595.1| PREDICTED: uncharacterized protein LOC101231487 [Cucumis sativus]
Length=386

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/180 (57%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +YKYL ES +SF+ S+DD   YGRGRY   M P++ + EWRKGSQWFE+
Sbjct  208  ESCIPLFNFSVIYKYLKESKYSFVGSFDDLGPYGRGRYRDAMAPEVNITEWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TKFY  F+++CRP CY DEHY PT L +  G + ANRS+T+VDWS GGP
Sbjct  268  NRKLAISIVQDTKFYKKFEQFCRPPCYVDEHYFPTMLTIEAGDVIANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE  +  I  NG +CSYN G + IC LFARKF PS+L PL  L+L V G+
Sbjct  328  HPATFGRRDITEELLARI-VNGQNCSYNNGTSSICSLFARKFAPSSLRPLLPLALDVFGY  386



>ref|XP_006645101.1| PREDICTED: uncharacterized protein LOC102713419 [Oryza brachyantha]
Length=385

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 131/180 (73%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV  F TVY YLT S HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+
Sbjct  206  ESCIPVQSFPTVYDYLTGSRHSFVEVYYHKDKTCRGRYSHRMEPDITLPQWRKGSQWFEL  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ ++++T++Y +F+++C PSCYPDEHY+PT + + HG  N+NR+VTYVDWS GG 
Sbjct  266  SRGLAVSVLADTRYYPLFRQHCLPSCYPDEHYLPTLVTMLHGAANSNRTVTYVDWSRGGA  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP +Y A ++T   IQS+R + T C YN   T  C+LFARKF P ALEPL  +S  VM +
Sbjct  326  HPVTYAAGDVTPDLIQSLRRSETPCMYNSRPTTACFLFARKFSPDALEPLLNMSSTVMQY  385



>ref|XP_010519868.1| PREDICTED: uncharacterized protein LOC104799181 [Tarenaya hassleriana]
Length=384

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F T+++Y+T+S HSF+ S+DDP  YGRGRYN+ M P++ + +WRKGSQWFE+
Sbjct  206  ETCIPLFNFTTIHRYITKSKHSFVGSFDDPGPYGRGRYNSSMAPEMDITQWRKGSQWFEV  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T +Y  F+ +CRP+CY DEHY PT L +    + ANRSVT+VDWS GG 
Sbjct  266  NRELAVTIVKDTVYYPKFRDFCRPACYVDEHYFPTMLNVEKPGLLANRSVTWVDWSRGGA  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  +++TE F   I   G +CSYN   T +CYLFARKF PSALEPL  L+ KV+GF
Sbjct  326  HPATFGRSDMTEDFFGRIH-GGRNCSYNGHNTSMCYLFARKFAPSALEPLLHLAPKVLGF  384



>ref|XP_009763004.1| PREDICTED: uncharacterized protein LOC104214963 isoform X2 [Nicotiana 
sylvestris]
Length=230

 Score =   219 bits (557),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y Y+  ST +F+ESYD P+  GRGRYN +M+P I L +WRKGSQWFE+
Sbjct  51   ESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMQPWITLDQWRKGSQWFEV  110

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI I+++ K++ +FK+YC+P+CY DEHY+PT++ + + + N NR++T+VDW+ GGP
Sbjct  111  DREIAIDIITDQKYFQLFKRYCKPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDWTKGGP  170

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   ++T   +  +R NGT C YN   T +CYLFARKF PS L+ L + + K+M F
Sbjct  171  HPTRFIRTDVTADLLNRMR-NGTQCEYNGDPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  229



>ref|XP_010942042.1| PREDICTED: uncharacterized protein LOC105060116 isoform X2 [Elaeis 
guineensis]
Length=298

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F   Y+YL  S +SF+ S+DDP  +GRGRYN RMKP++ + +WRKG+QWFE+
Sbjct  119  ESCIPLYNFSITYRYLMRSRYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQWRKGAQWFEV  178

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+S+ K+Y  F+ +C+P CY DEHY PT L +   ++ ANRSVT+VDWS GG 
Sbjct  179  NRKLAINIISDAKYYPKFRDFCKPGCYVDEHYFPTMLAIESPHLMANRSVTWVDWSRGGA  238

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ I   G SC YN   + +C+LFARKF P+ALEPL +L+  ++GF
Sbjct  239  HPATFGKRDITEAFLKKIL-EGKSCFYNAQPSSVCFLFARKFAPNALEPLLQLAPSLLGF  297



>ref|XP_009601239.1| PREDICTED: uncharacterized protein LOC104096562 [Nicotiana tomentosiformis]
Length=388

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +YKY+++S HSFI ++DDP  YGRGRY+  M P++ + +WRKGSQWFE+
Sbjct  210  ESCIPLYNFNVIYKYISQSKHSFIGAFDDPGPYGRGRYDENMLPEVNITDWRKGSQWFEI  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +TKFY  F ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  270  NRKLALYIVEDTKFYPKFAEFCKPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F++ + + G +C+YN   T +C+LFARKF PSALEPL  L+ K +GF
Sbjct  330  HPATFGKSDITEEFMKRMLA-GRNCTYNERNTSMCFLFARKFAPSALEPLFLLAPKYLGF  388



>ref|XP_007222675.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
 gb|EMJ23874.1| hypothetical protein PRUPE_ppa008602mg [Prunus persica]
Length=325

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y YL +S +SFI ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+
Sbjct  147  ESCIPLYNFSVIYHYLMKSKYSFIGAFDDPGPFGRGRYNNNMAPEVNITQWRKGSQWFEV  206

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T FY  F+K+CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGP
Sbjct  207  NRKLAISIVEDTTFYQKFEKFCRPACYVDEHYFPTMLTIQAGNSLANRSITWVDWSRGGP  266

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F + +   G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  267  HPATFGRADITEEFFKRML-EGHRCTYNDRNSSICFLFGRKFAPSAMEPLLHLAPKFLGF  325



>ref|XP_008795296.1| PREDICTED: uncharacterized protein LOC103711078 [Phoenix dactylifera]
Length=385

 Score =   223 bits (569),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 136/180 (76%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F T+Y YL  S +SF++S D+    G G YN+RM P+IK  +WR+G++WFE+
Sbjct  206  ESCIPVFNFQTIYNYLINSAYSFVQSNDENPIQGHGSYNSRMAPEIKHSQWREGTRWFEV  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R+LA+ IV++ K+Y++F+KYC+ +CYPD+ YIPTYL +  G +NANR+VT+ DWS  G 
Sbjct  266  KRSLAVNIVADNKYYSIFRKYCKITCYPDDSYIPTYLNMLDGILNANRTVTWADWSKRGH  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y + +ITEG IQSIR+NGT C+YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  326  HPATYGSEDITEGLIQSIRNNGTICTYNSKPSSVCFLFAMKFSPDALEPLLNLASMVMKF  385



>ref|XP_006426464.1| hypothetical protein CICLE_v100272021mg, partial [Citrus clementina]
 gb|ESR39704.1| hypothetical protein CICLE_v100272021mg, partial [Citrus clementina]
Length=212

 Score =   218 bits (554),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+P+++F  VY Y+++S +SF+ESYDDP  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  34   ESCVPLHNFSIVYYYISKSRYSFMESYDDPGPYGRGRYNGNMEPEVTLSQWRKGSQWFEI  93

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ I+ +T +Y  F+ +C+P CY DEHY PT L +H   + ANR++T+ DWS GG 
Sbjct  94   NRRLAVDIIEDTSYYPKFRDFCKPGCYVDEHYFPTMLTIHFSRLLANRTLTWTDWSRGGA  153

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y  A+I+E F + I ++ + C YN+  T  CYLFARKF PSAL PL +LSL   GF
Sbjct  154  HPATYGGADISEEFFRKITAS-SQCYYNKQVTSFCYLFARKFAPSALGPLLELSLSAFGF  212



>dbj|BAK04145.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 132/185 (71%), Gaps = 5/185 (3%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++ F  VY YL  S HSF+E Y   T+  +GRY+ RM P I+L +WRKGSQWFE+
Sbjct  207  ESCIPLHSFRAVYDYLVGSRHSFVEVYFQQTKQCQGRYSRRMAPAIRLPQWRKGSQWFEL  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI ++++TK+Y +F+++CRPSCYPDEHY+PT + + HG  NANR+VTYVDW+ GG 
Sbjct  267  NRDLAISVLADTKYYPLFRRHCRPSCYPDEHYLPTTVDMLHGARNANRTVTYVDWTKGGA  326

Query  298  HPASYTAANITEGFIQSIR-----SNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSL  134
            HPA YTA+N+T   IQ IR      +  SC YN   T +C+LFARKF P  L PL  +S 
Sbjct  327  HPAKYTASNVTAAAIQGIRRRRWKGDRPSCYYNDRPTSMCFLFARKFAPDTLGPLLNMSS  386

Query  133  KVMGF  119
             VMG+
Sbjct  387  AVMGY  391



>ref|XP_010227722.1| PREDICTED: uncharacterized protein LOC104581568 [Brachypodium 
distachyon]
Length=411

 Score =   223 bits (569),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S  S++ESY+       GRYN RM PD+   +WRKGS+WFE+
Sbjct  232  ESCVPVFNFPTVYEYLVNSAQSYVESYNMDVPQCAGRYNPRMAPDVLEEQWRKGSEWFEV  291

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ +VS+ ++YA+F+K+C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGP
Sbjct  292  SRELAVDVVSDRRYYAVFRKHCTPSCYPDEHYIPTYLHLVHGPRNANRTVTWVDWSRGGP  351

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  161
            HPA Y    +T  F+Q+IR+NGT C YN   T +CYLFARKF PSA
Sbjct  352  HPARYGKGTVTAEFLQAIRNNGTQCLYNGKPTTVCYLFARKFAPSA  397



>ref|XP_008796992.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796993.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
 ref|XP_008796994.1| PREDICTED: uncharacterized protein LOC103712290 [Phoenix dactylifera]
Length=384

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y YL  S +SF+ S+DDP  YGRGRYN RM P++ + +WRKG+QWFE+
Sbjct  205  ESCIPLYNFSIIYHYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEVNIMQWRKGAQWFEV  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TK+Y  F ++CRPSCY DEHY PT L +   ++ ANR++T+VDWS GG 
Sbjct  265  NRKLAIDIVRDTKYYPKFNEFCRPSCYVDEHYFPTMLTIESPHLIANRTITWVDWSRGGA  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ I   G +C YN   + +C+LFARKF PSALEPL + +  ++GF
Sbjct  325  HPATFGKGDITEAFLKKIL-EGKTCLYNDQPSSVCFLFARKFAPSALEPLLQFATSLLGF  383



>ref|XP_006842358.1| hypothetical protein AMTR_s00079p00180800 [Amborella trichopoda]
 gb|ERN04033.1| hypothetical protein AMTR_s00079p00180800 [Amborella trichopoda]
Length=206

 Score =   217 bits (552),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 130/181 (72%), Gaps = 1/181 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F TVY YLT S HS++ S+DDP   GRGRY  RM+P +KL  WRKGSQWFE+
Sbjct  26   EACIPLFNFTTVYSYLTNSRHSYVHSFDDPGANGRGRYPRRMRPHVKLSSWRKGSQWFEL  85

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RA+A  IV+E+ +Y +F KYC+P+CY DEHY+ T + L  G  +ANRS+T+VDWS GGP
Sbjct  86   DRAMAQDIVAESNYYGLFAKYCKPTCYVDEHYLSTLVALKFGGRSANRSLTWVDWSRGGP  145

Query  298  HPASYTAANITEGFIQSIRSN-GTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HP  +    +T   +  +RS  G  C YN G T IC+LFARKF P+AL+ L + + KV+G
Sbjct  146  HPMRFGRREVTIEVLNKMRSGEGKRCGYNGGSTDICFLFARKFLPNALDRLLRFAPKVLG  205

Query  121  F  119
            +
Sbjct  206  Y  206



>gb|EMS55277.1| hypothetical protein TRIUR3_33067 [Triticum urartu]
Length=449

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 99/166 (60%), Positives = 128/166 (77%), Gaps = 0/166 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S  S++ESY+       GRYN RM PD+   +WRKGS+WFE+
Sbjct  270  ESCVPVFNFPTVYEYLINSAQSYVESYNIDVPQCAGRYNPRMAPDVTEQQWRKGSEWFEL  329

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV++ ++Y +F+K+C PSCYPDEHYIPTYL L HG  NANR++T+VDWS GGP
Sbjct  330  SRELAVDIVADRRYYHVFRKHCTPSCYPDEHYIPTYLHLVHGPRNANRTITWVDWSRGGP  389

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  161
            HPA Y  A++T+ FIQ+IR+NGT C YN   T +CYLFARKF PSA
Sbjct  390  HPARYGKASVTKEFIQAIRNNGTQCLYNGRPTTVCYLFARKFAPSA  435



>ref|NP_001173628.1| Os03g0731050 [Oryza sativa Japonica Group]
 dbj|BAH92356.1| Os03g0731050, partial [Oryza sativa Japonica Group]
Length=240

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  61   ESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQWRKGSQWFEV  120

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T+VDWS GG 
Sbjct  121  NRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGA  180

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  181  HPATFGRGDITEEFLRRVQE-GRTCLYNGQNSTMCFLFARKFAPSALEPLLELAPTVLGF  239



>ref|XP_010942037.1| PREDICTED: uncharacterized protein LOC105060116 isoform X1 [Elaeis 
guineensis]
Length=384

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F   Y+YL  S +SF+ S+DDP  +GRGRYN RMKP++ + +WRKG+QWFE+
Sbjct  205  ESCIPLYNFSITYRYLMRSRYSFVGSFDDPGPHGRGRYNLRMKPEVNIAQWRKGAQWFEV  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+S+ K+Y  F+ +C+P CY DEHY PT L +   ++ ANRSVT+VDWS GG 
Sbjct  265  NRKLAINIISDAKYYPKFRDFCKPGCYVDEHYFPTMLAIESPHLMANRSVTWVDWSRGGA  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ I   G SC YN   + +C+LFARKF P+ALEPL +L+  ++GF
Sbjct  325  HPATFGKRDITEAFLKKIL-EGKSCFYNAQPSSVCFLFARKFAPNALEPLLQLAPSLLGF  383



>ref|XP_006485819.1| PREDICTED: uncharacterized protein LOC102611796 [Citrus sinensis]
Length=419

 Score =   223 bits (568),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  S+ +F+E+YD P   GRGRYN RM+P I+L +WRKGSQWFEM
Sbjct  240  ESCIPLFNFSTIYNYLINSSKAFVEAYDLPGPVGRGRYNRRMRPVIRLEQWRKGSQWFEM  299

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RALA+ ++S+ K++  FK++C+ SCY DEHY+PT++       N+NRS+T+VDWS GGP
Sbjct  300  DRALALEVISDKKYFVTFKRHCKASCYADEHYLPTFVSAKFWKRNSNRSLTWVDWSKGGP  359

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +   ++T  F++ +RS G+ C YN  +T IC+LFARKF P+AL+ L + + KVMGF
Sbjct  360  HPAKFQRRDVTIEFLKRLRS-GSHCEYNGKRTNICFLFARKFLPNALDRLLRFAPKVMGF  418



>ref|XP_007217120.1| hypothetical protein PRUPE_ppa015089m1g, partial [Prunus persica]
 gb|EMJ18319.1| hypothetical protein PRUPE_ppa015089m1g, partial [Prunus persica]
Length=214

 Score =   216 bits (551),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I +  WRKGSQWFE+
Sbjct  34   ESCIPLFNFTTTYDYLINSNLSFLSSFDDPRKPGRGRYNPKMYPIINITNWRKGSQWFEV  93

