BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036O12

Length=710
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004297483.1|  PREDICTED: probable nucleoredoxin 1                232   2e-68   Fragaria vesca subsp. vesca
ref|XP_010651766.1|  PREDICTED: probable nucleoredoxin 1                217   1e-66   
gb|KHG25736.1|  hypothetical protein F383_04337                         225   6e-66   Gossypium arboreum [tree cotton]
gb|KJB31218.1|  hypothetical protein B456_005G181700                    225   7e-66   Gossypium raimondii
ref|XP_002525369.1|  nucleoredoxin, putative                            224   1e-65   
ref|XP_008340047.1|  PREDICTED: probable nucleoredoxin 1                223   4e-65   Malus domestica [apple tree]
ref|XP_008221829.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     221   4e-65   Prunus mume [ume]
ref|XP_007222806.1|  hypothetical protein PRUPE_ppa005061mg             221   4e-65   
ref|XP_008221828.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     221   2e-64   Prunus mume [ume]
gb|KCW59852.1|  hypothetical protein EUGRSUZ_H025922                    215   4e-64   Eucalyptus grandis [rose gum]
ref|XP_007044667.1|  DC1 domain-containing protein                      220   5e-64   
ref|XP_008221827.1|  PREDICTED: probable nucleoredoxin 1                220   7e-64   Prunus mume [ume]
emb|CAN77321.1|  hypothetical protein VITISV_008818                     219   8e-64   Vitis vinifera
ref|XP_008221826.1|  PREDICTED: probable nucleoredoxin 1                219   9e-64   
ref|XP_010651402.1|  PREDICTED: probable nucleoredoxin 1                219   2e-63   Vitis vinifera
ref|XP_007225633.1|  hypothetical protein PRUPE_ppa003374mg             218   2e-63   Prunus persica
ref|XP_004297482.1|  PREDICTED: probable nucleoredoxin 1                217   5e-63   Fragaria vesca subsp. vesca
ref|XP_010553606.1|  PREDICTED: probable nucleoredoxin 1                216   2e-62   Tarenaya hassleriana [spider flower]
gb|KCW59854.1|  hypothetical protein EUGRSUZ_H02593                     214   7e-62   Eucalyptus grandis [rose gum]
ref|XP_010023556.1|  PREDICTED: probable nucleoredoxin 1                214   1e-61   Eucalyptus grandis [rose gum]
ref|XP_009391725.1|  PREDICTED: probable nucleoredoxin 1                212   7e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010243057.1|  PREDICTED: probable nucleoredoxin 1                211   2e-60   Nelumbo nucifera [Indian lotus]
emb|CAN59927.1|  hypothetical protein VITISV_043885                     210   3e-60   Vitis vinifera
ref|XP_010651408.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     209   6e-60   Vitis vinifera
ref|XP_010651414.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     209   6e-60   
gb|KDP26595.1|  hypothetical protein JCGZ_17753                         207   3e-59   Jatropha curcas
ref|XP_008792848.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    208   3e-59   Phoenix dactylifera
emb|CAN63033.1|  hypothetical protein VITISV_044051                     207   4e-59   Vitis vinifera
gb|KHN26883.1|  Putative nucleoredoxin 1                                206   7e-59   Glycine soja [wild soybean]
ref|XP_010937316.1|  PREDICTED: probable nucleoredoxin 1-1              207   8e-59   Elaeis guineensis
ref|XP_006365240.1|  PREDICTED: probable nucleoredoxin 1-like           207   9e-59   Solanum tuberosum [potatoes]
ref|XP_003631262.2|  PREDICTED: uncharacterized protein LOC100852797    211   1e-58   
ref|XP_003532006.1|  PREDICTED: probable nucleoredoxin 1-like iso...    205   2e-58   Glycine max [soybeans]
emb|CDY24527.1|  BnaA01g22310D                                          204   6e-58   Brassica napus [oilseed rape]
ref|XP_010917444.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    204   6e-58   
ref|XP_009103743.1|  PREDICTED: probable nucleoredoxin 1                204   6e-58   Brassica rapa
ref|XP_006392168.1|  hypothetical protein EUTSA_v10023374mg             204   7e-58   Eutrema salsugineum [saltwater cress]
emb|CCD74518.1|  putative nucleoredoxin 1                               204   9e-58   Arabidopsis halleri subsp. halleri
ref|XP_008389658.1|  PREDICTED: probable nucleoredoxin 1                203   1e-57   Malus domestica [apple tree]
ref|NP_564756.1|  protein reduce transmission through pollen            203   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AGV54528.1|  nucleoredoxin 1-like protein                            203   1e-57   Phaseolus vulgaris [French bean]
emb|CDY60573.1|  BnaC01g43180D                                          203   1e-57   Brassica napus [oilseed rape]
ref|XP_002314533.2|  hypothetical protein POPTR_0010s06960g             202   4e-57   Populus trichocarpa [western balsam poplar]
ref|XP_004156196.1|  PREDICTED: probable nucleoredoxin 1-like           201   4e-57   
ref|XP_010417977.1|  PREDICTED: probable nucleoredoxin 1                202   4e-57   Camelina sativa [gold-of-pleasure]
ref|XP_004141532.1|  PREDICTED: probable nucleoredoxin 1-like           201   5e-57   
ref|XP_010473222.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     201   5e-57   Camelina sativa [gold-of-pleasure]
ref|XP_002888143.1|  DC1 domain-containing protein                      201   5e-57   Arabidopsis lyrata subsp. lyrata
ref|XP_010510950.1|  PREDICTED: probable nucleoredoxin 1                201   6e-57   Camelina sativa [gold-of-pleasure]
gb|AAM64945.1|  PDI-like protein                                        201   7e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KFK40790.1|  hypothetical protein AALP_AA2G041400                    201   7e-57   Arabis alpina [alpine rockcress]
ref|XP_010023548.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     201   8e-57   Eucalyptus grandis [rose gum]
ref|XP_007153741.1|  hypothetical protein PHAVU_003G061100g             201   8e-57   Phaseolus vulgaris [French bean]
ref|XP_002314534.2|  hypothetical protein POPTR_0010s07000g             201   8e-57   Populus trichocarpa [western balsam poplar]
ref|XP_010682546.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     200   1e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011041579.1|  PREDICTED: probable nucleoredoxin 1                193   1e-56   Populus euphratica
ref|XP_006302027.1|  hypothetical protein CARUB_v10020010mg             201   1e-56   
ref|XP_004509957.1|  PREDICTED: probable nucleoredoxin 1-like           199   2e-56   
ref|XP_008459530.1|  PREDICTED: probable nucleoredoxin 1                199   2e-56   Cucumis melo [Oriental melon]
ref|XP_010682545.1|  PREDICTED: probable nucleoredoxin 1                199   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011041505.1|  PREDICTED: probable nucleoredoxin 1                198   7e-56   Populus euphratica
ref|XP_004141529.1|  PREDICTED: probable nucleoredoxin 1-like           198   9e-56   Cucumis sativus [cucumbers]
ref|XP_008782777.1|  PREDICTED: probable nucleoredoxin 1-1              198   1e-55   Phoenix dactylifera