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IVS+ K+Y +F++YCRPSCY DEHYIPT + + +  +N+ RS+T+VDWS GGP
Sbjct  94   HRELAIHIVSDCKYYPIFQEYCRPSCYIDEHYIPTLVNILYSELNSKRSITWVDWSRGGP  153

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +  ++IT+ F+  IR  G+ C YN   T IC+LFARKF P+ LEPL +++  ++GF
Sbjct  154  HPGKFEWSDITDEFLNRIRF-GSECEYNGNTTSICFLFARKFMPNTLEPLLRVAPLLLGF  212



>ref|XP_002872192.1| hypothetical protein ARALYDRAFT_910666 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48451.1| hypothetical protein ARALYDRAFT_910666 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   222 bits (565),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 136/180 (76%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y Y+T+S HSF+ S+DDP+ YGRGRY+  M P++ +++WRKGSQWFE+
Sbjct  208  ESCIPLFNFTTIYTYITKSKHSFMGSFDDPSPYGRGRYHGNMAPEVSINQWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  268  NRELAVSIVKDTLYYPKFKQFCKPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGA  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++ A +I+E F   +   G +C+YN G T +CYLFARKF PSALEPL +++ K++ F
Sbjct  328  HPATFGAQDISEEFFAWVL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLIQIAPKILSF  386



>gb|ADE76813.1| unknown [Picea sitchensis]
Length=345

 Score =   221 bits (562),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 132/174 (76%), Gaps = 1/174 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIPV++F T+Y YL +S HSF+ S+DDP   GRGRYN +M P++ L +WRKGSQWFE+
Sbjct  167  ETCIPVFNFSTIYNYLIKSKHSFVHSFDDPRPEGRGRYNIKMAPEVTLSQWRKGSQWFEV  226

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI I+S+TK+Y +FK +C+PSCY DEHYIPT L +  G + +NRS+T+VDWS GG 
Sbjct  227  HRKLAIDIISDTKYYQIFKAFCKPSCYIDEHYIPTILSMQFGSLISNRSITWVDWSRGGS  286

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLS  137
            HPA +   +IT+ F+ SIR +  +C+YN     +C+LFARKF PSAL+PL  +S
Sbjct  287  HPAMFGKDDITQEFMMSIR-DVNNCTYNDQTMSLCFLFARKFSPSALDPLLNMS  339



>ref|XP_009131226.1| PREDICTED: uncharacterized protein LOC103855927 [Brassica rapa]
Length=386

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL++S HSFI + DDP  +GRGRYN +M+P++ + +WRKG QWFE+
Sbjct  208  ESCIPLYNFTTIYTYLSQSKHSFIGAVDDPGPFGRGRYNEKMEPEVPITKWRKGPQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA  IV +T ++  F+++CRP+CY DEHY PT L +      ANRSVT+ DWS GGP
Sbjct  268  GRDLAATIVRDTLYHQKFREFCRPACYSDEHYFPTMLTIEKPTALANRSVTWTDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F   I  +GT+CSYN   T +CYLFARKF PSALEPL  ++ K+MGF
Sbjct  328  HPATFGRSDITEEFFGKI-FDGTNCSYNGRNTSMCYLFARKFAPSALEPLLHIAPKIMGF  386



>ref|XP_010108861.1| hypothetical protein L484_027054 [Morus notabilis]
 gb|EXC20501.1| hypothetical protein L484_027054 [Morus notabilis]
Length=405

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +Y YL  S  SF+ S+DDP   GRGRYN +M+P IKL +WRKG+QWFE+
Sbjct  225  ESCIPLFNFTAIYSYLINSNLSFLGSFDDPRSPGRGRYNPQMQPHIKLSDWRKGAQWFEL  284

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ ++S+ KFY +F+  CRP+CY DEHY+PT + + +G  NANRSVT+VDWS GGP
Sbjct  285  HRDLAVRVLSDRKFYPLFRDLCRPACYSDEHYLPTLVNILYGESNANRSVTWVDWSRGGP  344

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   ++T+ F+  IR  G+ C YN  +T +C+LFARKF P+ALEPL ++S  ++GF
Sbjct  345  HPGRFGWGDVTDEFLNRIRF-GSKCLYNGNETSMCFLFARKFLPNALEPLLRVSPVLLGF  403



>ref|XP_002872191.1| hypothetical protein ARALYDRAFT_351610 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48450.1| hypothetical protein ARALYDRAFT_351610 [Arabidopsis lyrata subsp. 
lyrata]
Length=386

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y Y+T+S HSF+ S+DDP+ YGRGRY+  M P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLFNFTTIYTYITKSKHSFMGSFDDPSPYGRGRYHGNMAPEVSIDQWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  268  NRELAVSIVKDTLYYPKFKQFCKPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGA  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++ A +I+E F   +   G +C+YN G T +CYLFARKF PSALEPL +++ K++ F
Sbjct  328  HPATFGAQDISEEFFAWVL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLIQIAPKILSF  386



>ref|XP_009337144.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
 ref|XP_009337145.1| PREDICTED: uncharacterized protein LOC103929645 [Pyrus x bretschneideri]
Length=389

 Score =   221 bits (564),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y YL +S +S++ ++DDP  YGRGRYN  M P++K+ +WRKGSQWFE+
Sbjct  211  ESCIPLYNFSVIYHYLMKSKYSYVGAFDDPGPYGRGRYNDNMAPEVKISKWRKGSQWFEV  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TKFY  FK++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGP
Sbjct  271  NRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+IT  F++ I      C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  331  HPATFGRAHITGEFLKRIFET-QRCTYNDRNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  389



>ref|XP_004959909.1| PREDICTED: uncharacterized protein LOC101775358 [Setaria italica]
Length=410

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S HS++ESY+       GRYN  M P++   +WRKGS+WFE+
Sbjct  231  ESCVPVFNFRTVYEYLVNSAHSYVESYNIDVPQCAGRYNPAMAPEVMEEQWRKGSEWFEL  290

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ +V++ ++YA+F+++C PSCYPDEHYIPTYL L HG  NANR+VT+VDWS GGP
Sbjct  291  SRELAVDVVADQRYYALFRRHCTPSCYPDEHYIPTYLHLRHGARNANRTVTWVDWSRGGP  350

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  161
            HPA +  A  T GF+ +IR+NGT C YN   T +CYLFARKF PSA
Sbjct  351  HPARFGRAATTAGFVAAIRNNGTRCLYNGKPTTVCYLFARKFAPSA  396



>gb|KDP29447.1| hypothetical protein JCGZ_18368 [Jatropha curcas]
Length=353

 Score =   220 bits (560),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F T+Y YL  S  SF+ SYDDP+R GRGRYN R+ P + L +WRKGSQWFE+
Sbjct  173  ETCIPIFNFTTIYNYLINSNQSFLASYDDPSRAGRGRYNKRLWPTVTLSDWRKGSQWFEI  232

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R L   IVS+ K+Y +F+ YC+P CY DEHY PT +      +N+NRS+T+VDWSLGGP
Sbjct  233  HRKLTGKIVSDVKYYPIFRDYCKPPCYMDEHYFPTLVTKICPELNSNRSITWVDWSLGGP  292

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP +Y   +++E F+  IR NG +CSYN   T +C+LFARKF  SAL+PL +++  ++GF
Sbjct  293  HPRNYVKKDVSEAFLNWIR-NGFNCSYNGAMTTVCFLFARKFHSSALQPLLRIAPALLGF  351



>ref|XP_008220437.1| PREDICTED: uncharacterized protein LOC103320525 [Prunus mume]
Length=388

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y YL +S +SFI ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+
Sbjct  210  ESCIPLYNFSVIYHYLMKSKYSFIGAFDDPGPFGRGRYNNNMAPEVNITQWRKGSQWFEV  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T FY  F+K+CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGP
Sbjct  270  NRKLAISIVEDTTFYPKFEKFCRPACYVDEHYFPTMLTIQAGNSLANRSITWVDWSRGGP  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+I+E F + +   G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  330  HPATFGRADISEEFFKRML-EGHRCTYNDRNSSICFLFGRKFAPSAMEPLLHLAPKFLGF  388



>ref|XP_004245124.1| PREDICTED: uncharacterized protein LOC101267146 [Solanum lycopersicum]
Length=388

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +YK+++ S HSF+ ++DDP  YGRGRY+  M P++ + +WRKGSQWFEM
Sbjct  210  ESCIPLYNFNVIYKHISRSKHSFVGAFDDPGPYGRGRYDENMLPEVNVSQWRKGSQWFEM  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV +T FY  F ++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  270  SRKLALFIVEDTIFYPKFAEFCRPACYVDEHYFPTMLTIEASNLLANRSITWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F++ +   G +C+YN   T ICYLFARKF PSALEPL  L+ K +GF
Sbjct  330  HPATFGKSDITEEFMKRML-QGQNCTYNNRNTSICYLFARKFAPSALEPLFLLAPKYLGF  388



>ref|XP_010941940.1| PREDICTED: uncharacterized protein LOC105060052 [Elaeis guineensis]
Length=384

 Score =   221 bits (562),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y+YL  S +SF+ S+DDP  YGRGRYN RM P+I + +WRKG+QWFE+
Sbjct  205  ESCIPLYNFSIIYQYLMRSRYSFVGSFDDPGPYGRGRYNLRMAPEIDITQWRKGAQWFEV  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TK+Y  FK++C+PSCY DEHY PT L +   ++ ANR++T+VDWS GG 
Sbjct  265  NRKLAIDIVRDTKYYPKFKEFCKPSCYVDEHYFPTMLTIESPHLIANRTLTWVDWSRGGA  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ I   G SC YN   + +C+LFARKF PSA+ PL + +  ++GF
Sbjct  325  HPATFGKGDITEAFLKKI-FEGKSCLYNDQPSSVCFLFARKFAPSAMAPLLQFAPSLLGF  383



>ref|XP_006842356.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
 gb|ERN04031.1| hypothetical protein AMTR_s00079p00179880 [Amborella trichopoda]
Length=376

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y YL  S HSF+ S+DDP   GRGRYN  M P+I L EWRKGSQWFE+
Sbjct  196  ESCIPLFNFTTAYSYLINSHHSFVGSFDDPRHCGRGRYNKTMAPEILLSEWRKGSQWFEV  255

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NRALAI IVS+TK+YA+F+++C P CY DEHY+PT++  +    N+NRS  +VDWS GG 
Sbjct  256  NRALAIEIVSDTKYYAIFREHCNPPCYMDEHYLPTFVTKNFPSSNSNRSFMWVDWSRGGS  315

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++ + + TE F+  IR N  +C+YN   T IC+LFARK+ P+AL+PL +++ +V+G 
Sbjct  316  HPATFRSGDATERFLNQIR-NSENCTYNGNPTSICFLFARKWAPNALQPLLRIAPRVLGL  374



>ref|XP_008393663.1| PREDICTED: uncharacterized protein LOC103455840 isoform X1 [Malus 
domestica]
 ref|XP_008393664.1| PREDICTED: uncharacterized protein LOC103455840 isoform X1 [Malus 
domestica]
Length=388

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  V+ YL +S +S++ ++DDP  +GRGRYN  M P++K+  WRKGSQWFE+
Sbjct  210  ESCIPLYNFSVVHHYLMKSKYSYVGAFDDPGPHGRGRYNYNMAPEVKISNWRKGSQWFEV  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +TK+Y  FK++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGP
Sbjct  270  NRKLAVSIVEDTKYYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGP  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F++ I   G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  330  HPATFGRADITEEFLKRI-FRGQRCTYNGQNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  388



>ref|XP_008393665.1| PREDICTED: uncharacterized protein LOC103455840 isoform X2 [Malus 
domestica]
Length=387

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  V+ YL +S +S++ ++DDP  +GRGRYN  M P++K+  WRKGSQWFE+
Sbjct  209  ESCIPLYNFSVVHHYLMKSKYSYVGAFDDPGPHGRGRYNYNMAPEVKISNWRKGSQWFEV  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +TK+Y  FK++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGP
Sbjct  269  NRKLAVSIVEDTKYYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F++ I   G  C+YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  329  HPATFGRADITEEFLKRI-FRGQRCTYNGQNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  387



>ref|XP_004981886.1| PREDICTED: uncharacterized protein LOC101780921 [Setaria italica]
Length=389

 Score =   220 bits (561),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T YKY   S+ SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  210  ESCIPIFDFNTTYKYFQNSSQSFLMAFDDPGPYGRGRYNWNMTPEVELDQWRKGSQWFEV  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV +T +Y  FK++CRP CY DEHY PT L +   +  ANRSVT+VDWS GG 
Sbjct  270  DRELAVAIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPHSLANRSVTWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +I+E F++ +R  G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  330  HPATFGRGDISEEFLRRVR-EGRTCLYNNQNSTMCFLFARKFSPSALEPLLELAPTVLGF  388



>ref|XP_010265065.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265066.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
 ref|XP_010265067.1| PREDICTED: uncharacterized protein LOC104602904 [Nelumbo nucifera]
Length=411

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ++CIP+++F TVY YL  ST SF+E+YD+P   GRGRY+ RMKPDIKL +WRKGSQWFEM
Sbjct  232  DACIPLFNFSTVYNYLIGSTKSFVEAYDEPGPVGRGRYSPRMKPDIKLSQWRKGSQWFEM  291

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI I S+ K++++F +YC+PSCY DEHYIPT + L     N+NRS+T+VDWS GGP
Sbjct  292  DRDLAIEIASDRKYFSLFGRYCKPSCYSDEHYIPTLVSLKFWEKNSNRSLTWVDWSRGGP  351

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   ++T   ++ +RS G +C YN   T +C LFARKF+P+ L+ L + + KVM F
Sbjct  352  HPTRFMRTDVTVELLERMRS-GRTCEYNGKTTNVCSLFARKFYPNTLDRLLRFAPKVMKF  410



>ref|XP_009361651.1| PREDICTED: uncharacterized protein LOC103951891 [Pyrus x bretschneideri]
Length=389

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  V++YL +S +S++ ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+
Sbjct  211  ESCIPLYNFSVVHRYLMKSKYSYVGAFDDPGPHGRGRYNDNMAPEVNISDWRKGSQWFEV  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TK+Y  FK++CRP+CY DEHY PT L +  G   ANRS+T+VDWS GGP
Sbjct  271  NRKLAISIVEDTKYYPKFKEFCRPACYVDEHYFPTMLTIEAGNSLANRSITWVDWSRGGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F++ I   G  C YN   + IC+LF RKF PSA+EPL  L+ K +GF
Sbjct  331  HPATFGRADITEEFLKRIFW-GQRCPYNGQNSTICFLFGRKFAPSAMEPLLHLAPKFLGF  389



>gb|KJB18563.1| hypothetical protein B456_003G060300 [Gossypium raimondii]
Length=383

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y++ S HSF+ESYDDP  YGRGRY++RM+P++ L +WRKGSQWFE+
Sbjct  205  ESCIPLYNFSVIYHYISRSNHSFMESYDDPGPYGRGRYDSRMEPEVTLGQWRKGSQWFEV  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+ + K+Y  FK++C+P+CY DEHY  T L +   ++ ANR++T+ DWS GG 
Sbjct  265  NRMLAINIIEDNKYYPKFKEFCQPACYVDEHYFTTMLTIQVPHLLANRTLTWTDWSRGGA  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   ++TE F Q I   G +C YN   T +C+LFARKF P+AL+PL +L+ KV GF
Sbjct  325  HPATFGKDDMTEAFFQKI-FEGQACLYNGQPTSLCFLFARKFAPNALDPLLELAPKVFGF  383