ref|XP_006378295.1|  hypothetical protein POPTR_0010s07010g             196   1e-55   
ref|XP_006378294.1|  hypothetical protein POPTR_0010s06990g             196   3e-55   
ref|XP_006378293.1|  disulfide isomerase family protein                 196   3e-55   
ref|XP_002314537.2|  hypothetical protein POPTR_0010s06940g             196   5e-55   
ref|XP_006378292.1|  hypothetical protein POPTR_0010s06950g             196   6e-55   
gb|AAU04766.1|  protein disulfide isomerase (PDI)-like protein 2        196   7e-55   Cucumis melo [Oriental melon]
ref|XP_008459528.1|  PREDICTED: probable nucleoredoxin 1                195   8e-55   Cucumis melo [Oriental melon]
ref|XP_006378291.1|  hypothetical protein POPTR_0010s06930g             195   1e-54   
emb|CDP00158.1|  unnamed protein product                                194   2e-54   Coffea canephora [robusta coffee]
ref|XP_011041502.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     194   2e-54   Populus euphratica
gb|EPS71977.1|  hypothetical protein M569_02774                         194   3e-54   Genlisea aurea
ref|XP_002314535.2|  hypothetical protein POPTR_0010s06980g             193   5e-54   
ref|XP_002525368.1|  nucleoredoxin, putative                            191   2e-53   
ref|XP_004238662.1|  PREDICTED: probable nucleoredoxin 1                192   2e-53   Solanum lycopersicum
ref|XP_008353015.1|  PREDICTED: probable nucleoredoxin 1                187   3e-53   Malus domestica [apple tree]
ref|XP_006836611.1|  hypothetical protein AMTR_s00131p00113720          192   3e-53   
ref|XP_011041503.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     190   8e-53   Populus euphratica
ref|XP_011014069.1|  PREDICTED: probable nucleoredoxin 1 isoform X4     189   1e-52   Populus euphratica
ref|XP_011071086.1|  PREDICTED: probable nucleoredoxin 1                190   1e-52   Sesamum indicum [beniseed]
tpg|DAA45727.1|  TPA: PDI-like protein                                  189   1e-52   
ref|NP_001105407.1|  nucleoredoxin1                                     189   1e-52   
ref|XP_011014068.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     189   2e-52   Populus euphratica
ref|XP_011014066.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     189   3e-52   Populus euphratica
ref|XP_011014067.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     189   3e-52   Populus euphratica
ref|XP_008340046.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     189   3e-52   
gb|ACF82903.1|  unknown                                                 188   6e-52   Zea mays [maize]
emb|CBI28536.3|  unnamed protein product                                186   1e-51   Vitis vinifera
gb|KEH20025.1|  protein disulfide isomerase (PDI)-like protein          186   2e-51   Medicago truncatula
gb|ACJ85567.1|  unknown                                                 186   3e-51   Medicago truncatula
emb|CBI28543.3|  unnamed protein product                                185   5e-51   Vitis vinifera
gb|KDO82403.1|  hypothetical protein CISIN_1g008336mg                   183   6e-51   Citrus sinensis [apfelsine]
ref|XP_006438372.1|  hypothetical protein CICLE_v10031097mg             182   2e-50   
ref|XP_007222607.1|  hypothetical protein PRUPE_ppa003530mg             184   2e-50   Prunus persica
ref|XP_006483868.1|  PREDICTED: probable nucleoredoxin 1-like           183   2e-50   Citrus sinensis [apfelsine]
gb|KDO82402.1|  hypothetical protein CISIN_1g008336mg                   183   2e-50   Citrus sinensis [apfelsine]
gb|KDO82401.1|  hypothetical protein CISIN_1g008336mg                   183   2e-50   Citrus sinensis [apfelsine]
ref|XP_006438373.1|  hypothetical protein CICLE_v10031097mg             182   7e-50   Citrus clementina [clementine]
ref|XP_010937371.1|  PREDICTED: probable nucleoredoxin 1-1              181   1e-49   Elaeis guineensis
ref|XP_008353016.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    181   2e-49   
ref|XP_002467709.1|  hypothetical protein SORBIDRAFT_01g032910          181   3e-49   Sorghum bicolor [broomcorn]
ref|XP_003562828.1|  PREDICTED: probable nucleoredoxin 1-2              179   1e-48   Brachypodium distachyon [annual false brome]
ref|XP_003557743.1|  PREDICTED: probable nucleoredoxin 1-2              179   1e-48   Brachypodium distachyon [annual false brome]
dbj|BAJ87919.1|  predicted protein                                      178   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP26596.1|  hypothetical protein JCGZ_17754                         178   2e-48   Jatropha curcas
gb|EMT12941.1|  Nucleoredoxin                                           176   1e-47   
ref|XP_008389657.1|  PREDICTED: probable nucleoredoxin 1                176   1e-47   Malus domestica [apple tree]
gb|AHL29285.1|  nucleoredoxin                                           176   2e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008340045.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     175   4e-47   
gb|EAY90397.1|  hypothetical protein OsI_11974                          174   6e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001050329.1|  Os03g0405500                                       174   6e-47   
gb|EYU22493.1|  hypothetical protein MIMGU_mgv1a003730mg                173   2e-46   Erythranthe guttata [common monkey flower]
ref|NP_001050331.2|  Os03g0405900                                       169   4e-46   
gb|EEC75442.1|  hypothetical protein OsI_11975                          171   1e-45   Oryza sativa Indica Group [Indian rice]
sp|Q7Y0F2.1|NRX12_ORYSJ  RecName: Full=Probable nucleoredoxin 1-2...    171   1e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010100450.1|  putative nucleoredoxin 1                           167   2e-44   Morus notabilis
gb|AAU89249.1|  C1-like domain containing protein                       164   8e-43   Oryza sativa Japonica Group [Japonica rice]
gb|ABR18079.1|  unknown                                                 161   2e-42   Picea sitchensis
gb|ABK25413.1|  unknown                                                 161   3e-42   Picea sitchensis
ref|XP_006292691.1|  hypothetical protein CARUB_v10018937mg             160   4e-42   
ref|XP_007222066.1|  hypothetical protein PRUPE_ppa003234mg             159   2e-41   
ref|XP_009626672.1|  PREDICTED: probable nucleoredoxin 1                158   2e-41   Nicotiana tomentosiformis
ref|XP_009762379.1|  PREDICTED: probable nucleoredoxin 1                158   3e-41   Nicotiana sylvestris
ref|XP_004239348.2|  PREDICTED: probable nucleoredoxin 1                157   5e-41   
ref|XP_004984067.1|  PREDICTED: probable nucleoredoxin 1-1-like         157   6e-41   Setaria italica
ref|XP_006452948.1|  hypothetical protein CICLE_v10010235mg             155   7e-41   
ref|XP_008221830.1|  PREDICTED: probable nucleoredoxin 1                156   2e-40   
ref|XP_006474525.1|  PREDICTED: probable nucleoredoxin 1-like           154   3e-40   
ref|XP_002467708.1|  hypothetical protein SORBIDRAFT_01g032890          155   3e-40   
ref|XP_006365237.1|  PREDICTED: probable nucleoredoxin 1-like           154   8e-40   Solanum tuberosum [potatoes]
ref|XP_008448920.1|  PREDICTED: probable nucleoredoxin 1                153   2e-39   Cucumis melo [Oriental melon]
gb|ABR16144.1|  unknown                                                 153   3e-39   Picea sitchensis
ref|XP_004986914.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    151   1e-38   
ref|XP_004147954.1|  PREDICTED: probable nucleoredoxin 1-like           149   7e-38   Cucumis sativus [cucumbers]
ref|XP_006836608.1|  hypothetical protein AMTR_s00131p00112160          147   2e-37   
emb|CBI28541.3|  unnamed protein product                                144   1e-36   Vitis vinifera
ref|NP_001130856.1|  hypothetical protein                               144   3e-36   Zea mays [maize]
ref|XP_010023551.1|  PREDICTED: probable nucleoredoxin 1 isoform X4     140   8e-35   
ref|XP_010023554.1|  PREDICTED: probable nucleoredoxin 1 isoform X6     139   8e-35   Eucalyptus grandis [rose gum]
ref|XP_010023552.1|  PREDICTED: probable nucleoredoxin 1 isoform X5     139   8e-35   
emb|CBI28535.3|  unnamed protein product                                139   2e-34   Vitis vinifera
gb|ABK25089.1|  unknown                                                 134   2e-33   Picea sitchensis
ref|XP_002968070.1|  hypothetical protein SELMODRAFT_440252             136   3e-33   Selaginella moellendorffii
ref|XP_002965590.1|  hypothetical protein SELMODRAFT_143457             135   3e-33   
ref|XP_010243058.1|  PREDICTED: probable nucleoredoxin 1                135   5e-33   Nelumbo nucifera [Indian lotus]
emb|CDP13168.1|  unnamed protein product                                133   1e-32   Coffea canephora [robusta coffee]
ref|XP_010913793.1|  PREDICTED: probable nucleoredoxin 3                132   2e-32   Elaeis guineensis
ref|XP_010023550.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     133   2e-32   
ref|XP_010023549.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     133   2e-32   Eucalyptus grandis [rose gum]
gb|AAS02080.1|  protein disulfide isomerase                             132   4e-32   Quercus suber [cork oak]
emb|CAC87937.1|  PDI-like protein                                       132   4e-32   Quercus suber [cork oak]
ref|XP_009405027.1|  PREDICTED: probable nucleoredoxin 1-1              134   5e-32   
ref|XP_010682544.1|  PREDICTED: probable nucleoredoxin 1                130   2e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010937315.1|  PREDICTED: probable nucleoredoxin 1-2              129   3e-31   
ref|XP_009626674.1|  PREDICTED: probable nucleoredoxin 1                129   5e-31   Nicotiana tomentosiformis
ref|XP_009762378.1|  PREDICTED: probable nucleoredoxin 1                129   6e-31   Nicotiana sylvestris
ref|XP_010937313.1|  PREDICTED: probable nucleoredoxin 1-2              128   8e-31   
ref|XP_011014070.1|  PREDICTED: probable nucleoredoxin 1                128   1e-30   Populus euphratica
ref|XP_010091604.1|  putative nucleoredoxin 1-1                         127   2e-30   
ref|XP_010648454.1|  PREDICTED: probable nucleoredoxin 3                125   5e-30   Vitis vinifera
ref|XP_002306954.1|  hypothetical protein POPTR_0005s26610g             124   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_011003080.1|  PREDICTED: probable nucleoredoxin 2                124   2e-29   Populus euphratica
gb|KDP33411.1|  hypothetical protein JCGZ_06982                         123   4e-29   Jatropha curcas
ref|XP_010263377.1|  PREDICTED: probable nucleoredoxin 3                122   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_006855862.1|  hypothetical protein AMTR_s00037p00109800          122   5e-29   Amborella trichopoda
ref|XP_008781716.1|  PREDICTED: probable nucleoredoxin 3                122   6e-29   Phoenix dactylifera
emb|CBI20806.3|  unnamed protein product                                125   1e-28   Vitis vinifera
ref|XP_002314536.2|  hypothetical protein POPTR_0010s06970g             122   1e-28   
ref|XP_011041504.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     122   1e-28   Populus euphratica
gb|KEH20030.1|  protein disulfide isomerase (PDI)-like protein          121   2e-28   Medicago truncatula
ref|NP_001053815.2|  Os04g0608600                                       117   2e-28   
ref|XP_006382207.1|  hypothetical protein POPTR_0006s29370g             120   3e-28   Populus trichocarpa [western balsam poplar]
ref|XP_011006661.1|  PREDICTED: probable nucleoredoxin 3                120   3e-28   Populus euphratica
ref|XP_010438062.1|  PREDICTED: probable nucleoredoxin 3                120   3e-28   
ref|XP_002448495.1|  hypothetical protein SORBIDRAFT_06g027950          120   3e-28   Sorghum bicolor [broomcorn]
ref|XP_003522672.1|  PREDICTED: probable nucleoredoxin 3-like           120   4e-28   Glycine max [soybeans]
ref|XP_003526462.1|  PREDICTED: probable nucleoredoxin 3-like iso...    119   5e-28   Glycine max [soybeans]
ref|XP_007017891.1|  DC1 domain-containing protein isoform 2            119   6e-28   
ref|XP_004976749.1|  PREDICTED: probable nucleoredoxin 3-like           119   6e-28   Setaria italica
ref|XP_006435249.1|  hypothetical protein CICLE_v10001187mg             118   6e-28   
gb|KDO67158.1|  hypothetical protein CISIN_1g016384mg                   118   7e-28   Citrus sinensis [apfelsine]
ref|XP_007017892.1|  DC1 domain-containing protein isoform 3            119   7e-28   Theobroma cacao [chocolate]
ref|XP_007017890.1|  DC1 domain-containing protein isoform 1            119   8e-28   
ref|XP_002510593.1|  nucleoredoxin, putative                            119   8e-28   Ricinus communis
gb|KHG03676.1|  hypothetical protein F383_28340                         119   9e-28   Gossypium arboreum [tree cotton]
ref|XP_010266892.1|  PREDICTED: probable nucleoredoxin 2                119   9e-28   Nelumbo nucifera [Indian lotus]
ref|XP_008377128.1|  PREDICTED: probable nucleoredoxin 2                119   1e-27   Malus domestica [apple tree]
ref|XP_010669505.1|  PREDICTED: probable nucleoredoxin 3                119   1e-27   Beta vulgaris subsp. vulgaris [field beet]
gb|AAV50008.1|  protein disulfide isomerase                             114   1e-27   Malus domestica [apple tree]
ref|XP_010447596.1|  PREDICTED: probable nucleoredoxin 3                118   1e-27   
ref|XP_006435250.1|  hypothetical protein CICLE_v10001187mg             119   2e-27   Citrus clementina [clementine]
gb|KDO84955.1|  hypothetical protein CISIN_1g013684mg                   118   2e-27   Citrus sinensis [apfelsine]
gb|KDO67150.1|  hypothetical protein CISIN_1g016384mg                   118   2e-27   Citrus sinensis [apfelsine]
ref|XP_006435252.1|  hypothetical protein CICLE_v10001187mg             118   2e-27   Citrus clementina [clementine]