>ref|XP_006853920.1| hypothetical protein AMTR_s00036p00191120 [Amborella trichopoda]
 gb|ERN15387.1| hypothetical protein AMTR_s00036p00191120 [Amborella trichopoda]
Length=327

 Score =   218 bits (555),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 125/179 (70%), Gaps = 1/179 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+ +F TVY YL  S HSF+ S+DDP+ YGRGRYN  M P++ + EWRKGSQWFE+
Sbjct  149  ESCIPIMNFTTVYHYLMRSRHSFVGSFDDPSVYGRGRYNENMAPEVNITEWRKGSQWFEV  208

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ ++ +T +Y  FK +CRP+CY DEHY PT   +   Y  ANRS+T+VDWS GG 
Sbjct  209  NRKLALTLIEDTTYYPKFKNFCRPACYVDEHYFPTMFTIKAPYHIANRSITWVDWSRGGA  268

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA++   +IT  FI  I  NG  C YN   + +C+LFARKF PSAL PL  L+ K +G
Sbjct  269  HPATFGKVDITVEFIARI-VNGNECKYNNQSSSVCFLFARKFAPSALVPLLDLAPKFIG  326



>ref|XP_004291015.1| PREDICTED: uncharacterized protein LOC101301742 [Fragaria vesca 
subsp. vesca]
Length=389

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VY+Y+ +S +S++ ++DD   +GRGRYN  M P++ + +WRKGSQWFE+
Sbjct  211  ESCIPLYNFTVVYEYMRKSKYSYMGAFDDHGPFGRGRYNDNMAPEVNITQWRKGSQWFEV  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +TKFY  FK++CRP+CY DEHY PT L +  G M ANRS+T+VDWS GGP
Sbjct  271  NRKLAITIVEDTKFYPKFKEFCRPACYVDEHYFPTMLTIQAGSMIANRSITWVDWSRGGP  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ +  +   C+YN   + +C+LFARKF PS LEPL +L+ K +GF
Sbjct  331  HPATFGRGDITEDFMKRMLGSH-RCTYNNQNSTMCFLFARKFAPSTLEPLLRLAPKFLGF  389



>ref|XP_007222895.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
 gb|EMJ24094.1| hypothetical protein PRUPE_ppa006723mg [Prunus persica]
Length=398

 Score =   220 bits (560),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F TVY YL  S  SF++ YDDP+  GRGRYN+ M P I L +WRKGSQWFEM
Sbjct  218  ESCIPLHNFSTVYSYLVRSRESFVQVYDDPSSVGRGRYNSHMYPKISLSQWRKGSQWFEM  277

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R  AI IVS+ K++  F+KYCR SCY DEHY+PT+  ++ G  N+NRS+T+VDWS GGP
Sbjct  278  DRRHAIEIVSDKKYFPAFQKYCRGSCYADEHYLPTFANINFGAKNSNRSLTWVDWSRGGP  337

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +T  ++T   +  +R NGT+C YN   T +C+LFARKF P  LE L + + K+M F
Sbjct  338  HPAKFTRTDVTVELLSRLR-NGTACVYNGKSTNVCFLFARKFGPDTLERLLRFAPKLMRF  396



>ref|XP_009772023.1| PREDICTED: uncharacterized protein LOC104222493 [Nicotiana sylvestris]
Length=388

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +YKY+++S HSFI ++DDP  YGRGRY+  M P++ + +WRKGSQWFE+
Sbjct  210  ESCIPLYNFNVIYKYISQSKHSFIGAFDDPGPYGRGRYDENMLPEVNITDWRKGSQWFEI  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +TKFY  F ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  270  NRKLALYIVEDTKFYPKFAEFCKPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F++ + + G +C+YN     +C+LFARKF PSALEPL  L+   +GF
Sbjct  330  HPATFGKSDITEEFMKRMLAGG-NCTYNERNISMCFLFARKFAPSALEPLFLLAPTYLGF  388



>ref|XP_006442617.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
 gb|ESR55857.1| hypothetical protein CICLE_v10020320mg [Citrus clementina]
Length=419

 Score =   220 bits (561),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 135/180 (75%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  S+ +FIE+YD P   GRGRYN  M+P I+L +WRKGSQWFEM
Sbjct  240  ESCIPLFNFSTIYNYLINSSKAFIEAYDLPGPVGRGRYNRPMRPVIRLEQWRKGSQWFEM  299

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +RALA+ ++S+ K++  FK++C+ SCY DEHY+PT++ +     N+NRS+T+VDWS GGP
Sbjct  300  DRALALEVISDKKYFVTFKRHCKASCYADEHYLPTFVSVKFWKRNSNRSLTWVDWSKGGP  359

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +   ++T  F++ +RS G+ C YN   T IC+LFARKF P+AL+ L + + KVMGF
Sbjct  360  HPAKFQRRDVTIEFLKRLRS-GSHCEYNGKSTNICFLFARKFLPNALDRLLRFAPKVMGF  418



>ref|XP_008806040.1| PREDICTED: uncharacterized protein LOC103718829 [Phoenix dactylifera]
Length=397

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 134/179 (75%), Gaps = 1/179 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  ST +++ SYDDP   GRGRYN RMKP +KL +WRKGSQWFE+
Sbjct  217  ESCIPLFNFSTIYSYLINSTKTYVSSYDDPGPNGRGRYNIRMKPHVKLQQWRKGSQWFEV  276

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI I+S+ K++ +FK+YC+PSCY DEHY+ T++ +   + NANRS+T+VDWS  GP
Sbjct  277  DRNLAIEIISDDKYFPVFKRYCKPSCYVDEHYLSTFVSMRFWWRNANRSLTWVDWSKRGP  336

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA +   ++T   ++ +R NG++C YN   T IC+LFARKF P++L  L + + KVMG
Sbjct  337  HPARFGRLDVTIELLKGMR-NGSTCDYNGRTTSICFLFARKFLPNSLTRLMRFAPKVMG  394



>ref|XP_011081713.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
 ref|XP_011081714.1| PREDICTED: uncharacterized protein LOC105164695 [Sesamum indicum]
Length=385

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VY Y+T S +SFI ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  207  ESCIPLYNFSMVYNYITGSKYSFIGAFDDPGPYGRGRYNDNMLPEVNITDWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            N+ LA+ IV +TKFY  F ++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  267  NKKLALYIVEDTKFYPKFSEFCKPACYVDEHYFPTMLTIQAATLLANRSITWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G SC YN   + ICYLFARKF PSALE L  L+ K +GF
Sbjct  327  HPATFGGSDITEEFFKKI-FDGRSCLYNNKPSSICYLFARKFSPSALEALFLLAPKFLGF  385



>gb|KFK25431.1| hypothetical protein AALP_AA8G114400 [Arabis alpina]
Length=387

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL +S HSF+ ++DD   +GRGRY+  M+P++ + +WRKGSQWFE+
Sbjct  209  ESCIPLFNFTTIYSYLIKSKHSFMGAFDDLGPFGRGRYSQNMEPEVPITKWRKGSQWFEI  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  269  NRDLAATIVEDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPAVLANRSLTWVDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C YN G T +CYLFARKF PS LEPL  ++ KV+GF
Sbjct  329  HPATFGRSDITEKFFERI-FDGRNCPYNDGNTSMCYLFARKFAPSTLEPLLHIAHKVLGF  387



>ref|XP_010648315.1| PREDICTED: uncharacterized protein LOC100249300 [Vitis vinifera]
Length=385

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S +SF+ ++DDP  YGRGRYN  MKP++ + +WRKG+QWFE+
Sbjct  207  ESCIPLYNFTLIYHYIMKSKYSFMGAFDDPGPYGRGRYNGNMKPEVSISQWRKGAQWFEV  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T FY  F+++C+P+CY DEHY PT L +  G++ ANRS+T+VDWS GG 
Sbjct  267  NRKLAVNIVEDTTFYKKFEEFCKPACYVDEHYFPTMLTIQSGHLIANRSITWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F+  + SN   C YN   +  C+LFARKF PS LEPL +L+ K +GF
Sbjct  327  HPATFGKADITEEFLHRVVSNH-KCLYNNQPSSTCFLFARKFAPSTLEPLLQLAHKHLGF  385



>ref|XP_010033803.1| PREDICTED: uncharacterized protein LOC104423043 [Eucalyptus grandis]
 gb|KCW53627.1| hypothetical protein EUGRSUZ_J02890 [Eucalyptus grandis]
Length=384

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+ +  TVY YL++S +SFI S+D+ + YGRGRYN +M P+I L EWRKGSQWFE+
Sbjct  206  ESCIPIQNLTTVYSYLSQSRYSFIGSFDEDSSYGRGRYNKKMAPEINLTEWRKGSQWFEV  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+ ++ +Y  FKK+CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  266  NRKLAIDIIEDSTYYPKFKKFCRPTCYVDEHYFPTMLSIQSPDLLANRSLTWVDWSRGGP  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+IT+ F + I  N +SCSYN     +C+LFARKF PSAL  L  L+L V G+
Sbjct  326  HPATFGEADITKEFFKKILEN-SSCSYNDQPYSLCFLFARKFAPSALVSLSDLALDVFGY  384



>emb|CDX69735.1| BnaA10g20840D [Brassica napus]
Length=386

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNDNMEPEVPITKWRKGSQWFEI  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +      ANRS+T+VDWS GGP
Sbjct  268  NRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  328  HPATFGRSDITEKFFEKIL-DGKNCVYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>emb|CBI33634.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE+
Sbjct  116  ESCIPLFNFTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEV  175

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ I+S+ K+Y +F +YC P CY DEHYIPT + + +  MN+NRS+T+VDWS GGP
Sbjct  176  HRELAVQIISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGP  235

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP+ +   +IT+ F+  IR  G+ C YN   T IC+LFARKF P+ALEPL +++  ++GF
Sbjct  236  HPSKFGWGDITDEFLNKIRY-GSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGF  294



>emb|CBI26990.3| unnamed protein product [Vitis vinifera]
Length=296

 Score =   216 bits (549),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F T+YKYL  S HSF+ S+DDP   GRGRYN RM P + L +WRKGSQWFE+
Sbjct  116  ETCIPLFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDWRKGSQWFEV  175

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IVS+  +Y +F+++CRP CY DEHY+ T +      +N+NRS+T+VDWS GG 
Sbjct  176  HRKLAIEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNSNRSITWVDWSRGGS  235

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   +++E F+   R +G +CSYN G + IC+LFARKF PS LEPL +++  ++GF
Sbjct  236  HPTKFVRKDVSEAFLNQAR-HGFNCSYNSGLSSICFLFARKFHPSTLEPLLRIAPSLLGF  294



>ref|XP_008243270.1| PREDICTED: uncharacterized protein LOC103341513 [Prunus mume]
Length=398

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/180 (55%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F TVY YL  S  SF++ YDDP+  GRGRYN+ M P I L +WRKGSQWFEM
Sbjct  218  ESCIPLHNFSTVYSYLVHSRESFVQVYDDPSSVGRGRYNSHMYPKISLSQWRKGSQWFEM  277

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R  AI IVS+ K++  F+KYCR SCY DEHY+PT+  ++ G  N+NRS+T+VDWS GGP
Sbjct  278  HRRHAIDIVSDKKYFPAFQKYCRGSCYADEHYLPTFANINFGAKNSNRSLTWVDWSRGGP  337

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +T  ++T   +  +R NGT+C YN   T +C+LFARKF P  LE L + + K+M F
Sbjct  338  HPAKFTRTDVTVEVLSRLR-NGTACVYNGKSTNVCFLFARKFGPDTLERLLRFAPKLMRF  396



>ref|XP_009357077.1| PREDICTED: uncharacterized protein LOC103947833 [Pyrus x bretschneideri]
Length=400

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F TVY Y+  S  +F++ YDDP+  GRGRY+  M P + L++WRKGSQWFEM
Sbjct  220  EACIPLHNFSTVYNYVIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWLNQWRKGSQWFEM  279

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R+LAI +VS+ K++ +F+ YC+ SCY DEHY+PT++ +  G  N+NRS+T+VDWS GGP
Sbjct  280  DRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNRSLTWVDWSRGGP  339

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +T  ++T   + S+R NGTSC YN   + +CYLFARKF P  LE L K + K+MGF
Sbjct  340  HPAKFTRTDVTVDVLNSLR-NGTSCIYNGRVSNVCYLFARKFGPETLERLLKFAPKLMGF  398



>ref|XP_008339646.1| PREDICTED: uncharacterized protein LOC103402673 [Malus domestica]
Length=400

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F TVY Y+  S  +F++ YDDP+  GRGRY+  M P + L++WRKGSQWFEM
Sbjct  220  ESCIPLHNFSTVYNYIIRSNETFVQVYDDPSSVGRGRYSFNMYPQVWLNQWRKGSQWFEM  279

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R+LAI +VS+ K++ +F+ YC+ SCY DEHY+PT++ +  G  N+NR++T+VDWS GGP
Sbjct  280  DRSLAIEVVSDRKYFPVFQSYCKGSCYADEHYLPTFVNMKFGKKNSNRTLTWVDWSRGGP  339

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +T  ++T   + S+R NGTSC YN   + +CYLFARKF P  LE L K + K+MGF
Sbjct  340  HPAKFTRTDVTIDVLNSLR-NGTSCIYNGRVSNVCYLFARKFGPETLERLLKFAPKLMGF  398



>ref|XP_002466519.1| hypothetical protein SORBIDRAFT_01g009210 [Sorghum bicolor]
 gb|EER93517.1| hypothetical protein SORBIDRAFT_01g009210 [Sorghum bicolor]
Length=402

 Score =   219 bits (557),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y Y   S+HSF+ S DDP R GRGRYN  M P+++L +WRKG QWFE 
Sbjct  220  ESCIPLFDFNTTYGYFQNSSHSFVMSIDDPGRDGRGRYNLNMAPEVELEQWRKGWQWFEA  279

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV +T +Y  FK++CRP CY DEHYI T L++   +  ANR+ T+VDWS GGP
Sbjct  280  DRDLAVAIVEDTVYYPKFKQFCRPGCYADEHYIQTMLKIEAPHKLANRTATWVDWSRGGP  339

Query  298  ---HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  128
               HPA++   +ITE F++ IR  G +C YN   T +CYLFARKF PSALEPL +L+  V
Sbjct  340  NSAHPATFGRGDITEEFLKGIR-GGETCLYNGQNTTLCYLFARKFAPSALEPLLELAPTV  398

Query  127  MGF  119
            +GF
Sbjct  399  LGF  401



>gb|KHG10617.1| Putative non-structural 4 [Gossypium arboreum]
Length=388

 Score =   218 bits (556),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y+Y+ +S HSF+ ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+
Sbjct  210  ESCIPLYNFSVIYQYIMKSKHSFMGAFDDPGPFGRGRYNYNMVPEVNISKWRKGSQWFEV  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  270  NRKLAINIVEDVTYYPKFEQFCRPACYVDEHYFPTMLTIQTPNLLANRSITWVDWSRGGP  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP ++  ++ITE F   I   G  C YN   + IC+LFARKF PSA+EPL +++ KV+GF
Sbjct  330  HPGTFGRSDITEDFFNRIL-EGRQCRYNDQPSSICFLFARKFAPSAMEPLLQIAQKVLGF  388



>ref|XP_007024391.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY27013.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=386

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +Y+Y++ S HSF+ S+D+   YGRGRYN RM+P++ L +WRKGSQWFE+
Sbjct  208  ESCIPLHNFSIIYRYISRSRHSFMGSFDEAGPYGRGRYNPRMEPEVTLSQWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+ +T +Y  FK++CRP+CY DEHY PT L +   ++ ANR++T+ DWS GG 
Sbjct  268  NRRLAINIIEDTTYYPKFKEFCRPACYVDEHYFPTMLSIQFPHLLANRTLTWTDWSRGGA  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITEG    I   G  C YN   + +CYLFARKF PSAL+PL  L+ KV+G+
Sbjct  328  HPATFGKADITEGLFNKIL-EGQLCLYNNQPSSVCYLFARKFAPSALDPLLGLASKVLGY  386



>gb|EEE59868.1| hypothetical protein OsJ_12453 [Oryza sativa Japonica Group]
Length=383

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  204  ESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQWRKGSQWFEV  263

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T+VDWS GG 
Sbjct  264  NRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGA  323

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  324  HPATFGRGDITEEFLRRVQ-EGRTCLYNGQNSTMCFLFARKFAPSALEPLLELAPTVLGF  382



>ref|XP_010099264.1| hypothetical protein L484_015454 [Morus notabilis]
 gb|EXB77528.1| hypothetical protein L484_015454 [Morus notabilis]
Length=423

 Score =   219 bits (558),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 131/180 (73%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+Y+F T+Y YL  +T + + +YD+P   GRGRYN  M PDI L +WRKGSQWFEM
Sbjct  242  EACIPLYNFKTIYNYLINATKNHVMAYDEPGVVGRGRYNYHMYPDISLKQWRKGSQWFEM  301

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI +VS++K++ +F+KYCR +CY DEHY+PT + +     N+NRS+T+VDWS GGP
Sbjct  302  NRELAIEVVSDSKYFPIFQKYCRGNCYSDEHYLPTLVSIKFWEGNSNRSLTWVDWSKGGP  361

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +   ++T   ++S+R N T C+YN   T +CYLFARKF PS ++ L K + K+M F
Sbjct  362  HPARFWRTDVTLELLRSMRRNNTGCAYNENSTNLCYLFARKFLPSTVDRLLKFAPKIMHF  421



>ref|NP_197969.2| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|ABE66181.1| hypothetical protein At5g25970 [Arabidopsis thaliana]
 gb|AED93506.1| core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Arabidopsis thaliana]
 gb|AHL38604.1| glycosyltransferase, partial [Arabidopsis thaliana]
Length=387

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y Y+T+S HSF+ S+DDP  YGRGRY+  M P++ + +WRKGSQWFE+
Sbjct  209  ESCIPLFNFTTIYTYMTKSEHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQWRKGSQWFEI  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  269  NRELAVSIVKDTLYYPKFKEFCQPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGA  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
            HPA++ A +I E F   I   G +C+YN G T +CYLFARKF PSALEPL +++ K++
Sbjct  329  HPATFGAQDINEEFFARIL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLVQIAPKLL  385



>ref|XP_008812373.1| PREDICTED: uncharacterized protein LOC103723273 [Phoenix dactylifera]
Length=406

 Score =   218 bits (556),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  ST +++ S+DD    GRGRYN RMKP +KL EWRKGSQW E+
Sbjct  226  ESCIPLFNFSTIYSYLINSTKTYVSSFDDRGPNGRGRYNIRMKPQVKLQEWRKGSQWLEV  285

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI I+S+ K++ +FKKYC+ SCY DEHY+PT++ +   + N+NRS+T+VDWS GGP
Sbjct  286  DRDLAIEIISDEKYFPVFKKYCKRSCYVDEHYLPTFVSMRFWWSNSNRSLTWVDWSKGGP  345

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +   ++T   ++ +R NG++C YN   T +C+LFARKF P++L  L + + KVMGF
Sbjct  346  HPARFGRLDVTIELLERMR-NGSTCKYNGRTTNVCFLFARKFLPNSLTRLMRFAPKVMGF  404



>gb|KJB70318.1| hypothetical protein B456_011G068900 [Gossypium raimondii]
Length=387

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 131/177 (74%), Gaps = 1/177 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +Y+Y++ S HSF+ S+D+P  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  209  ESCIPLHNFSIIYRYISRSRHSFMGSFDEPGPYGRGRYNPHMQPEVTLSQWRKGSQWFEV  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T +Y  FKK+CRP+CY DEHY PT L +   ++ ANR++T+ DWS GG 
Sbjct  269  NRKLAIDIVVDTTYYPKFKKFCRPACYVDEHYFPTMLTIQSPHLLANRTLTWTDWSRGGA  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  128
            HPA++  A+ITEGF + I   G  C YN   + +CYLFARKF PSAL+PL  L+ KV
Sbjct  329  HPATFGKADITEGFFKKI-FEGQVCLYNGQPSTVCYLFARKFAPSALDPLLGLASKV  384



>gb|ABK28713.1| unknown [Arabidopsis thaliana]
Length=388

 Score =   218 bits (555),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y Y+T+S HSF+ S+DDP  YGRGRY+  M P++ + +WRKGSQWFE+
Sbjct  209  ESCIPLFNFTTIYTYMTKSEHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQWRKGSQWFEI  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  269  NRELAVSIVKDTLYYPKFKEFCQPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGA  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
            HPA++ A +I E F   I   G +C+YN G T +CYLFARKF PSALEPL +++ K++
Sbjct  329  HPATFGAQDINEEFFARIL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLVQIAPKLL  385



>emb|CAN70606.1| hypothetical protein VITISV_040196 [Vitis vinifera]
Length=385

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S +SF+ ++DDP  YGRGRYN  MKP++ + +WRKG+QWFE+
Sbjct  207  ESCIPLYNFTLIYHYIMKSKYSFMGAFDDPGPYGRGRYNGNMKPEVSISQWRKGAQWFEV  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T FY  F+++C+P+CY DEHY PT L +  G + ANRS+T+VDWS GG 
Sbjct  267  NRKLAVNIVEDTTFYKKFEEFCKPACYVDEHYFPTMLTIQSGNLIANRSITWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F+  + SN   C YN   +  C+LFARKF PS LEPL +L+ K +GF
Sbjct  327  HPATFGKADITEEFLHRVVSN-HKCLYNNQPSSTCFLFARKFAPSTLEPLLQLAHKHLGF  385



>ref|XP_009778079.1| PREDICTED: uncharacterized protein LOC104227520 [Nicotiana sylvestris]
Length=382

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  VY+Y++ES HSFI  +DDP   GRGRYN  M P++ + EWRKGSQWFE+
Sbjct  204  ESCIPLHNFSVVYRYISESRHSFISVFDDPGPVGRGRYNKNMSPEVNITEWRKGSQWFEV  263

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +  +Y  F ++C+PSCY DEHY PT L + + ++ ANRS+T VDWS GG 
Sbjct  264  NRKLAIDIVKDQVYYLKFDQFCKPSCYVDEHYFPTMLHIQYPHLLANRSLTLVDWSRGGA  323

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+IT+ F++ I   GT C YN   T +C+LF RKF PS LEPL + S K +GF
Sbjct  324  HPATFGKADITDQFLKKIVEGGT-CVYNNQATSLCFLFTRKFSPSTLEPLLERSSKYLGF  382



>gb|AFO66494.1| hypothetical protein [Brassica napus]
Length=386

 Score =   218 bits (554),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL+ + HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLFNFTTIYSYLSRTKHSFMGAFDDPGPFGRGRYNDNMEPEVPITKWRKGSQWFEI  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +      ANRS+T+VDWS GGP
Sbjct  268  NRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  328  HPATFGRSDITEKFFERIL-DGKNCVYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>ref|XP_006651782.1| PREDICTED: uncharacterized protein LOC102702183 [Oryza brachyantha]
Length=330

 Score =   216 bits (550),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  151  ESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELEQWRKGSQWFEV  210

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T+VDWS GG 
Sbjct  211  DRELAIAIVKDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGA  270

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PS+LEPL +L+  V+GF
Sbjct  271  HPATFGRGDITEEFLRRVQE-GRTCLYNGQNSTMCFLFARKFAPSSLEPLLELAPTVLGF  329



>ref|XP_008663766.1| PREDICTED: uncharacterized protein LOC103642231 [Zea mays]
Length=439

 Score =   219 bits (558),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S  S++ESY+       GRYN +M P++    WRKGS+WFEM
Sbjct  260  ESCVPVFNFRTVYEYLVNSAMSYVESYNIDVPQCAGRYNPQMAPEVLEEHWRKGSEWFEM  319

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ +V++ ++YA+F+++C PSCYPDEHYIPT+L L HG  NANR+VT+VDWS GGP
Sbjct  320  SRDLAVDVVADQRYYALFRRHCTPSCYPDEHYIPTFLHLRHGARNANRTVTWVDWSRGGP  379

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +  A  T   + +IRSNGT C YN   T +CYLFARKF PSAL  L   S  ++ F
Sbjct  380  HPARFGKAATTADLMAAIRSNGTLCLYNGKPTTVCYLFARKFAPSALPMLLNFSNTLLDF  439



>gb|AFW60050.1| hypothetical protein ZEAMMB73_108408 [Zea mays]
Length=437

 Score =   219 bits (557),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S  S++ESY+       GRYN +M P++    WRKGS+WFEM
Sbjct  258  ESCVPVFNFRTVYEYLVNSAMSYVESYNIDVPQCAGRYNPQMAPEVLEEHWRKGSEWFEM  317

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ +V++ ++YA+F+++C PSCYPDEHYIPT+L L HG  NANR+VT+VDWS GGP
Sbjct  318  SRDLAVDVVADQRYYALFRRHCTPSCYPDEHYIPTFLHLRHGARNANRTVTWVDWSRGGP  377

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +  A  T   + +IRSNGT C YN   T +CYLFARKF PSAL  L   S  ++ F
Sbjct  378  HPARFGKAATTADLMAAIRSNGTLCLYNGKPTTVCYLFARKFAPSALPMLLNFSNTLLDF  437



>ref|XP_009763003.1| PREDICTED: uncharacterized protein LOC104214963 isoform X1 [Nicotiana 
sylvestris]
Length=409

 Score =   218 bits (555),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y Y+  ST +F+ESYD P+  GRGRYN +M+P I L +WRKGSQWFE+
Sbjct  230  ESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMQPWITLDQWRKGSQWFEV  289

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI I+++ K++ +FK+YC+P+CY DEHY+PT++ + + + N NR++T+VDW+ GGP
Sbjct  290  DREIAIDIITDQKYFQLFKRYCKPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDWTKGGP  349

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   ++T   +  +R NGT C YN   T +CYLFARKF PS L+ L + + K+M F
Sbjct  350  HPTRFIRTDVTADLLNRMR-NGTQCEYNGDPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  408



>emb|CDP08214.1| unnamed protein product [Coffea canephora]
Length=294

 Score =   214 bits (546),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+T+S +SF+ ++DDP  +GRGRYN  M P++++ +WRKG+QWF++
Sbjct  116  ESCIPLYNFSIIYHYITKSKYSFVGAFDDPGPFGRGRYNENMAPEVQISQWRKGAQWFQI  175

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+IIV++TKFY  F ++CR  CY DEHY PT L +      ANRS+T+VDWS GG 
Sbjct  176  NRKLALIIVADTKFYPKFAEFCRSPCYVDEHYFPTMLTIQAPNQLANRSITWVDWSRGGA  235

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++ +A+ITE FI+ I  N T C YN   T IC+LFARKF PS L+PL  L+ K  G+
Sbjct  236  HPATFGSADITEPFIRGILENHT-CPYNDQPTSICHLFARKFAPSTLQPLFFLAPKYFGY  294



>gb|AAT77886.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF98696.1| expressed protein [Oryza sativa Japonica Group]
Length=398

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  219  ESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQWRKGSQWFEV  278

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T+VDWS GG 
Sbjct  279  NRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGA  338

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  339  HPATFGRGDITEEFLRRVQ-EGRTCLYNGQNSTMCFLFARKFAPSALEPLLELAPTVLGF  397



>emb|CDX97141.1| BnaC09g44840D [Brassica napus]
Length=386

 Score =   217 bits (553),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITKWRKGSQWFEI  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK +CRP+CY DEHY PT L +      ANRS+T+VDWS GGP
Sbjct  268  NRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  328  HPATFGRSDITERFFEKIL-DGKNCIYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>ref|XP_010097098.1| hypothetical protein L484_019537 [Morus notabilis]
 gb|EXB66899.1| hypothetical protein L484_019537 [Morus notabilis]
Length=387

 Score =   217 bits (553),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+++S  SF+ ++DDP  YGRGRYN  M P++ +  WRKGSQWFE+
Sbjct  209  ESCIPLYNFSIIYHYISKSKFSFMGAFDDPGPYGRGRYNDNMLPEVNISRWRKGSQWFEV  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  I+ +T FY  F+K+CRP+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  269  NRKLATYIIGDTTFYPKFEKFCRPACYVDEHYFPTMLTIEAANLLANRSITWVDWSRGGA  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +IT+ F + +   GT C+YN   + IC+LFARKF PSALEPL ++S KV+G+
Sbjct  329  HPATFGRPDITDEFFKRV-FEGTRCTYNNRNSSICFLFARKFAPSALEPLLRISKKVLGY  387



>ref|XP_010318628.1| PREDICTED: uncharacterized protein LOC101267221 isoform X2 [Solanum 
lycopersicum]
Length=282

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+YDF T+Y Y+  S ++F+ESYD  +  GRGRYN +MKP + L +WRKGSQWFE+
Sbjct  103  ESCIPLYDFTTIYDYIINSANTFMESYDLISPVGRGRYNKKMKPLVTLAQWRKGSQWFEV  162

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI I+S+ K+  +FK++CRP+CY DEHY+PT++ + + + N NR++T+VDW+ GGP
Sbjct  163  DREIAIDIISDQKYSNLFKRFCRPACYSDEHYLPTFVTMKYWWKNENRTLTWVDWAKGGP  222

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   ++TE  +  +R NGT C YN   + +CYLFARKF PS L+ L + + K+M F
Sbjct  223  HPTKFIRPDVTEDLLYGMR-NGTKCEYNGQPSNMCYLFARKFLPSTLDRLLRFAPKIMKF  281



>tpg|DAA51165.1| TPA: hypothetical protein ZEAMMB73_778026 [Zea mays]
Length=207

 Score =   211 bits (537),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S  SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  28   ESCIPIFDFNTTYRYFRNSNQSFLMAFDDPGPYGRGRYNWNMTPEVELDQWRKGSQWFEV  87

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  88   HRELAIEIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPNRLANRSVTWVDWSRGGA  147

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +IT  F++ +R  G +C +N   + +C+LFARKF PS LEPL +L+  V+GF
Sbjct  148  HPATFGRGDITLEFLRRVRE-GRTCLHNNQNSTMCFLFARKFAPSTLEPLLELAPTVLGF  206



>emb|CDX97139.1| BnaC09g44860D [Brassica napus]
Length=386

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNHNMEPEVPITKWRKGSQWFEI  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK +CRP+CY DEHY PT L +      ANRS+T+VDWS GGP
Sbjct  268  NRELAATIVKDTLYYPKFKDFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGP  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  328  HPATFGRSDITERFFEKIL-DGKNCIYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  386



>gb|AAD40142.1|AF149413_23 contains similarity to several Arabidopsis thaliana hypothetical 
proteins including GB:U95973 and GB:AC002392 [Arabidopsis 
thaliana]
Length=436

 Score =   218 bits (556),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 132/178 (74%), Gaps = 1/178 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y Y+T+S HSF+ S+DDP  YGRGRY+  M P++ + +WRKGSQWFE+
Sbjct  258  ESCIPLFNFTTIYTYMTKSEHSFMGSFDDPGAYGRGRYHGNMAPEVFIDQWRKGSQWFEI  317