gb|KDO67148.1|  hypothetical protein CISIN_1g016384mg                   118   2e-27   Citrus sinensis [apfelsine]
emb|CAA16527.1|  predicted protein                                      115   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006483643.1|  PREDICTED: probable nucleoredoxin 3-like iso...    117   2e-27   Citrus sinensis [apfelsine]
gb|KDO67152.1|  hypothetical protein CISIN_1g016384mg                   117   2e-27   Citrus sinensis [apfelsine]
gb|KHN18231.1|  Putative nucleoredoxin 3                                120   3e-27   Glycine soja [wild soybean]
ref|XP_007011460.1|  Kinase C-like zinc finger protein                  117   3e-27   
ref|XP_004291281.1|  PREDICTED: probable nucleoredoxin 3                117   3e-27   Fragaria vesca subsp. vesca
ref|XP_009620045.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     117   4e-27   Nicotiana tomentosiformis
ref|XP_007137135.1|  hypothetical protein PHAVU_009G102600g             117   4e-27   Phaseolus vulgaris [French bean]
ref|XP_007221797.1|  hypothetical protein PRUPE_ppa006064mg             117   4e-27   Prunus persica
gb|KDP36878.1|  hypothetical protein JCGZ_08169                         117   6e-27   Jatropha curcas
ref|XP_008221212.1|  PREDICTED: probable nucleoredoxin 2                117   6e-27   Prunus mume [ume]
ref|XP_004136369.1|  PREDICTED: probable nucleoredoxin 2-like           117   6e-27   Cucumis sativus [cucumbers]
ref|XP_004167003.1|  PREDICTED: probable nucleoredoxin 2-like           117   6e-27   
ref|XP_009417224.1|  PREDICTED: probable nucleoredoxin 2 isoform X3     115   7e-27   
gb|EYU22494.1|  hypothetical protein MIMGU_mgv1a005241mg                117   7e-27   Erythranthe guttata [common monkey flower]
gb|KJB18918.1|  hypothetical protein B456_003G074700                    116   7e-27   Gossypium raimondii
gb|AFW59396.1|  hypothetical protein ZEAMMB73_974140                    116   8e-27   
ref|XP_009417223.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008663577.1|  PREDICTED: probable nucleoredoxin 3                116   1e-26   
ref|XP_010256393.1|  PREDICTED: uncharacterized protein LOC104596799    119   1e-26   Nelumbo nucifera [Indian lotus]
ref|XP_009798867.1|  PREDICTED: probable nucleoredoxin 2                116   1e-26   Nicotiana sylvestris
ref|XP_009417222.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006386162.1|  hypothetical protein POPTR_0002s01870g             115   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_009334668.1|  PREDICTED: probable nucleoredoxin 2                115   2e-26   Pyrus x bretschneideri [bai li]
ref|XP_008806406.1|  PREDICTED: probable nucleoredoxin 2                115   2e-26   Phoenix dactylifera
ref|XP_002867308.1|  predicted protein                                  114   3e-26   Arabidopsis lyrata subsp. lyrata
ref|XP_011083440.1|  PREDICTED: probable nucleoredoxin 2                115   3e-26   Sesamum indicum [beniseed]
ref|XP_008357428.1|  PREDICTED: probable nucleoredoxin 3                114   3e-26   
ref|XP_002285895.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     114   3e-26   Vitis vinifera
ref|XP_010664141.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     114   4e-26   Vitis vinifera
ref|XP_008350516.1|  PREDICTED: probable nucleoredoxin 2                114   4e-26   
ref|NP_567869.1|  putative nucleoredoxin 3                              114   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010525856.1|  PREDICTED: probable nucleoredoxin 3 isoform X3     114   4e-26   Tarenaya hassleriana [spider flower]
ref|XP_008466458.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     114   5e-26   Cucumis melo [Oriental melon]
ref|XP_010525854.1|  PREDICTED: probable nucleoredoxin 3 isoform X1     114   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_008387909.1|  PREDICTED: probable nucleoredoxin 2                114   5e-26   Malus domestica [apple tree]
ref|XP_010525855.1|  PREDICTED: probable nucleoredoxin 3 isoform X2     114   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_010692758.1|  PREDICTED: probable nucleoredoxin 2                114   5e-26   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009127152.1|  PREDICTED: probable nucleoredoxin 3                114   5e-26   Brassica rapa
ref|XP_003527520.1|  PREDICTED: probable nucleoredoxin 2-like iso...    114   5e-26   Glycine max [soybeans]
gb|KHN45956.1|  Putative nucleoredoxin 2                                114   6e-26   Glycine soja [wild soybean]
ref|NP_001276271.1|  probable nucleoredoxin 2-like                      114   6e-26   
gb|KHN09060.1|  Putative nucleoredoxin 2                                114   6e-26   Glycine soja [wild soybean]
ref|XP_006342078.1|  PREDICTED: probable nucleoredoxin 2-like           114   6e-26   Solanum tuberosum [potatoes]
ref|XP_003527521.1|  PREDICTED: probable nucleoredoxin 2-like iso...    114   7e-26   Glycine max [soybeans]
ref|XP_006577959.1|  PREDICTED: probable nucleoredoxin 2-like iso...    114   7e-26   
emb|CDX68729.1|  BnaC01g07240D                                          114   7e-26   
ref|XP_010061105.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     113   9e-26   Eucalyptus grandis [rose gum]
ref|XP_010112126.1|  putative nucleoredoxin 3                           115   9e-26   
gb|KCW68002.1|  hypothetical protein EUGRSUZ_F01693                     113   2e-25   Eucalyptus grandis [rose gum]
ref|XP_004238384.1|  PREDICTED: probable nucleoredoxin 2                113   2e-25   Solanum lycopersicum
ref|XP_011034968.1|  PREDICTED: probable nucleoredoxin 2                113   2e-25   Populus euphratica
ref|XP_010923905.1|  PREDICTED: probable nucleoredoxin 2                112   2e-25   Elaeis guineensis
gb|EEC77960.1|  hypothetical protein OsI_17320                          112   2e-25   Oryza sativa Indica Group [Indian rice]
ref|XP_003603818.1|  Nucleoredoxin                                      112   4e-25   Medicago truncatula
ref|XP_004138773.1|  PREDICTED: probable nucleoredoxin 3-like           111   4e-25   Cucumis sativus [cucumbers]
ref|XP_004160840.1|  PREDICTED: probable nucleoredoxin 3-like           111   4e-25   
ref|XP_010061104.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     112   4e-25   Eucalyptus grandis [rose gum]
ref|XP_003603563.1|  Nucleoredoxin                                      111   5e-25   Medicago truncatula
ref|XP_006450083.1|  hypothetical protein CICLE_v10010213mg             114   5e-25   
ref|XP_006652793.1|  PREDICTED: probable nucleoredoxin 3-like           111   5e-25   
ref|XP_004500916.1|  PREDICTED: probable nucleoredoxin 2-like iso...    111   7e-25   
ref|XP_008219971.1|  PREDICTED: probable nucleoredoxin 3 isoform X2     110   8e-25   Prunus mume [ume]
ref|XP_008219969.1|  PREDICTED: probable nucleoredoxin 3 isoform X1     110   9e-25   Prunus mume [ume]