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T +Y  FK++C+P+CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  318  NRELAVSIVKDTLYYPKFKEFCQPACYVDEHYFPTMLTIEKPAALANRSVTWVDWSRGGA  377

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
            HPA++ A +I E F   I   G +C+YN G T +CYLFARKF PSALEPL +++ K++
Sbjct  378  HPATFGAQDINEEFFARIL-KGDNCTYNGGYTSMCYLFARKFSPSALEPLVQIAPKLL  434



>ref|XP_006466159.1| PREDICTED: uncharacterized protein LOC102619633 [Citrus sinensis]
Length=385

 Score =   217 bits (552),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  VY Y+++S +SF+ESYDDP  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  207  ESCIPLHNFSIVYYYISKSRYSFMESYDDPGPYGRGRYNGNMEPEVTLSQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ I+ +T +Y  F+ +C+P CY DEHY PT L +H   + ANR++T+ DWS GG 
Sbjct  267  NRRLAVDIIEDTSYYPKFRDFCKPGCYVDEHYFPTMLTIHFSRLLANRTLTWTDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y  A+I+E F + I ++ + C YN+  T  CYLF RKF PSAL PL +LSL   GF
Sbjct  327  HPATYGGADISEEFFRKITAS-SQCYYNKQVTSFCYLFGRKFAPSALGPLLELSLSAFGF  385



>ref|NP_001044966.1| Os01g0875800 [Oryza sativa Japonica Group]
 dbj|BAF06880.1| Os01g0875800 [Oryza sativa Japonica Group]
 dbj|BAG97459.1| unnamed protein product [Oryza sativa Japonica Group]
Length=384

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 127/180 (71%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV  F   Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+
Sbjct  205  ESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFEL  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG 
Sbjct  265  RRDLAVAALTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGA  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL  +S  VM +
Sbjct  325  HPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVMQY  384



>ref|XP_002280674.1| PREDICTED: uncharacterized protein LOC100244641 [Vitis vinifera]
Length=414

 Score =   217 bits (553),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE+
Sbjct  234  ESCIPLFNFTTTYNYLMASNLSFLGSFDDPRKPGRGRYNPQMWPAINISDWRKGSQWFEV  293

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ I+S+ K+Y +F +YC P CY DEHYIPT + + +  MN+NRS+T+VDWS GGP
Sbjct  294  HRELAVQIISDRKYYTIFGEYCHPPCYMDEHYIPTLVNMLYVKMNSNRSITWVDWSRGGP  353

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP+ +   +IT+ F+  IR  G+ C YN   T IC+LFARKF P+ALEPL +++  ++GF
Sbjct  354  HPSKFGWGDITDEFLNKIRY-GSDCIYNGNTTNICFLFARKFLPTALEPLLRIAPLLLGF  412



>ref|NP_001169393.1| uncharacterized protein LOC100383262 [Zea mays]
 gb|ACN33611.1| unknown [Zea mays]
 tpg|DAA51166.1| TPA: hypothetical protein ZEAMMB73_632462 [Zea mays]
Length=403

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/183 (54%), Positives = 131/183 (72%), Gaps = 4/183 (2%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S+HSF+ S DDP R GRGRYN  M P+++L +WRKG QWFE 
Sbjct  221  ESCIPLFDFNTTYEYFQNSSHSFVMSIDDPGRDGRGRYNLNMAPEVELEQWRKGWQWFEA  280

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IV +T +Y  FK++CRP CY DEHYI T L++   +  ANR+ T+VDWS GGP
Sbjct  281  DRDLAVAIVEDTVYYPKFKQFCRPGCYADEHYIQTMLKIEAPHKLANRTATWVDWSRGGP  340

Query  298  ---HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  128
               HPA++   +ITE F++ +R  G +C YN   T +C+LFARKF PSAL+PL +L+  V
Sbjct  341  NSAHPATFGRGDITEEFLKGVR-GGETCLYNGRNTTVCFLFARKFAPSALQPLLELAPTV  399

Query  127  MGF  119
            +GF
Sbjct  400  LGF  402



>ref|XP_011019540.1| PREDICTED: uncharacterized protein LOC105122240 [Populus euphratica]
Length=385

 Score =   216 bits (551),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+  S HSFI ++DD   YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  207  ESCIPLYNFSVIYDYIMRSKHSFIGAFDDHGPYGRGRYNENMAPEVNITQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V + ++Y  F+++CRPSCY DEHY PT L +    + ANR++T+VDWS GG 
Sbjct  267  NRKLAVSVVEDARYYPKFEEFCRPSCYVDEHYFPTMLTIEAAPLLANRTLTWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F + IR +   C YN   + +C+LFARKF PSALEPL ++S  V+GF
Sbjct  327  HPATFGRADITEEFFKKIRED-KHCIYNNQSSPVCFLFARKFAPSALEPLLQVSQNVLGF  385



>dbj|BAD82090.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ14347.1| hypothetical protein OsJ_04268 [Oryza sativa Japonica Group]
Length=380

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 127/180 (71%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV  F   Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+
Sbjct  201  ESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFEL  260

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG 
Sbjct  261  RRDLAVAALTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGA  320

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL  +S  VM +
Sbjct  321  HPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVMQY  380



>gb|KDO58674.1| hypothetical protein CISIN_1g040146mg [Citrus sinensis]
Length=385

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+P+++F  VY Y+++S +SF+ESYDDP  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  207  ESCVPLHNFSIVYYYISKSRYSFMESYDDPGPYGRGRYNGNMEPEVTLSQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ I+ +T +Y  F+ +C+P CY DEHY PT L +H   + ANR++T+ DWS GG 
Sbjct  267  NRRLAVDIIEDTSYYPKFRDFCKPGCYVDEHYFPTMLTIHFSRLLANRTLTWTDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y  A+I+E F + I ++ + C YN+  T  CYLF RKF PSAL PL +LSL   GF
Sbjct  327  HPATYGGADISEEFFRKITAS-SQCYYNKQVTSFCYLFGRKFAPSALGPLLELSLSAFGF  385



>gb|EEC76122.1| hypothetical protein OsI_13390 [Oryza sativa Indica Group]
Length=3986

 Score =   229 bits (585),  Expect = 1e-64, Method: Composition-based stats.
 Identities = 98/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658   ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
             ESCIP+++F T Y+YL  S+ SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  3807  ESCIPIFNFNTTYRYLQNSSQSFVMAFDDPGPYGRGRYNWNMTPEVELTQWRKGSQWFEV  3866

Query  478   NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             NR LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRS+T+VDWS GG 
Sbjct  3867  NRELAIEIVRDTLYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSITWVDWSRGGA  3926

Query  298   HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
             HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  3927  HPATFGRGDITEEFLRRVQE-GRTCLYNGQNSTMCFLFARKFAPSALEPLLELAPTVLGF  3985



>ref|XP_009624653.1| PREDICTED: uncharacterized protein LOC104115679 [Nicotiana tomentosiformis]
Length=408

 Score =   217 bits (552),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y Y+  ST +F+ESYD P+  GRGRYN +M+P I L +WRKGSQWFE+
Sbjct  229  ESCIPLYNFTTIYNYIMNSTKTFMESYDLPSPVGRGRYNKKMRPWITLDQWRKGSQWFEV  288

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI I+S+ K++ +FK+YC+P+CY DEHY+PT   + + + N NR++T+VDWS GGP
Sbjct  289  DREMAIDIISDQKYFQLFKRYCKPACYSDEHYLPTVATMRYWWKNGNRTLTWVDWSKGGP  348

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +    +T   +  +R NGT C YN   T +CYLFARKF PS L+ L + + K+M F
Sbjct  349  HPTRFIRTEVTADLLNRMR-NGTKCEYNGEPTNMCYLFARKFLPSTLDRLLRFAPKIMKF  407



>gb|KDP34129.1| hypothetical protein JCGZ_07700 [Jatropha curcas]
Length=386

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+  S +SF+ ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLYNFTVIYHYIMRSKYSFVGAFDDPGPYGRGRYNENMAPEVNISQWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +TK+Y  F+++C+P+CY DEHY PT L +   ++ ANRS+T+VDWS GG 
Sbjct  268  NRRLAVTIVEDTKYYPKFEEFCKPNCYVDEHYFPTMLNIQAAHLIANRSLTWVDWSRGGA  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F +     G  C+YN   + IC+LF RKF PSALEPL  ++  V+GF
Sbjct  328  HPATFGRADITEDFFRKF-FEGQHCTYNNQPSSICFLFGRKFAPSALEPLLHIAPSVLGF  386



>ref|XP_010244357.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
 ref|XP_010244358.1| PREDICTED: uncharacterized protein LOC104588211 [Nelumbo nucifera]
Length=385

 Score =   216 bits (550),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+  S +SFI ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  207  ESCIPLYNFSIIYNYIARSRYSFIGAFDDPGPYGRGRYNENMAPEVNITQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +  FY  F+++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  267  NRKLAINIVGDVIFYPKFEEFCKPNCYVDEHYFPTMLTIQAAQLLANRSITWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F++ I   G SC YN   + +CYLFARKF PSALEPL  L+ K  G+
Sbjct  327  HPATFGRADITEDFVKRIL-EGHSCLYNNQPSSVCYLFARKFAPSALEPLFFLAPKYFGY  385



>emb|CDM85189.1| unnamed protein product [Triticum aestivum]
Length=385

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 129/184 (70%), Gaps = 4/184 (2%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++ F  VY YL  S HSF+E Y   T+  +GRY+ RM P I L +WRKGSQWFE+
Sbjct  202  ESCIPLHSFRAVYDYLIGSRHSFVEVYFQQTKQCQGRYSRRMAPAITLQQWRKGSQWFEL  261

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI ++++TK+Y +F+++CRPSCYPDEHY+PT + + HG  NANR+VTYVDWS GG 
Sbjct  262  SRDLAISVLADTKYYPLFRRHCRPSCYPDEHYLPTTVSMLHGARNANRTVTYVDWSKGGA  321

Query  298  HPASYTAANITEGFIQSIRSNGTS----CSYNRGKTQICYLFARKFFPSALEPLEKLSLK  131
            HPA +TA N+T   IQ IR         C YN+  T +C+LFARKF P  L PL  +S  
Sbjct  322  HPAKHTAENVTAAAIQGIRRRRWRNDRPCYYNQRPTSMCFLFARKFAPDTLGPLLNMSSA  381

Query  130  VMGF  119
            VMG+
Sbjct  382  VMGY  385



>gb|KJB54739.1| hypothetical protein B456_009G047200 [Gossypium raimondii]
 gb|KJB54740.1| hypothetical protein B456_009G047200 [Gossypium raimondii]
Length=388

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y+Y+ +S HSF+ ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+
Sbjct  210  ESCIPLYNFSVIYQYIMKSKHSFMGAFDDPGPFGRGRYNYNMVPEVNISKWRKGSQWFEV  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T+VDWS GGP
Sbjct  270  NRKLAINIVEDVTYYPKFEQFCRPACYVDEHYFPTMLTIQTPNLLANRSITWVDWSRGGP  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP ++  ++IT  F + I   G  C YN   + IC+LFARKF PSA+EPL +++ KV+GF
Sbjct  330  HPGTFGRSDITVDFFKRIL-EGHQCKYNDQPSSICFLFARKFAPSAMEPLLQIAQKVLGF  388



>ref|XP_010912680.1| PREDICTED: uncharacterized protein LOC105038537 [Elaeis guineensis]
Length=385

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 133/180 (74%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY YL +S +SF++SYD+    G+G Y++ M P+I   +WRKG+ WFE+
Sbjct  206  ESCIPVFNFPTVYNYLIDSAYSFVQSYDENPIQGQGYYDSHMAPEINHSQWRKGTPWFEV  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R+LA+ IV++ K+Y++F+KYC+ +C+ D+ YIPTYL +  G +NANR+V + DWS+ G 
Sbjct  266  QRSLAVNIVADNKYYSIFRKYCKTTCHSDDSYIPTYLNMLDGILNANRTVIWADWSMRGS  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+Y   +ITEG IQSIR+NGT C YN   + +C+LFA KF P ALEPL  L+  VM F
Sbjct  326  HPATYGHEDITEGIIQSIRNNGTICRYNSKPSSVCFLFAMKFSPDALEPLLNLTSTVMKF  385



>gb|EAY76682.1| hypothetical protein OsI_04637 [Oryza sativa Indica Group]
Length=380

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 127/180 (71%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV  F   Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+
Sbjct  201  ESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFEL  260

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG 
Sbjct  261  RRDLAVASLTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGA  320

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL  +S  VM +
Sbjct  321  HPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVMQY  380



>ref|XP_008244554.1| PREDICTED: uncharacterized protein LOC103342693 [Prunus mume]
Length=341

 Score =   214 bits (546),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I +  WRKGSQWFE+
Sbjct  161  ESCIPLFNFTTTYDYLINSNLSFLSSFDDPRKPGRGRYNPQMYPIINITNWRKGSQWFEV  220

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IVS+ K+Y +F++YC P CY DEHYIPT + L +  +N+ RS+T+VDWS GGP
Sbjct  221  HRELAIHIVSDCKYYPIFQEYCHPPCYIDEHYIPTLVNLLYSELNSKRSITWVDWSRGGP  280

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +  ++IT+ F+  IR  G+ C YN   T IC+LFARKF P+ LEPL +++  ++GF
Sbjct  281  HPGKFGGSDITDEFLNRIRF-GSECEYNGNTTSICFLFARKFMPNTLEPLLRVAPLLLGF  339



>gb|EMT03400.1| hypothetical protein F775_00930 [Aegilops tauschii]
Length=266

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y Y   S+ SF+  +DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  87   ESCIPIFDFNTTYDYFQNSSQSFVMVFDDPGPYGRGRYNYNMTPEVELEQWRKGSQWFEV  146

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI I+ +T++Y  FK++CRP CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  147  DRDLAIEIIRDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSVTWVDWSRGGA  206

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ +++ G +C YN   +  C+LFARKF PSAL+PL  L+  V+G+
Sbjct  207  HPATFGRGDITEEFLRRVQT-GRTCLYNNQNSTTCFLFARKFAPSALQPLLVLAPTVLGY  265



>ref|XP_002279551.2| PREDICTED: uncharacterized protein LOC100250702 [Vitis vinifera]
Length=427

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F T+YKYL  S HSF+ S+DDP   GRGRYN RM P + L +WRKGSQWFE+
Sbjct  247  ETCIPLFNFTTIYKYLINSNHSFVSSFDDPRHIGRGRYNKRMFPTVTLPDWRKGSQWFEV  306

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IVS+  +Y +F+++CRP CY DEHY+ T +      +N+NRS+T+VDWS GG 
Sbjct  307  HRKLAIEIVSDVTYYPIFQEHCRPPCYMDEHYLATLVNKLRPDLNSNRSITWVDWSRGGS  366

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   +++E F+   R +G +CSYN G + IC+LFARKF PS LEPL +++  ++GF
Sbjct  367  HPTKFVRKDVSEAFLNQAR-HGFNCSYNSGLSSICFLFARKFHPSTLEPLLRIAPSLLGF  425



>emb|CDX70416.1| BnaC03g05000D [Brassica napus]
Length=437

 Score =   217 bits (553),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL++S HSFI + DDP  +GRGRYN +M+P++ + +WRKG QWFE+
Sbjct  206  ESCIPLYNFTTIYTYLSQSKHSFIGAVDDPGPFGRGRYNEKMEPEVPITKWRKGPQWFEV  265

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA  IV +T ++  F+++CRP+CY DEHY PT L +      ANRSVT+ DWS GGP
Sbjct  266  DRDLAATIVKDTLYHHKFREFCRPACYSDEHYFPTMLTIEKPTALANRSVTWTDWSRGGP  325