ref|XP_007136118.1|  hypothetical protein PHAVU_009G019400g             110   1e-24   Phaseolus vulgaris [French bean]
ref|XP_010432885.1|  PREDICTED: probable nucleoredoxin 3                110   1e-24   Camelina sativa [gold-of-pleasure]
ref|XP_008445069.1|  PREDICTED: probable nucleoredoxin 3                110   2e-24   Cucumis melo [Oriental melon]
ref|XP_009353319.1|  PREDICTED: probable nucleoredoxin 3                109   2e-24   Pyrus x bretschneideri [bai li]
ref|XP_010049785.1|  PREDICTED: probable nucleoredoxin 3                109   2e-24   Eucalyptus grandis [rose gum]
gb|KHG29175.1|  hypothetical protein F383_13074                         109   2e-24   Gossypium arboreum [tree cotton]
gb|KJB58048.1|  hypothetical protein B456_009G191800                    109   2e-24   Gossypium raimondii
gb|KJB58049.1|  hypothetical protein B456_009G191800                    109   2e-24   Gossypium raimondii
ref|XP_006285266.1|  hypothetical protein CARUB_v10006638mg             112   3e-24   
ref|XP_006412615.1|  hypothetical protein EUTSA_v10026931mg             112   3e-24   
gb|KJB58046.1|  hypothetical protein B456_009G191800                    109   3e-24   Gossypium raimondii
gb|KJB58047.1|  hypothetical protein B456_009G191800                    109   4e-24   Gossypium raimondii
ref|XP_004501221.1|  PREDICTED: probable nucleoredoxin 3-like iso...    108   4e-24   Cicer arietinum [garbanzo]
ref|XP_004291331.1|  PREDICTED: probable nucleoredoxin 2                108   4e-24   Fragaria vesca subsp. vesca
gb|KJB31217.1|  hypothetical protein B456_005G181700                    109   5e-24   Gossypium raimondii
ref|XP_007223217.1|  hypothetical protein PRUPE_ppa007157mg             107   1e-23   Prunus persica
gb|KJB14359.1|  hypothetical protein B456_002G121200                    107   1e-23   Gossypium raimondii
gb|KJB14358.1|  hypothetical protein B456_002G121200                    107   1e-23   Gossypium raimondii
gb|KJB14361.1|  hypothetical protein B456_002G121200                    107   2e-23   
ref|XP_010266051.1|  PREDICTED: probable nucleoredoxin 2                107   2e-23   
emb|CDP07350.1|  unnamed protein product                                106   3e-23   
gb|KCW45107.1|  hypothetical protein EUGRSUZ_L01281                     105   6e-23   
ref|XP_010100128.1|  hypothetical protein L484_014319                   101   2e-21   
ref|XP_006646403.1|  PREDICTED: probable nucleoredoxin 2-like           100   2e-21   
gb|AFK35779.1|  unknown                                               95.1    9e-21   
gb|EEC71628.1|  hypothetical protein OsI_04055                        98.2    2e-20   
ref|NP_001044503.1|  Os01g0794400                                     98.2    2e-20   
gb|AFK36928.1|  unknown                                               95.1    1e-19   
gb|KCW63369.1|  hypothetical protein EUGRSUZ_G01004                   95.5    1e-19   
ref|XP_004970236.1|  PREDICTED: probable nucleoredoxin 2-like         95.1    2e-19   
gb|ABK25230.1|  unknown                                               93.2    1e-18   
ref|XP_008654314.1|  PREDICTED: protein disulfide isomerase isofo...  92.4    2e-18   
ref|XP_008654315.1|  PREDICTED: protein disulfide isomerase isofo...  92.4    2e-18   
ref|XP_008654313.1|  PREDICTED: protein disulfide isomerase isofo...  92.4    2e-18   
ref|NP_001131397.1|  protein disulfide isomerase                      92.4    2e-18   
ref|NP_001169000.1|  uncharacterized protein LOC100382831             92.0    3e-18   
gb|KCW59853.1|  hypothetical protein EUGRSUZ_H025921                  89.7    3e-18   
ref|XP_003564391.1|  PREDICTED: probable nucleoredoxin 2              91.7    4e-18   
ref|XP_010651773.1|  PREDICTED: probable nucleoredoxin 1              90.1    5e-18   
gb|AGT16827.1|  disulfide isomerase                                   91.3    5e-18   
ref|XP_002982114.1|  hypothetical protein SELMODRAFT_115826           90.9    9e-18   
emb|CDM84533.1|  unnamed protein product                              90.1    1e-17   
ref|XP_002992215.1|  hypothetical protein SELMODRAFT_134976           90.1    1e-17   
ref|XP_002456473.1|  hypothetical protein SORBIDRAFT_03g036980        90.1    2e-17   
emb|CBI28542.3|  unnamed protein product                              91.7    2e-17   
gb|KGN52627.1|  hypothetical protein Csa_5G647490                     90.5    2e-17   
ref|XP_008459536.1|  PREDICTED: probable nucleoredoxin 1 isoform X6   89.4    2e-17   
ref|XP_006435251.1|  hypothetical protein CICLE_v10001187mg           89.7    2e-17   
ref|XP_008459535.1|  PREDICTED: probable nucleoredoxin 1-1 isofor...  89.0    4e-17   
ref|XP_008459534.1|  PREDICTED: probable nucleoredoxin 1-1 isofor...  89.0    4e-17   
ref|XP_008459533.1|  PREDICTED: probable nucleoredoxin 1 isoform X3   89.0    5e-17   
gb|AGH33853.1|  PDI4                                                  89.4    5e-17   
ref|XP_008459532.1|  PREDICTED: probable nucleoredoxin 1 isoform X2   89.0    5e-17   
ref|XP_008459531.1|  PREDICTED: probable nucleoredoxin 1 isoform X1   89.0    6e-17   
gb|ACG38694.1|  protein disulfide isomerase                           88.6    6e-17   
gb|AAU04768.1|  protein disulfide isomerase (PDI)-like protein 4      89.0    8e-17   
ref|XP_004141531.1|  PREDICTED: probable nucleoredoxin 1-like         89.7    9e-17   
ref|XP_010064572.1|  PREDICTED: probable nucleoredoxin 2              85.5    9e-17   
gb|KJB14360.1|  hypothetical protein B456_002G121200                  87.4    1e-16   
ref|XP_002741798.1|  PREDICTED: nucleoredoxin-like                    87.4    1e-16   
gb|EMS60992.1|  putative nucleoredoxin 2                              89.0    2e-16   
ref|XP_008653605.1|  PREDICTED: probable nucleoredoxin 3              85.9    2e-16   
ref|XP_011014064.1|  PREDICTED: probable nucleoredoxin 1              84.3    2e-16   
tpg|DAA59507.1|  TPA: hypothetical protein ZEAMMB73_323265            85.9    3e-16   
dbj|BAK03911.1|  predicted protein                                    87.0    3e-16   
emb|CCP27784.1|  unnamed protein product                              87.0    6e-16   
ref|XP_008459538.1|  PREDICTED: probable nucleoredoxin 1              84.3    9e-16   
gb|EMT04086.1|  hypothetical protein F775_43323                       85.1    1e-15   
ref|XP_002974175.1|  hypothetical protein SELMODRAFT_15910            81.3    3e-15   
ref|XP_003384190.1|  PREDICTED: nucleoredoxin-like                    83.6    4e-15   
sp|Q7XPE8.2|NRX3_ORYSJ  RecName: Full=Probable nucleoredoxin 3; S...  83.6    4e-15   
gb|KGN52628.1|  hypothetical protein Csa_5G647500                     81.6    9e-15   
ref|XP_010682547.1|  PREDICTED: probable nucleoredoxin 1 isoform X2   81.3    1e-14   
gb|KDO82404.1|  hypothetical protein CISIN_1g008336mg                 80.5    2e-14   
ref|XP_010431903.1|  PREDICTED: probable nucleoredoxin 1              78.2    2e-14   
ref|XP_010470488.1|  PREDICTED: probable nucleoredoxin 1 isoform X2   78.2    4e-14   
ref|XP_005768492.1|  hypothetical protein EMIHUDRAFT_445503           80.5    5e-14   
ref|XP_005769806.1|  hypothetical protein EMIHUDRAFT_436388           80.1    5e-14   
ref|XP_010470487.1|  PREDICTED: probable nucleoredoxin 1 isoform X1   78.2    5e-14   
ref|XP_011441997.1|  PREDICTED: probable nucleoredoxin 1              77.0    7e-14   
ref|XP_008824756.1|  PREDICTED: nucleoredoxin                         77.0    1e-13   
ref|XP_011410190.1|  PREDICTED: ATP-dependent RNA helicase DHX36      80.1    2e-13   
ref|XP_008864269.1|  hypothetical protein H310_02512                  79.0    2e-13   
gb|AAH63828.1|  NXN protein                                           76.3    2e-13   
gb|EJY79822.1|  thioredoxin                                           77.0    2e-13   
ref|XP_009839259.1|  hypothetical protein H257_13447                  79.0    2e-13   
ref|XP_005804144.1|  PREDICTED: nucleoredoxin-like                    77.8    2e-13   
gb|EJY77789.1|  thioredoxin                                           77.0    3e-13   
ref|XP_009033181.1|  hypothetical protein AURANDRAFT_16440            73.6    3e-13   
ref|XP_008944115.1|  PREDICTED: nucleoredoxin                         76.3    3e-13   
gb|KFQ34957.1|  Nucleoredoxin                                         76.3    3e-13   
ref|XP_005582477.1|  PREDICTED: nucleoredoxin isoform X3              76.6    3e-13   
gb|EHH57553.1|  Nucleoredoxin                                         76.6    4e-13   
gb|AAH73845.1|  NXN protein                                           75.9    4e-13   
ref|XP_005582476.1|  PREDICTED: nucleoredoxin isoform X2              76.6    4e-13   
ref|XP_007567435.1|  PREDICTED: nucleoredoxin                         77.4    4e-13   
ref|XP_002767066.1|  Tryparedoxin, putative                           74.3    5e-13   
ref|XP_003884365.1|  putative nnucleoredoxin                          75.5    5e-13   
ref|XP_001701995.1|  nucleoredoxin 2                                  77.8    5e-13   
ref|XP_009839261.1|  hypothetical protein H257_13449                  77.4    5e-13   
ref|XP_009187555.1|  PREDICTED: nucleoredoxin isoform X3              76.6    5e-13   
ref|XP_007623197.1|  PREDICTED: nucleoredoxin isoform X2              75.9    5e-13   
ref|XP_002958706.1|  hypothetical protein VOLCADRAFT_108271           77.4    6e-13   
ref|XP_008054249.1|  PREDICTED: nucleoredoxin                         75.9    7e-13   
ref|NP_001167329.1|  Tryparedoxin                                     77.0    7e-13   
ref|XP_003417015.1|  PREDICTED: nucleoredoxin                         76.3    7e-13   
ref|XP_008827049.1|  PREDICTED: nucleoredoxin                         76.6    7e-13   
ref|XP_006977476.1|  PREDICTED: nucleoredoxin                         75.9    7e-13   
ref|XP_005582475.1|  PREDICTED: nucleoredoxin isoform X1              76.6    7e-13   
ref|XP_006641152.1|  PREDICTED: nucleoredoxin-like                    76.6    7e-13   
ref|XP_010371830.1|  PREDICTED: nucleoredoxin                         76.6    7e-13   
ref|XP_008423154.1|  PREDICTED: nucleoredoxin                         76.6    8e-13   
gb|AFK11103.1|  nucleoredoxin-like protein                            75.1    8e-13   
gb|ELU09340.1|  hypothetical protein CAPTEDRAFT_174065                76.6    8e-13   
gb|ELK26967.1|  Nucleoredoxin                                         75.5    8e-13   
gb|KDO32836.1|  hypothetical protein SPRG_02529                       77.0    8e-13   
gb|ELR61876.1|  Nucleoredoxin                                         75.5    9e-13   
ref|XP_005402699.1|  PREDICTED: nucleoredoxin                         75.9    9e-13   
ref|XP_004318054.1|  PREDICTED: nucleoredoxin                         75.5    9e-13   
ref|XP_004707373.1|  PREDICTED: nucleoredoxin                         76.3    9e-13   
gb|KFZ53194.1|  Nucleoredoxin                                         74.3    9e-13   
ref|XP_010863626.1|  PREDICTED: nucleoredoxin                         76.6    9e-13   
gb|ELK01886.1|  Nucleoredoxin                                         75.9    9e-13   
gb|KDO32015.1|  hypothetical protein SPRG_03232                       74.7    9e-13   
gb|ELV11126.1|  Nucleoredoxin                                         75.5    9e-13   
ref|XP_005654033.1|  PREDICTED: nucleoredoxin                         75.5    9e-13   
ref|XP_010640711.1|  PREDICTED: nucleoredoxin                         75.9    9e-13   
ref|XP_002191661.1|  PREDICTED: nucleoredoxin-like                    74.7    9e-13   
ref|XP_010956525.1|  PREDICTED: nucleoredoxin                         75.5    9e-13   
ref|XP_009924330.1|  PREDICTED: nucleoredoxin                         73.6    9e-13   
ref|XP_004605049.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_008531526.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_009814648.1|  PREDICTED: nucleoredoxin                         74.7    1e-12   
ref|XP_003912092.1|  PREDICTED: nucleoredoxin isoform X1              76.6    1e-12   
ref|XP_007123660.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_005328005.1|  PREDICTED: nucleoredoxin                         75.9    1e-12   
gb|KFP95148.1|  Nucleoredoxin                                         73.6    1e-12   
ref|XP_008968177.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_005256815.1|  PREDICTED: nucleoredoxin isoform X3              75.5    1e-12   
ref|NP_001192248.1|  nucleoredoxin isoform 2                          75.5    1e-12   
ref|XP_006940095.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_005932096.1|  PREDICTED: nucleoredoxin-like isoform X2         75.5    1e-12   
gb|AAH09327.2|  NXN protein                                           75.5    1e-12   
ref|XP_006863275.1|  PREDICTED: nucleoredoxin isoform X2              75.9    1e-12   
ref|XP_008007939.1|  PREDICTED: nucleoredoxin                         76.6    1e-12   
ref|XP_004635420.1|  PREDICTED: nucleoredoxin isoform X3              75.9    1e-12   
gb|KFV57197.1|  Nucleoredoxin                                         74.7    1e-12   
ref|XP_005858409.1|  PREDICTED: nucleoredoxin                         75.9    1e-12   
ref|XP_009074337.1|  PREDICTED: nucleoredoxin                         74.3    1e-12   
ref|XP_005349576.1|  PREDICTED: nucleoredoxin isoform X2              75.9    1e-12   
ref|NP_001101755.1|  nucleoredoxin                                    75.9    1e-12   
gb|AAH04688.1|  Nxn protein                                           76.3    1e-12   
ref|XP_003469738.1|  PREDICTED: nucleoredoxin isoform 2               75.9    1e-12   
ref|XP_005493616.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_005474805.1|  PREDICTED: nucleoredoxin-like isoform X2         75.1    1e-12   
ref|XP_004807669.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_005932097.1|  PREDICTED: nucleoredoxin-like isoform X3         75.1    1e-12   
ref|XP_004483855.1|  PREDICTED: nucleoredoxin isoform 2               75.9    1e-12   