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA++  ++ITE F   I  +G +CSYN   T +CYLFARKF PSALEPL  ++ K+MG
Sbjct  326  HPATFGRSDITEEFFGKI-FDGENCSYNGRNTSMCYLFARKFAPSALEPLLHIAPKIMG  383



>ref|XP_010049161.1| PREDICTED: uncharacterized protein LOC104437817 [Eucalyptus grandis]
 gb|KCW81640.1| hypothetical protein EUGRSUZ_C03002 [Eucalyptus grandis]
Length=385

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S +SF+ ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  207  ESCIPLYNFSLIYHYIMKSGYSFMGAFDDPGPYGRGRYNLNMAPEVNISQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +  ++  F+ +CRP+CY DEHY PT L +  G++ ANRS+T+VDWS GG 
Sbjct  267  NRKLAINIVEDATYHPKFETFCRPACYVDEHYFPTMLTIQAGHLLANRSITWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F++ I  N   C+YN+  +  C+LFARKF PSAL PL +L+ KV+G+
Sbjct  327  HPATFGRSDITEEFLRRISKN-QRCTYNKRNSSTCFLFARKFAPSALHPLLELAPKVLGY  385



>ref|XP_007044267.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY00099.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=404

 Score =   216 bits (549),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F TVY YL  S+ SF+ S+DDPT  GRGRYN +M P + L +WRKGSQWFE+
Sbjct  223  EACIPLFNFTTVYNYLINSSRSFLGSFDDPTHTGRGRYNKQMWPTVSLADWRKGSQWFEV  282

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IVS+ K+Y +F+ +CRP CY DEHY+PT + L    +N+NRS+T+VDWS GGP
Sbjct  283  NRMLAAEIVSDDKYYPVFRDHCRPPCYMDEHYLPTLVNLICPELNSNRSITWVDWSRGGP  342

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  Y   +++   +  +R  G +C+YN  ++ IC+LFARKF PS LEPL +++  ++GF
Sbjct  343  HPTKYLRKDVSVALLNQVR-QGFNCTYNGERSSICFLFARKFHPSTLEPLLRIAPALLGF  401



>ref|XP_010230469.1| PREDICTED: uncharacterized protein LOC100843610 [Brachypodium 
distachyon]
Length=390

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S+ SF+  +DDP  YGRGRYN  M P++++ +WRKGSQWFE+
Sbjct  211  ESCIPIFDFNTTYEYFQNSSQSFVMVFDDPGPYGRGRYNDNMTPEVEITQWRKGSQWFEV  270

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IV +T++Y  FK++CRP CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  271  DRELAIEIVKDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSVTWVDWSRGGA  330

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ ++S  T C YN   + +C+LFARKF PSALEPL  L+  V+G+
Sbjct  331  HPATFGRGDITEEFLRRVQSKHT-CLYNNQNSTMCFLFARKFAPSALEPLLVLAPTVLGY  389



>gb|KHG11266.1| Insulin-degrading enzyme [Gossypium arboreum]
Length=359

 Score =   214 bits (546),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S +SFI ++DDP  +G+GRYN  M P++ L +WRKGSQWFE+
Sbjct  181  ESCIPLYNFSVIYHYIKKSKYSFIGAFDDPGPHGQGRYNESMAPEVNLTQWRKGSQWFEI  240

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  241  NRKLAVNIVEDITYYPKFEQFCRPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGA  300

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++ +A+ITE F   I   G  C YN   + IC+LFARKF PSALEPL +++ KV+GF
Sbjct  301  HPATFGSADITEEFFTRIY-EGHECWYNDQPSSICFLFARKFAPSALEPLLQIAPKVLGF  359



>emb|CDX78439.1| BnaA03g03510D [Brassica napus]
Length=401

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 130/179 (73%), Gaps = 1/179 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL++S HSFI + DDP  +GRGRYN  M+P++ + +WRKG QWFE+
Sbjct  209  ESCIPLYNFTTIYTYLSQSKHSFIGAVDDPGPFGRGRYNDNMEPEVPITKWRKGPQWFEL  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA  IV +  ++  F+++CRP+CY DEHY PT L +      ANRSVT+ DWS GGP
Sbjct  269  DRDLAATIVKDALYHHKFREFCRPACYSDEHYFPTMLTIEKPTALANRSVTWTDWSRGGP  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA++  ++ITE F   I  +G +CSYN   T +CYLFARKF PSALEPL  ++ K+MG
Sbjct  329  HPATFGRSDITEEFFGKI-FDGENCSYNGRNTSMCYLFARKFAPSALEPLLHIAPKIMG  386



>gb|KCW83891.1| hypothetical protein EUGRSUZ_B00742 [Eucalyptus grandis]
Length=302

 Score =   213 bits (541),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 128/180 (71%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  ST SFIE+YD P   GRGRYN RM+P I++ +WRKGSQWFEM
Sbjct  123  ESCIPLFNFTTIYSYLVGSTRSFIEAYDKPGPVGRGRYNLRMRPVIQIGQWRKGSQWFEM  182

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ +VS+ K+ ++F+++C+ SCY DEHY+PT + +     N+NRS+T+VDWS GGP
Sbjct  183  DRGLAVEVVSDMKYISVFRRFCKGSCYSDEHYLPTLVSIKFWRRNSNRSLTWVDWSKGGP  242

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +    +T   ++ +R     C YN   T +C+LFARKF P+AL+ L + + KVM F
Sbjct  243  HPTRFGRWQVTVELLKRLRGGSRKCEYNGKSTSVCFLFARKFLPNALDRLLRFAPKVMEF  302



>gb|KJB65609.1| hypothetical protein B456_010G103300 [Gossypium raimondii]
Length=386

 Score =   215 bits (547),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S +SFI ++DDP  +G+GRYN  M P++ L +WRKGSQWFE+
Sbjct  208  ESCIPLYNFSVIYHYIKKSKYSFIGAFDDPGPHGQGRYNESMAPEVNLTQWRKGSQWFEI  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +  +Y  F+++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  268  NRKLAVNIVEDITYYPKFEQFCRPACYVDEHYFPTMLTIQASNLLANRSITWVDWSRGGA  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++ +A+ITE F   I   G  C YN   + IC+LFARKF PSALEPL +++ KV+GF
Sbjct  328  HPATFGSADITEEFFTRIY-EGHECRYNDQPSSICFLFARKFAPSALEPLLQIAPKVLGF  386



>ref|XP_009344746.1| PREDICTED: uncharacterized protein LOC103936628 [Pyrus x bretschneideri]
Length=558

 Score =   219 bits (558),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE+
Sbjct  378  ESCIPLFNFTTAYHYLINSNLSFLNSFDDPRKPGRGRYNPQMYPMINITDWRKGSQWFEV  437

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IVS+ K+Y +F++YC P CY DEHYIPT + L +  +N+NRSVT+VDWS GGP
Sbjct  438  HRELAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLMYTELNSNRSVTWVDWSRGGP  497

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   +IT+ F+  IR  G+ C+YN   T +C+LFARKF P ALEPL +++  ++GF
Sbjct  498  HPGKFGWMDITDEFLNRIRF-GSECTYNGNTTSVCFLFARKFLPDALEPLLRVAPLLLGF  556



>ref|XP_004986256.1| PREDICTED: uncharacterized protein LOC101760830 [Setaria italica]
Length=407

 Score =   216 bits (549),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 130/183 (71%), Gaps = 4/183 (2%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S+ SF+ S DDP R GRGRYN  M P++ L +WRKG QWFE+
Sbjct  225  ESCIPLFDFNTTYQYFQNSSQSFVMSIDDPGRDGRGRYNLNMAPEVYLEQWRKGWQWFEV  284

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IV +T +Y  FKK+CRP CY DEHYI T L +   +  ANR+VT+VDWS GGP
Sbjct  285  DRELAIAIVRDTLYYPKFKKFCRPGCYADEHYIQTMLTIEATHSLANRTVTWVDWSRGGP  344

Query  298  ---HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  128
               HPA++   +ITE F++ IR  G +C YN   + +C+LFARKF PSALEPL +L+  V
Sbjct  345  HAAHPATFGRGDITEEFLRGIR-GGETCMYNNQNSTMCHLFARKFAPSALEPLLELAPTV  403

Query  127  MGF  119
            +GF
Sbjct  404  LGF  406



>ref|XP_009151114.1| PREDICTED: uncharacterized protein LOC103874440 [Brassica rapa]
Length=386

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y Y+++S HSF+ S+DDP+ YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  208  ESCIPLYNFTTIYGYISKSKHSFMGSFDDPSPYGRGRYNGNMSPEVSIEQWRKGSQWFEV  267

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V +T +Y  FK++C P+CY DEHY PT L +      ANRS+T+VDWS GG 
Sbjct  268  NRELAVSLVKDTLYYPKFKEFCTPACYVDEHYFPTMLTIEKPAALANRSLTWVDWSRGGA  327

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +I E F   I   G +C+YN   T +C LFARKF PSALEPL +++ K++ F
Sbjct  328  HPATFGEPDINEDFFAKIM-KGDNCTYNGESTSMCSLFARKFSPSALEPLIQIAPKILSF  386



>gb|EYU20381.1| hypothetical protein MIMGU_mgv1a0226482mg, partial [Erythranthe 
guttata]
Length=212

 Score =   209 bits (532),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T++ Y+T S +SF  ++DDP  +GRGRYN  M P++ + +WRKGSQWFE+
Sbjct  34   ESCIPLHNFTTIHSYITGSKYSFTGAFDDPGPFGRGRYNDHMLPEVDIKDWRKGSQWFEV  93

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ ++ + KFY  F+++CRP+CY DEHY PT L +  G + ANRSVT+VDWS GG 
Sbjct  94   SRQLALYLIQDKKFYPKFEQFCRPACYVDEHYFPTMLTVQAGNLLANRSVTWVDWSRGGA  153

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I   G  C YN   + +C LFARKF PSALEPL  L+ K +GF
Sbjct  154  HPATFGRSDITEDFFKRI-FEGEKCLYNDQPSSVCSLFARKFSPSALEPLFFLAPKFLGF  212



>dbj|BAB86235.1| P0648C09.24 [Oryza sativa Japonica Group]
Length=481

 Score =   217 bits (553),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 126/178 (71%), Gaps = 0/178 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV  F   Y YLT S HSF+E Y    +  RGRY+ RM+PDI L +WRKGSQWFE+
Sbjct  201  ESCIPVQSFPVAYGYLTGSRHSFVEVYYHKGKTCRGRYSRRMEPDITLPQWRKGSQWFEL  260

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
             R LA+  +++ ++Y +F+++CRPSCYPDEHY+PT++ + HG  N+NR+VTYVDWS GG 
Sbjct  261  RRDLAVAALTDARYYPLFRRHCRPSCYPDEHYLPTFVAMLHGADNSNRTVTYVDWSRGGA  320

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVM  125
            HPA+YTA ++T   I SIR +   C YN   T  C+LFARKF   ALEPL  +S  VM
Sbjct  321  HPATYTAGDVTPELILSIRRSEVPCMYNSRPTTACFLFARKFSADALEPLLNISSTVM  378



>ref|XP_010264609.1| PREDICTED: uncharacterized protein LOC104602574 [Nelumbo nucifera]
Length=404

 Score =   215 bits (547),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 134/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F TVY YL  S  +F+E+YD+P   GRGRYN RMKP I L +WRKG+QWFEM
Sbjct  224  EACIPLFNFSTVYNYLIGSNMTFVEAYDEPGPVGRGRYNHRMKPLITLDQWRKGAQWFEM  283

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IVS+ K++++F KYC+ SCY DEHYIPT++ ++    N+NR++T+VDWS GGP
Sbjct  284  DRDLAIEIVSDVKYFSVFGKYCKGSCYSDEHYIPTFVSVNFWEKNSNRTLTWVDWSRGGP  343

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   ++T   ++ +R+  T+C YN   T ICYLFARKF+P++L+ L + + KVM F
Sbjct  344  HPTRFIRTDVTIELLEMMRT-ATTCKYNGNTTNICYLFARKFYPNSLDRLLRFAPKVMMF  402



>ref|XP_010999299.1| PREDICTED: uncharacterized protein LOC105107168 [Populus euphratica]
Length=383

 Score =   214 bits (545),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +Y+Y+++S +SFI  +DDP  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  205  ESCIPLHNFGIIYRYISKSRYSFIGVFDDPGPYGRGRYNWNMQPEVMLDQWRKGSQWFEV  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ ++ ++ +Y  FK +CRP CY DEHY PT L +   ++ ANRSVT+ DWS GG 
Sbjct  265  DRKLAVSVIEDSTYYPKFKDFCRPGCYADEHYFPTMLSIQFPHLLANRSVTWTDWSRGGA  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++IT+ F + +   G SC YN     +C+LFARKF PSALEPL  LS KV+GF
Sbjct  325  HPATFGNSDITDEFFKRM-FEGQSCLYNNQPDNVCFLFARKFAPSALEPLLDLSPKVLGF  383



>ref|XP_011007501.1| PREDICTED: uncharacterized protein LOC105113152 isoform X2 [Populus 
euphratica]
Length=411

 Score =   215 bits (547),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIPV++F T+Y YL  S  SF+ S+DDP   GRGRYN RM+P + L +WRKGSQWFE 
Sbjct  231  ETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWFEA  290

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI ++S+ K+Y +F+ +CRP CY DEHY PT +      +N+NRS+T+VDWS GG 
Sbjct  291  HRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGGGS  350

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   +++E F+  IR NG +C+YN G T +C+LFARKF PS L+PL +++  ++GF
Sbjct  351  HPTRFVRKDVSEAFLNQIR-NGFNCTYNGGITTVCFLFARKFHPSTLDPLLRIAPGLLGF  409



>ref|XP_011007493.1| PREDICTED: uncharacterized protein LOC105113152 isoform X1 [Populus 
euphratica]
Length=415

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIPV++F T+Y YL  S  SF+ S+DDP   GRGRYN RM+P + L +WRKGSQWFE 
Sbjct  235  ETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWFEA  294

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI ++S+ K+Y +F+ +CRP CY DEHY PT +      +N+NRS+T+VDWS GG 
Sbjct  295  HRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGGGS  354

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   +++E F+  IR NG +C+YN G T +C+LFARKF PS L+PL +++  ++GF
Sbjct  355  HPTRFVRKDVSEAFLNQIR-NGFNCTYNGGITTVCFLFARKFHPSTLDPLLRIAPGLLGF  413



>ref|XP_009345696.1| PREDICTED: uncharacterized protein LOC103937474 [Pyrus x bretschneideri]
Length=411

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T Y YL  S  SF+ S+DDP + GRGRYN +M P I + +WRKGSQWFE+
Sbjct  231  ESCIPLFNFTTAYHYLINSNLSFLNSFDDPRKPGRGRYNPQMYPMINITDWRKGSQWFEV  290

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IVS+ K+Y +F++YC P CY DEHYIPT + L +  +N+NRSVT+VDWS GGP
Sbjct  291  HRELAVHIVSDRKYYPIFQQYCNPPCYIDEHYIPTLVNLMYTELNSNRSVTWVDWSRGGP  350

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   +IT+ F+  IR  G+ C+YN   T + +LFARKF P ALEPL +++  ++GF
Sbjct  351  HPGKFGWMDITDEFLNRIRF-GSECTYNGNTTSVFFLFARKFLPDALEPLLRVAPLLLGF  409