gb|EPQ02770.1|  Nucleoredoxin                                         75.5    1e-12   
gb|KFW07294.1|  Nucleoredoxin                                         74.7    1e-12   
ref|XP_005067434.1|  PREDICTED: nucleoredoxin isoform X2              75.9    1e-12   
ref|XP_006768187.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_009574641.1|  PREDICTED: nucleoredoxin                         73.9    1e-12   
ref|XP_006891069.1|  PREDICTED: nucleoredoxin isoform X4              75.9    1e-12   
ref|XP_006925243.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
gb|EGV96743.1|  Nucleoredoxin                                         76.3    1e-12   
ref|XP_003506776.1|  PREDICTED: nucleoredoxin isoform X1              75.9    1e-12   
gb|KFP81403.1|  Nucleoredoxin                                         74.3    1e-12   
ref|XP_005256814.1|  PREDICTED: nucleoredoxin isoform X2              75.5    1e-12   
ref|XP_004901065.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
gb|EHB13353.1|  Nucleoredoxin                                         75.9    1e-12   
gb|KFQ89891.1|  Nucleoredoxin                                         73.9    1e-12   
gb|KFW03638.1|  Nucleoredoxin                                         73.9    1e-12   
ref|XP_010859662.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_008591306.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_007520482.1|  PREDICTED: nucleoredoxin isoform X2              75.9    1e-12   
ref|XP_006099271.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_010170099.1|  PREDICTED: nucleoredoxin                         74.3    1e-12   
ref|XP_004747434.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
dbj|BAD88798.1|  nucleoredoxin                                        75.9    1e-12   
gb|EDL12859.1|  nucleoredoxin                                         75.9    1e-12   
ref|XP_004685199.1|  PREDICTED: nucleoredoxin                         75.5    1e-12   
ref|XP_004433510.1|  PREDICTED: nucleoredoxin                         75.9    1e-12   
ref|XP_004635419.1|  PREDICTED: nucleoredoxin isoform X2              75.9    1e-12   
ref|XP_009429794.1|  PREDICTED: nucleoredoxin isoform X1              75.5    1e-12   
gb|KFZ62045.1|  Nucleoredoxin                                         73.9    2e-12   
ref|XP_005349575.1|  PREDICTED: nucleoredoxin isoform X1              75.9    2e-12   
ref|XP_011441998.1|  PREDICTED: nucleoredoxin-like                    72.4    2e-12   
ref|XP_006863274.1|  PREDICTED: nucleoredoxin isoform X1              75.9    2e-12   
ref|XP_002605721.1|  hypothetical protein BRAFLDRAFT_77988            75.5    2e-12   
ref|XP_006246969.1|  PREDICTED: nucleoredoxin isoform X1              75.9    2e-12   
ref|NP_032776.1|  nucleoredoxin                                       75.9    2e-12   
ref|XP_005067433.1|  PREDICTED: nucleoredoxin isoform X1              75.9    2e-12   
ref|XP_004483854.1|  PREDICTED: nucleoredoxin isoform 1               75.9    2e-12   
ref|XP_002718941.1|  PREDICTED: nucleoredoxin                         75.9    2e-12   
gb|KDO32827.1|  hypothetical protein SPRG_02520                       76.3    2e-12   
ref|XP_009971007.1|  PREDICTED: nucleoredoxin                         73.6    2e-12   
ref|XP_004635418.1|  PREDICTED: nucleoredoxin isoform X1              75.9    2e-12   
ref|XP_004013286.1|  PREDICTED: nucleoredoxin                         75.9    2e-12   
ref|XP_003469737.1|  PREDICTED: nucleoredoxin isoform 1               75.9    2e-12   
ref|XP_008122185.1|  PREDICTED: nucleoredoxin                         74.7    2e-12   
ref|XP_004376324.1|  PREDICTED: nucleoredoxin                         75.9    2e-12   
ref|XP_001701807.1|  nucleoredoxin 1                                  75.1    2e-12   
ref|XP_008928855.1|  PREDICTED: nucleoredoxin                         75.1    2e-12   
ref|XP_011358201.1|  PREDICTED: LOW QUALITY PROTEIN: nucleoredoxin    75.9    2e-12   
ref|XP_005056720.1|  PREDICTED: nucleoredoxin                         74.7    2e-12   
gb|KFV58459.1|  Nucleoredoxin                                         73.6    2e-12   
ref|XP_005624969.1|  PREDICTED: nucleoredoxin isoform X1              75.5    2e-12   
gb|EAW90639.1|  nucleoredoxin, isoform CRA_a                          75.5    2e-12   
ref|XP_006891067.1|  PREDICTED: nucleoredoxin isoform X2              75.9    2e-12   
ref|XP_006052777.1|  PREDICTED: nucleoredoxin                         75.9    2e-12   
ref|XP_006891068.1|  PREDICTED: nucleoredoxin isoform X3              75.9    2e-12   
gb|KFW86506.1|  Nucleoredoxin                                         74.7    2e-12   
ref|XP_003642481.2|  PREDICTED: nucleoredoxin                         74.3    2e-12   
ref|XP_004594003.1|  PREDICTED: nucleoredoxin                         74.7    2e-12   
ref|XP_009697403.1|  PREDICTED: nucleoredoxin                         73.9    2e-12   
ref|XP_006891066.1|  PREDICTED: nucleoredoxin isoform X1              75.9    2e-12   
ref|XP_008307694.1|  PREDICTED: nucleoredoxin                         75.5    2e-12   
ref|XP_009503264.1|  PREDICTED: nucleoredoxin                         73.6    2e-12   
emb|CDQ77743.1|  unnamed protein product                              75.5    2e-12   
ref|XP_009671237.1|  PREDICTED: nucleoredoxin                         74.7    2e-12   
ref|XP_004267132.1|  PREDICTED: nucleoredoxin isoform 2               75.5    2e-12   
ref|XP_005693427.1|  PREDICTED: nucleoredoxin                         75.5    2e-12   
gb|KFP64510.1|  Nucleoredoxin                                         73.9    2e-12   
ref|XP_008606784.1|  hypothetical protein SDRG_02951                  72.0    2e-12   
ref|XP_004404145.1|  PREDICTED: nucleoredoxin isoform 2               75.5    2e-12   
gb|KFV80184.1|  Nucleoredoxin                                         74.7    2e-12   
ref|XP_003800168.1|  PREDICTED: nucleoredoxin                         75.5    2e-12   
ref|XP_001701806.1|  nucleoredoxin 1                                  75.9    2e-12   
ref|XP_007520481.1|  PREDICTED: nucleoredoxin isoform X1              75.5    2e-12   
ref|XP_005598018.1|  PREDICTED: nucleoredoxin                         75.5    2e-12   
ref|XP_007898874.1|  PREDICTED: nucleoredoxin                         74.7    2e-12   
ref|XP_853899.1|  PREDICTED: nucleoredoxin isoform X2                 75.5    2e-12   
ref|XP_008881883.1|  nucleoredoxin family protein                     75.5    2e-12   
ref|XP_010720373.1|  PREDICTED: nucleoredoxin isoform X3              74.3    2e-12   
ref|XP_005298217.1|  PREDICTED: nucleoredoxin                         75.5    2e-12   
ref|NP_001095606.1|  nucleoredoxin                                    75.5    2e-12   
ref|XP_004267131.1|  PREDICTED: nucleoredoxin isoform 1               75.5    2e-12   
gb|KFO08069.1|  Nucleoredoxin                                         73.6    2e-12   