>gb|KDP29448.1| hypothetical protein JCGZ_18369 [Jatropha curcas]
Length=258

 Score =   210 bits (534),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F T+Y YL  ST +F+E+YD     GRGRYN +M P I + +WRKGSQWFEM
Sbjct  78   EACIPLFNFSTIYSYLINSTKNFVEAYDLEGPVGRGRYNHQMSPQITIDQWRKGSQWFEM  137

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI +VS+ K++ +F+KYC+ +CY DEHY+PT++ + H   N+NRS+T+VDWS GGP
Sbjct  138  DRQLAIEVVSDQKYFPIFQKYCKGNCYADEHYLPTFVSMKHWQRNSNRSLTWVDWSRGGP  197

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +    +T  F++ +RS G+ C YN   + IC+LFARKF P+AL+ L + + K M F
Sbjct  198  HPTRFIRTEVTVEFLEKLRS-GSKCLYNGKSSSICFLFARKFLPTALDRLLRFAPKAMHF  256



>gb|KHG05757.1| hypothetical protein F383_31190 [Gossypium arboreum]
Length=387

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 130/177 (73%), Gaps = 1/177 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +Y Y++ S +SF+ S+D+P  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  209  ESCIPLHNFSIIYHYISRSRYSFMGSFDEPGPYGRGRYNPHMEPEVTLSQWRKGSQWFEV  268

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T +Y  FKK+CRP+CY DEHY PT L +   ++ ANR++T+ DWS GG 
Sbjct  269  NRKLAIDIVVDTTYYPKFKKFCRPACYVDEHYFPTMLTIQSPHLLANRTLTWTDWSRGGA  328

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKV  128
            HPA++  A+ITEGF + I   G  C YN   + +CYLFARKF PSAL+PL  L+ KV
Sbjct  329  HPATFGKADITEGFFKKI-FEGQVCLYNGQPSTVCYLFARKFAPSALDPLLGLASKV  384



>ref|XP_004236422.2| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010318627.1| PREDICTED: uncharacterized protein LOC101267221 isoform X1 [Solanum 
lycopersicum]
Length=426

 Score =   215 bits (547),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+YDF T+Y Y+  S ++F+ESYD  +  GRGRYN +MKP + L +WRKGSQWFE+
Sbjct  247  ESCIPLYDFTTIYDYIINSANTFMESYDLISPVGRGRYNKKMKPLVTLAQWRKGSQWFEV  306

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI I+S+ K+  +FK++CRP+CY DEHY+PT++ + + + N NR++T+VDW+ GGP
Sbjct  307  DREIAIDIISDQKYSNLFKRFCRPACYSDEHYLPTFVTMKYWWKNENRTLTWVDWAKGGP  366

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +   ++TE  +  +R NGT C YN   + +CYLFARKF PS L+ L + + K+M F
Sbjct  367  HPTKFIRPDVTEDLLYGMR-NGTKCEYNGQPSNMCYLFARKFLPSTLDRLLRFAPKIMKF  425



>ref|XP_002515894.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46314.1| conserved hypothetical protein [Ricinus communis]
Length=385

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F  +Y+Y++ S HSF+ S+D+ + YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  207  EACIPLHNFSIIYRYISRSRHSFMGSFDENSPYGRGRYNWNMQPEVTLEQWRKGSQWFEV  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR  A+ IV +T +Y  F+ +C+P+CY DEHY PT L +   ++ ANR++T+ DWS GG 
Sbjct  267  NRRFAVNIVEDTTYYPKFRDFCQPACYVDEHYFPTMLTIQVPHLLANRTLTWTDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F + +   G SC+YN   T +CYLFARKF PSALEPL  LS KV GF
Sbjct  327  HPATFGKADITEEFFKRM-FEGQSCTYNNQPTTVCYLFARKFAPSALEPLLGLSSKVFGF  385



>ref|XP_006450782.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 ref|XP_006450783.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 ref|XP_006475972.1| PREDICTED: uncharacterized protein LOC102614541 isoform X1 [Citrus 
sinensis]
 ref|XP_006475973.1| PREDICTED: uncharacterized protein LOC102614541 isoform X2 [Citrus 
sinensis]
 gb|ESR64022.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 gb|ESR64023.1| hypothetical protein CICLE_v10008613mg [Citrus clementina]
 gb|KDO79995.1| hypothetical protein CISIN_1g016651mg [Citrus sinensis]
 gb|KDO79996.1| hypothetical protein CISIN_1g016651mg [Citrus sinensis]
Length=385

 Score =   214 bits (544),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 126/180 (70%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S HSF+ S+DDP  YGRGRYN  M P + + +WRKGSQWFE+
Sbjct  207  ESCIPLYNFSLIYHYIKKSKHSFMGSFDDPGPYGRGRYNANMAPVVNITQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T +Y  F ++CRP CY DEHY PT L +    + ANRS T+VDWS GG 
Sbjct  267  NRRLAVNIVEDTTYYPKFAEFCRPPCYVDEHYFPTMLSIQMPNLLANRSSTWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F + +   G  C YN   + +C+LF RKF PSAL+PL  +S KV+GF
Sbjct  327  HPATFGRADITEEFFKKVYG-GQHCKYNNQPSTVCFLFGRKFAPSALQPLMNISSKVLGF  385



>ref|XP_002315929.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
 gb|EEF02100.2| hypothetical protein POPTR_0010s13160g [Populus trichocarpa]
Length=411

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIPV++F T+Y YL  S  SF+ S+DDP   GRGRYN RM+P + L +WRKGSQWFE 
Sbjct  231  ETCIPVFNFSTIYNYLMNSNQSFLGSFDDPRHMGRGRYNKRMRPTVTLSDWRKGSQWFEA  290

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +AI ++S+ K+Y +F+ +CRP CY DEHY PT +      +N+NRS+T+VDWS GG 
Sbjct  291  HRKVAIEMISDVKYYPVFRDHCRPPCYMDEHYFPTLVTKISPELNSNRSITWVDWSGGGS  350

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +   +++E F+  IR NG +C+YN G T +C+LFARKF PS L+ L +++ +++GF
Sbjct  351  HPARFVRKDVSEAFLNQIR-NGFNCTYNGGITTVCFLFARKFHPSTLDSLLRIAPELLGF  409



>gb|KDP40817.1| hypothetical protein JCGZ_24816 [Jatropha curcas]
Length=381

 Score =   213 bits (543),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 132/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+++F   Y+Y++ S HSF+ S+D+   YGRGRYN+ M+P++ L +WRKGSQWFE+
Sbjct  203  EACIPLHNFSIFYRYISRSRHSFMGSFDELGPYGRGRYNSNMQPEVTLEQWRKGSQWFEV  262

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI I+ +T +Y  F+ +C+P+CY DEHY PT L +   ++ ANR++T+ DWS GG 
Sbjct  263  NRRLAINIIEDTTYYPKFRDFCQPACYVDEHYFPTMLSIKLPHLLANRTLTWTDWSRGGA  322

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F + I   G SC+YN   T +CYLFARKF PSAL+PL  L+ KV GF
Sbjct  323  HPATFGKADITEEFFKRI-FEGQSCTYNNQPTTVCYLFARKFAPSALDPLLALASKVFGF  381



>gb|KHN20747.1| hypothetical protein glysoja_019064 [Glycine soja]
Length=315

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  ST +F+E+YD P   GRGRY+ +M+P I+L +WRKGSQWF++
Sbjct  136  ESCIPLFNFSTIYTYLMNSTKTFVEAYDLPGEVGRGRYSPQMRPQIRLSQWRKGSQWFQI  195

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R+LA+ IVS+ +++++FKKYC+PSCY DEHY+PT + +     N+NR++T+VDWS GGP
Sbjct  196  DRSLALQIVSDHQYFSVFKKYCKPSCYSDEHYLPTLVSIKFWKRNSNRTLTWVDWSRGGP  255

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP+ Y   ++T  F   +R  G SC YN   T IC+LFARKF P AL+ L + + K+M F
Sbjct  256  HPSRYFRTDVTIEFFNKLRF-GRSCEYNGRTTNICHLFARKFTPHALDRLLRFAPKIMQF  314



>ref|XP_010936142.1| PREDICTED: uncharacterized protein LOC105055840 [Elaeis guineensis]
Length=395

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+ +F   YK+L  S HSFI + DDP  YGRGRYN  M P++ + +WRKGSQWF +
Sbjct  216  ESCIPLSNFSIAYKHLMRSRHSFIGAMDDPGPYGRGRYNLNMAPEVNITQWRKGSQWFAV  275

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R  A+ IV +T +Y  F+ +C+P+CY DEHY PT L +   ++ ANRS+T+VDWS GG 
Sbjct  276  SRKSAVSIVKDTTYYPKFENFCKPNCYVDEHYFPTLLTIESPHLLANRSITWVDWSRGGA  335

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE FI+SI   G +C YN   T +C+LFARKF PSALEPL +++ K++GF
Sbjct  336  HPATFGGADITETFIRSIL-EGHTCLYNNQSTSLCHLFARKFAPSALEPLLQVAPKMLGF  394



>ref|XP_002466518.1| hypothetical protein SORBIDRAFT_01g009200 [Sorghum bicolor]
 gb|EER93516.1| hypothetical protein SORBIDRAFT_01g009200 [Sorghum bicolor]
Length=380

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 127/180 (71%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S+ SF+ + DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  201  ESCIPIFDFNTTYQYFLNSSQSFVMAIDDPGPYGRGRYNWNMTPEVELDQWRKGSQWFEV  260

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T +Y  FK++CRPSCY DEHYI T L +      ANRSVT+VDWS    
Sbjct  261  NRELAIEIVKDTVYYPKFKEFCRPSCYSDEHYIQTMLSIETPQSLANRSVTWVDWSRIAA  320

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +   +ITE F++ +R  G +C YN   + +C+LFARKF PSAL PL +L+  V+GF
Sbjct  321  HPARFGRGDITEEFLREVR-EGQTCLYNEQNSTLCFLFARKFAPSALGPLLELAPTVLGF  379



>ref|XP_002516477.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45818.1| conserved hypothetical protein [Ricinus communis]
Length=371

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 130/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S +SFI ++DD   YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  193  ESCIPLYNFSVIYHYIMKSRYSFIGAFDDHGPYGRGRYNENMAPEVNITQWRKGSQWFEI  252

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T FY  F+++C+P CY DEHY PT L +   ++ ANRS+T+VDWS GG 
Sbjct  253  NRRLAVNIVEDTTFYPKFEEFCKPHCYVDEHYFPTMLTIQAAHLLANRSITWVDWSRGGA  312

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F + I + G +C+YN   +  C+LFARKF PSALEPL  +S K +GF
Sbjct  313  HPATFGRGDITEDFFRRIHA-GQNCTYNNQPSSTCFLFARKFAPSALEPLLLVSSKFLGF  371



>ref|XP_002309520.1| hypothetical protein POPTR_0006s24970g [Populus trichocarpa]
 gb|EEE93043.1| hypothetical protein POPTR_0006s24970g [Populus trichocarpa]
Length=385

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+  S +SFI ++DD   YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  207  ESCIPLYNFSVIYDYMMRSKYSFIGAFDDHGPYGRGRYNENMAPEVNITQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ +V + ++Y  F+++C+PSCY DEHY PT L +    + ANR++T+VDWS GG 
Sbjct  267  NRKLAVNVVEDARYYPKFEEFCKPSCYVDEHYFPTMLTIEAAPLLANRTLTWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+IT+ F + IR + T C YN   + +C+LFARKF PSALEPL ++S  V+GF
Sbjct  327  HPATFGRADITKEFFKKIRED-THCVYNNQSSPVCFLFARKFAPSALEPLLQVSQNVLGF  385



>gb|ACF84653.1| unknown [Zea mays]
Length=302

 Score =   210 bits (535),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 125/180 (69%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIPV++F TVY YL  S HSF+E+Y    R  R RY+ RM PDI L EWRKGSQW E+
Sbjct  123  ESCIPVHNFTTVYDYLVGSRHSFVEAYYRDDRGCRSRYSRRMAPDITLREWRKGSQWLEL  182

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA  ++++T++Y +F+++C PSCYPDEHY+ TY+ L HG  N+NR+VT V+W  G  
Sbjct  183  SRDLAASVLADTRYYPLFRRHCTPSCYPDEHYVQTYVSLRHGARNSNRTVTRVEWPAGTS  242

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP +Y A + T   ++SIR++   C+YN   T  CYLFARKF P AL PL  +S  VM +
Sbjct  243  HPVTYGAGDATPELVRSIRTSAEPCAYNSRLTSTCYLFARKFSPDALAPLLNMSAAVMHY  302



>gb|AFO66521.1| putative clathrin binding protein [Brassica napus]
Length=829

 Score =   221 bits (563),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  651  ESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNDNMEPEVPITKWRKGSQWFEI  710

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +      ANRS+T+VDWS GGP
Sbjct  711  NRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGP  770

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  771  HPATFGRSDITEKFFEKIL-DGKNCVYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  829



>ref|XP_006353820.1| PREDICTED: uncharacterized protein LOC102581987 [Solanum tuberosum]
Length=325

 Score =   211 bits (536),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 88/180 (49%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            E+CIP+Y+F T+Y Y+  ST +F+ESYD+    GRGRYN++M P + + +WRKGSQWFE+
Sbjct  146  EACIPLYNFTTIYTYIMNSTKTFVESYDEWGPVGRGRYNSQMTPWVTIEQWRKGSQWFEL  205

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R +A+ ++++TKF+ +FK +CRP+CY DEHY+PT++ + + + N NR++T+VDW+ GGP
Sbjct  206  DREIALDMITDTKFFNLFKDFCRPACYSDEHYLPTFVTMRYWWKNGNRTLTWVDWTKGGP  265

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP  +    +T   +  +R+ G  C YN   T +CYLFARKF PSAL+ L K + KVM F
Sbjct  266  HPTKFARTEVTRELLHQMRT-GIQCMYNGEPTSMCYLFARKFLPSALDRLLKFAPKVMMF  324



>ref|XP_006369242.1| hypothetical protein POPTR_0001s20050g [Populus trichocarpa]
 gb|ERP65811.1| hypothetical protein POPTR_0001s20050g [Populus trichocarpa]
Length=383

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +Y+Y+++S +SF+  +DDP  YGRGRYN  M+P++ L +WRKGSQWFE+
Sbjct  205  ESCIPLHNFGIIYRYISKSRYSFMGVFDDPGPYGRGRYNWNMQPEVTLEQWRKGSQWFEV  264

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ ++ ++ +Y  FK +CRP CY DEHY PT L +   ++ ANRSVT+ DWS GG 
Sbjct  265  DRKLAVSVIEDSTYYPKFKDFCRPGCYVDEHYFPTMLSIQFPHLLANRSVTWTDWSRGGA  324

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++IT+ F + +   G SC YN     +C+LFARKF PSALEPL  LS KV+GF
Sbjct  325  HPATFGNSDITDEFFKRM-FEGQSCLYNNQPDNVCFLFARKFSPSALEPLLDLSPKVLGF  383



>ref|XP_002466520.1| hypothetical protein SORBIDRAFT_01g009220 [Sorghum bicolor]
 gb|EER93518.1| hypothetical protein SORBIDRAFT_01g009220 [Sorghum bicolor]
Length=386

 Score =   212 bits (540),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S  SF+ ++DD   YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  207  ESCIPIFDFNTTYRYFQNSNRSFLMAFDDHGPYGRGRYNWNMTPEVELDQWRKGSQWFEV  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  267  HRELAIEIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPNSLANRSVTWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +ITE F++ ++  G +C YN   + +C+LFARKF PSALEPL +L+  V+GF
Sbjct  327  HPATFGRGDITEEFLRRVQ-KGRTCLYNNQNSTMCFLFARKFAPSALEPLLELAPTVLGF  385



>ref|XP_007044265.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
 gb|EOY00097.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein isoform 1 [Theobroma cacao]
Length=399

 Score =   213 bits (541),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F TVY YL  S+ SF+ESYD     GRGRY+ RM P + L +WRKG+QWFEM
Sbjct  219  ESCIPIFNFSTVYSYLINSSQSFVESYDLEGPVGRGRYSRRMSPRVTLDQWRKGAQWFEM  278

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI +VS+ +++ +F+KYC+ +CY DEHY+PT++ +  G+ N+NR++T+VDWS GGP
Sbjct  279  DRELAIGVVSDQEYFPVFQKYCKGACYADEHYLPTFVTMKFGHKNSNRTLTWVDWSKGGP  338

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +    +T  F++ +RS G+ C YN   T IC+LFARKF P AL  L K + K+M F
Sbjct  339  HPAKFLRTEVTVEFLERLRS-GSQCQYNGNTTDICHLFARKFSPDALYRLLKFAPKLMHF  397



>ref|XP_009122883.1| PREDICTED: LOW QUALITY PROTEIN: clathrin interactor EPSIN 1 [Brassica 
rapa]
Length=982

 Score =   221 bits (564),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/180 (54%), Positives = 133/180 (74%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL+ S HSF+ ++DDP  +GRGRYN  M+P++ + +WRKGSQWFE+
Sbjct  804  ESCIPLFNFTTIYSYLSRSKHSFMGAFDDPGPFGRGRYNDNMEPEVPITKWRKGSQWFEI  863

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA  IV +T +Y  FK++CRP+CY DEHY PT L +      ANRS+T+VDWS GGP
Sbjct  864  NRELAATIVKDTLYYPKFKEFCRPACYVDEHYFPTMLTIEKPMALANRSLTWVDWSRGGP  923

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  ++ITE F + I  +G +C YN   T +CYLFARKF PSALE L  ++ K++G+
Sbjct  924  HPATFGRSDITEKFFEKIL-DGKNCVYNGRNTSMCYLFARKFAPSALESLLHIAPKILGY  982



>ref|XP_002447391.1| hypothetical protein SORBIDRAFT_06g034240 [Sorghum bicolor]
 gb|EES11719.1| hypothetical protein SORBIDRAFT_06g034240 [Sorghum bicolor]
Length=446

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 0/166 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESC+PV++F TVY+YL  S  S++ESY+       GRYN RM P++    WRKGS+WFEM
Sbjct  267  ESCVPVFNFRTVYEYLVNSAMSYVESYNIDVPQCAGRYNPRMAPEVLEEHWRKGSEWFEM  326

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ +V++ ++Y +F+++C PSCYPDEHYIPT+L L HG  NANR+VT+VDWS GGP
Sbjct  327  SRDLAVDVVADQRYYVLFRRHCTPSCYPDEHYIPTFLHLRHGAGNANRTVTWVDWSRGGP  386

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSA  161
            HPA +  A  T   + +IRSNGT C YN   T +CYLFARKF PSA
Sbjct  387  HPARFGKAATTSDLMAAIRSNGTLCLYNGKPTTVCYLFARKFAPSA  432



>ref|XP_007012231.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
 gb|EOY29850.1| Core-2/I-branching beta-1,6-N-acetylglucosaminyltransferase family 
protein [Theobroma cacao]
Length=392

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 131/180 (73%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  +Y Y+ +S +SFI ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  210  ESCIPLYNFSVIYHYIKKSKYSFIGAFDDPGPYGRGRYNENMAPEVNITQWRKGSQWFEI  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV ++ +Y  F+++CRP+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  270  NRRLALNIVEDSTYYPKFEQFCRPACYVDEHYFPTMLTIQASNLIANRSITWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE   + I  +   C YN   + +C+LFARKF PSALEPL +++ K++GF
Sbjct  330  HPATFGRADITEELFKRIFEDH-QCRYNDQPSLVCFLFARKFAPSALEPLLQIAPKILGF  388



>ref|XP_009625225.1| PREDICTED: uncharacterized protein LOC104116132 [Nicotiana tomentosiformis]
Length=382

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  VY+Y++ES HSFI  +DD    GRGRYN  M P++ + EWRKGSQWFE+
Sbjct  204  ESCIPLHNFSVVYRYISESRHSFISVFDDHGPVGRGRYNKNMSPEVIITEWRKGSQWFEV  263

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +  +Y  F+++C+PSCY DEHY PT L +   ++ ANRS+T VDWS GG 
Sbjct  264  NRKLAIDIVKDHVYYPKFEQFCKPSCYVDEHYFPTMLHIQSPHLLANRSLTLVDWSRGGA  323

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+IT+ F++ I   GT C YN   T +C LFARKF PS LEPL + S K +GF
Sbjct  324  HPATFGKADITDQFLKKIVEGGT-CVYNNQTTSLCSLFARKFSPSTLEPLLERSSKYLGF  382



>gb|KHN37013.1| hypothetical protein glysoja_009041 [Glycine soja]
Length=324

 Score =   210 bits (535),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 128/181 (71%), Gaps = 2/181 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VY Y+ +S HSF+ ++DDP  YGRGRYN  M P + + +WRKGSQWFE+
Sbjct  145  ESCIPLYNFSFVYHYIMKSKHSFVGAFDDPGPYGRGRYNEHMAPLVNVTKWRKGSQWFEV  204

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LAI IV +T F+ +F++YCRP+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  205  NRKLAITIVEDTTFHPIFEQYCRPACYVDEHYFPTMLTIQAANVLANRSITWVDWSRGGA  264

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEP-LEKLSLKVMG  122
            HPA++   +ITE F   +R  G +C YN   + +C LFARKF PSALEP L  +  KV+ 
Sbjct  265  HPATFGRNDITEEFFNRVR-RGHTCLYNNRNSSVCALFARKFAPSALEPLLHMVDSKVLD  323

Query  121  F  119
            F
Sbjct  324  F  324



>ref|XP_006357367.1| PREDICTED: uncharacterized protein LOC102582902 [Solanum tuberosum]
Length=380

 Score =   212 bits (539),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 91/180 (51%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F  +Y+Y++ES +SF+  +DDP   GRGRYN +M P +K+ +WRKGSQWFE+
Sbjct  201  ESCIPLHNFSVIYRYISESRYSFVSVFDDPRSVGRGRYNWKMSPVVKITQWRKGSQWFEV  260

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV++  +Y  FK++C+PSCY DEHY PT L +   ++  N S+T+VDW  GG 
Sbjct  261  NRKLAVDIVTDEVYYPKFKQFCKPSCYVDEHYFPTMLHIQSPHLLTNTSLTWVDWHRGGA  320

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A++T+ F++ +     +C YN   T  C LFARKF PSAL+PL KLS K +GF
Sbjct  321  HPATFGKADVTDKFLKQLSEGQRTCVYNNQTTSYCLLFARKFSPSALDPLLKLSSKYLGF  380



>ref|XP_009403975.1| PREDICTED: uncharacterized protein LOC103987406 [Musa acuminata 
subsp. malaccensis]
Length=398

 Score =   212 bits (540),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F TVY YL  ST  F+E YDDP   GRGRY + +KP I+  +WRKGSQWF +
Sbjct  217  ESCIPLFNFPTVYSYLINSTEVFVEVYDDPGPNGRGRYKSTLKPGIEFKQWRKGSQWFAV  276

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IVS+ K++ +F++YCRPSC  DEHY+PT + +   +  ANRS+T+ DWS GGP
Sbjct  277  DRGLAMEIVSDEKYFPLFQRYCRPSCLADEHYLPTLMNVRSFWGTANRSLTWADWSKGGP  336

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA      IT   +Q +R NG++CSYN   T+ICYLF RKF P++L  L +L+ K+M F
Sbjct  337  HPARIGRNEITAELLQRMR-NGSACSYNGRTTRICYLFGRKFLPNSLNRLVRLAPKLMDF  395



>tpg|DAA51164.1| TPA: hypothetical protein ZEAMMB73_778026 [Zea mays]
Length=389

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S  SF+ ++DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  210  ESCIPIFDFNTTYRYFRNSNQSFLMAFDDPGPYGRGRYNWNMTPEVELDQWRKGSQWFEV  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI IV +T +Y  FK++CRP CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  270  HRELAIEIVKDTVYYPKFKEFCRPHCYVDEHYFPTMLTIEAPNRLANRSVTWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +IT  F++ +R  G +C +N   + +C+LFARKF PS LEPL +L+  V+GF
Sbjct  330  HPATFGRGDITLEFLRRVR-EGRTCLHNNQNSTMCFLFARKFAPSTLEPLLELAPTVLGF  388



>emb|CBI15481.3| unnamed protein product [Vitis vinifera]
Length=365

 Score =   211 bits (537),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 128/180 (71%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F T+Y YL  S  SF+ESYD P   GRGRYN RMKP IK+ +WRKGSQWFEM
Sbjct  186  ESCIPLYNFSTIYSYLMGSKKSFVESYDLPGPVGRGRYNPRMKPLIKMEQWRKGSQWFEM  245

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI ++S+ K++ +F+K+C P CY DEHY+PT + +     N+NRS+T+VDWS GG 
Sbjct  246  DRGLAIQVISDRKYFPVFQKFCTPPCYADEHYLPTLVSVKFWRRNSNRSLTWVDWSHGGA  305

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA +    +T  F++ +R NG+ C YN   +  C++FARKF P+AL+ L +   K+M F
Sbjct  306  HPARFWRVAVTVDFLKKLR-NGSHCHYNGKSSNTCFMFARKFLPNALDRLLRFGPKLMKF  364



>ref|XP_010926004.1| PREDICTED: uncharacterized protein LOC105048408 [Elaeis guineensis]
Length=407

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 93/179 (52%), Positives = 132/179 (74%), Gaps = 1/179 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+++F T+Y YL  ST +++ SYDDP   GRGRY  +M+P ++L +WRKGSQWFE+
Sbjct  227  ESCIPLFNFPTIYSYLINSTKTYVSSYDDPGPNGRGRYRIKMRPYLELQQWRKGSQWFEV  286

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LAI I+S+ K++ +FKKYC+PSCY DEHY+ T++ +     NANRS+T+VDWS GGP
Sbjct  287  DRNLAIEIISDEKYFPVFKKYCKPSCYVDEHYLSTFVSISFWGRNANRSLTWVDWSKGGP  346

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMG  122
            HPA +   ++T   ++ +R NG++C YN   T IC+LFARKF P++L    + + KVMG
Sbjct  347  HPARFGRLDVTIELLERLR-NGSTCDYNGRTTNICFLFARKFLPNSLTRFLRFAPKVMG  404



>ref|XP_010062561.1| PREDICTED: uncharacterized protein LOC104449935 [Eucalyptus grandis]
 ref|XP_010062562.1| PREDICTED: uncharacterized protein LOC104449935 [Eucalyptus grandis]
 ref|XP_010062563.1| PREDICTED: uncharacterized protein LOC104449935 [Eucalyptus grandis]
 ref|XP_010062564.1| PREDICTED: uncharacterized protein LOC104449935 [Eucalyptus grandis]
 gb|KCW69701.1| hypothetical protein EUGRSUZ_F03095 [Eucalyptus grandis]
Length=389

 Score =   212 bits (539),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 93/180 (52%), Positives = 129/180 (72%), Gaps = 0/180 (0%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+ +F  +Y YL  S +SF+ S+D+   YGRGRYN  M P++ L +WRKG+QWFE+
Sbjct  210  ESCIPLQNFSVIYLYLLRSRYSFVGSFDEDGPYGRGRYNENMAPEVNLTQWRKGAQWFEV  269

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +T++Y  F+ +CRP+CY DEHY PT L +   ++ ANR++T+VDWS GG 
Sbjct  270  NRKLALDIVVDTRYYPKFRDFCRPACYVDEHYFPTMLAIQSPHLLANRTLTWVDWSRGGA  329

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F +   +  ++C YN   + +C+LFARKF PSALEPL  L+ KV GF
Sbjct  330  HPATFGKADITEEFFKKKINERSTCFYNNQPSSLCFLFARKFAPSALEPLLDLASKVFGF  389



>ref|XP_010267069.1| PREDICTED: uncharacterized protein LOC104604439 isoform X1 [Nelumbo 
nucifera]
Length=385

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 95/180 (53%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP+Y+F  VY ++  S +SF+ ++DDP  YGRGRYN  M P++ + +WRKGSQWFE+
Sbjct  207  ESCIPLYNFSIVYHHIASSRYSFMGAFDDPGPYGRGRYNQNMAPEVNITQWRKGSQWFEI  266

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            NR LA+ IV +  FY  F+++C+P+CY DEHY PT L +    + ANRS+T+VDWS GG 
Sbjct  267  NRRLAVNIVEDVTFYPKFEEFCKPACYVDEHYFPTMLTIQTPQLLANRSITWVDWSRGGA  326

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++  A+ITE F++ I   G SC YN   + +C+LFARKF PSALEPL  L+ K  G+
Sbjct  327  HPATFGNADITEDFLKRIL-EGNSCLYNNLPSSVCFLFARKFSPSALEPLLLLASKYFGY  385



>ref|XP_006344151.1| PREDICTED: uncharacterized protein LOC102582712 [Solanum tuberosum]
Length=305

 Score =   209 bits (532),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP ++F T+Y YLT S  SF+ S+DDP + GRGRYN RM P+I L +WRKGSQWFE+
Sbjct  126  ESCIPFFNFTTIYTYLTNSDQSFLGSFDDPRKIGRGRYNKRMYPNITLSDWRKGSQWFEV  185

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R LA+ IVS+  +Y +FK YC P CY DEHY+PT +      + +NRSVT+ DWS GG 
Sbjct  186  HRKLAVKIVSDVMYYPVFKNYCVPPCYMDEHYLPTLVNKVCPGLTSNRSVTWADWSAGGS  245

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HP ++   ++TE F++S+ S   +CSYN   + IC+LF RKF PS L+PL +++ K++GF
Sbjct  246  HPMTFLKKDVTEEFLKSVGSE-LNCSYNGKMSSICFLFGRKFHPSTLQPLLRIAPKLLGF  304



>dbj|BAK05476.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93216.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   211 bits (538),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/180 (52%), Positives = 129/180 (72%), Gaps = 1/180 (1%)
 Frame = -3

Query  658  ESCIPVYDFXTVYKYLTESTHSFIESYDDPTRYGRGRYNTRMKPDIKLHEWRKGSQWFEM  479
            ESCIP++DF T Y+Y   S+ SF+  +DDP  YGRGRYN  M P+++L +WRKGSQWFE+
Sbjct  212  ESCIPIFDFNTTYEYFQNSSQSFVMVFDDPGPYGRGRYNYNMTPEVELTQWRKGSQWFEV  271

Query  478  NRALAIIIVSETKFYAMFKKYCRPSCYPDEHYIPTYLQLHHGYMNANRSVTYVDWSLGGP  299
            +R L I I+ +T++Y  FK++CRP CY DEHY PT L +      ANRSVT+VDWS GG 
Sbjct  272  DRDLGIEIIRDTRYYPKFKEFCRPHCYVDEHYFPTMLTIEAPQSLANRSVTWVDWSRGGA  331

Query  298  HPASYTAANITEGFIQSIRSNGTSCSYNRGKTQICYLFARKFFPSALEPLEKLSLKVMGF  119
            HPA++   +I+E F++ +++ G +C YN   T  C+LFARKF PSAL+PL  L+  V+G+
Sbjct  332  HPATFGRGDISEEFLRRVQT-GRTCLYNNQNTTTCFLFARKFAPSALQPLLVLAPTVLGY  390



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1023687230320