>ref|XP_004297483.1| PREDICTED: probable nucleoredoxin 1 [Fragaria vesca subsp. vesca]
Length=583

 Score =   232 bits (591),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 136/186 (73%), Positives = 160/186 (86%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSDRDQ+SFD+FFS MPWLA+P+GD RK SLSR FKV+GIPMLVAIGR
Sbjct  401  KAKDDAFEVIFISSDRDQASFDDFFSGMPWLALPFGDSRKASLSRRFKVQGIPMLVAIGR  460

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T EAR+L+M HGADAYPFTEERLKE+EAE EEMAKGWP K+ +ALHEEHEL+L R
Sbjct  461  AGQTVTKEARDLIMVHGADAYPFTEERLKEMEAELEEMAKGWPRKLKNALHEEHELVLAR  520

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R ++ CDGCNE G+ WSFYC++CDFDLHPKCAL   +EE   +   K + +++EGWVCDG
Sbjct  521  RNNFVCDGCNEKGETWSFYCEECDFDLHPKCAL---EEEKGTKTDAKPEGESQEGWVCDG  577

Query  168  EVCKKA  151
            EVCKKA
Sbjct  578  EVCKKA  583


 Score = 86.7 bits (213),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S+D D+ SF+ +FSKMPWLAIP+ D + + SL   FKVRGIP LV +   GR  
Sbjct  85   FEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARESLDEQFKVRGIPHLVFLCEEGRVR  144

Query  513  TTEARNLVMSHGADAYPFT  457
                  +V  +G D YPFT
Sbjct  145  NASGVEIVREYGVDGYPFT  163


 Score = 62.0 bits (149),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGS-LSRLFKVRGIPMLVAIG  532
            KA+ ++FE++FIS D ++ +F+E  + MPW A+P  D +    L+R F++  +P LV +G
Sbjct  240  KAQGESFEIVFISLDDEEEAFEEDLTNMPWFALPQKDTKTSEKLARYFELSTLPTLVILG  299

Query  531  RTGRTLTTEARNLVMSHGADAYPFT  457
              G+T+       +  HG  AYPFT
Sbjct  300  ADGKTVHNNVVEAIEEHGLLAYPFT  324



>ref|XP_010651766.1| PREDICTED: probable nucleoredoxin 1 [Vitis vinifera]
Length=219

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 134/186 (72%), Positives = 153/186 (82%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD+DQ+SFDEFFS MPWLA+P+GD RK SLSR FKV GIP L+AIG 
Sbjct  37   KTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDKRKASLSRTFKVHGIPSLIAIGP  96

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEARNLVM HGADAYPFTEE +KE+EA+YEEMAKGWPEKM HALHEEHEL+LT+
Sbjct  97   TGRTVTTEARNLVMIHGADAYPFTEEHIKEIEAQYEEMAKGWPEKMKHALHEEHELVLTK  156

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC + G  WSFYC++CDFDLHPKCALEE K    +E  +       EGW CDG
Sbjct  157  RRVYGCNGCEKQGHLWSFYCEECDFDLHPKCALEEDKGTKDDEMEKAS---PGEGWKCDG  213

Query  168  EVCKKA  151
            EVC KA
Sbjct  214  EVCYKA  219



>gb|KHG25736.1| hypothetical protein F383_04337 [Gossypium arboreum]
Length=570

 Score =   225 bits (574),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 149/186 (80%), Gaps = 11/186 (6%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KDDAFEVIFISSDRD++SFDE++S MPWLA+P+ D RK SLSR FKV+GIPML+A+G 
Sbjct  395  KEKDDAFEVIFISSDRDRASFDEYYSGMPWLALPFNDARKSSLSRKFKVQGIPMLIALGP  454

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM+HGADAYPFTEERLKE+EA+ EEMAKGWPEK+    HEEHEL+LTR
Sbjct  455  TGKTITKEARSLVMAHGADAYPFTEERLKEIEAQIEEMAKGWPEKLKDERHEEHELVLTR  514

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R +Y CD C E GQ WSFYC++CDFDLHPKCAL            ++     KEGWVCDG
Sbjct  515  RSNYVCDACKENGQVWSFYCEECDFDLHPKCAL-----------EKETKADAKEGWVCDG  563

Query  168  EVCKKA  151
            EVC +A
Sbjct  564  EVCTRA  569


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S+D D+ SF+ +FSKMPWLAIP+ D + +  L   F V GIP LV +   G+ L
Sbjct  81   FEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVMGIPHLVLLDENGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   ++  +G + YPFT
Sbjct  141  TEEGVEIIREYGEEGYPFT  159


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 48/84 (57%), Gaps = 1/84 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+ IS D D+ SF + F   PWLA+P  D     L+R F++  +P +V IG 
Sbjct  236  KENGEKFEVVMISLDDDEESFRQSFG-APWLALPLKDKSCEKLARYFELSTLPTVVIIGP  294

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A + +  HG  AYPFT
Sbjct  295  DGKTLHPNAADAIDEHGIVAYPFT  318



>gb|KJB31218.1| hypothetical protein B456_005G181700 [Gossypium raimondii]
Length=570

 Score =   225 bits (573),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 150/186 (81%), Gaps = 11/186 (6%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KDDAFEVIFISSDRDQSSFD+++S MPWLA+P+ D RK SLSR FKV+GIPML+A+G 
Sbjct  395  KEKDDAFEVIFISSDRDQSSFDDYYSGMPWLALPFNDARKSSLSRKFKVQGIPMLIALGP  454

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM+HGADAYPFTEERLKE+EA+ EEMAKGWPEK+    HEEHEL+LTR
Sbjct  455  TGKTITKEARSLVMAHGADAYPFTEERLKEIEAQIEEMAKGWPEKLKDERHEEHELVLTR  514

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R +Y CD C+E GQ WSFYC++CDFDLHPKCAL            ++     KEGWVCDG
Sbjct  515  RSNYVCDVCDEMGQVWSFYCEECDFDLHPKCAL-----------EKETKADAKEGWVCDG  563

Query  168  EVCKKA  151
            EVC +A
Sbjct  564  EVCTRA  569


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S+D D+ SF+ +FSKMPWLAIP+ D + +  L   F V+GIP LV +   G+ L
Sbjct  81   FEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVKGIPHLVLLDENGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   ++  +G + YPFT
Sbjct  141  TEEGVEIIREYGEEGYPFT  159


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 47/84 (56%), Gaps = 1/84 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+ IS D D  SF + F   PWLA+P  D     L+R F++  +P +V IG 
Sbjct  236  KENGEKFEVVMISLDDDDESFKQSFG-APWLALPSKDKSCEKLARYFELSTLPTVVIIGP  294

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A + +  HG  AYPFT
Sbjct  295  DGKTLHPNAADAIDEHGIVAYPFT  318



>ref|XP_002525369.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF37007.1| nucleoredoxin, putative [Ricinus communis]
Length=575

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 160/187 (86%), Gaps = 1/187 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KDDAFEVIFISSDRDQ+SFDEFFS MPWLA+P+GD RK SLSR FKV+GIPML+A+G 
Sbjct  389  KTKDDAFEVIFISSDRDQASFDEFFSGMPWLALPFGDVRKASLSRKFKVQGIPMLIALGP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T EAR+LV  HGADAY FTEE LKE+EA+YE+MAKGWPEK+NHALHEEHEL+L+R
Sbjct  449  TGRTITKEARSLVTLHGADAYLFTEEHLKEIEAKYEDMAKGWPEKVNHALHEEHELVLSR  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALee-kkeepteeesqkddEKTKEGWVCD  172
            R ++ CDGCNEGG  WSF+C++CDFDLHPKCAL+E K+     +E +  +  +KEGW+CD
Sbjct  509  RMNFICDGCNEGGNIWSFHCEECDFDLHPKCALKEGKETRDGGKEDENGEAVSKEGWICD  568

Query  171  GEVCKKA  151
            GEVC KA
Sbjct  569  GEVCYKA  575


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FI++D D  SF+E+FSKMPWLAIP+ D D++  L  +FKV+GIP  V +   G+  
Sbjct  74   FEIVFITADEDDESFEEYFSKMPWLAIPFSDSDKRDRLDEIFKVQGIPHFVILDENGKVS  133

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G   YPFT
Sbjct  134  SESGVEIIQEYGVQCYPFT  152


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FE++FIS D ++ +F +  + MPWLA P+ D     L R F++  +P LV IG 
Sbjct  229  KAKGENFEIVFISLDDEEETFQQSLANMPWLAFPFNDKGCEKLVRYFELSTVPTLVVIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  289  DGKTLHSNVAEAIEEHGVQAYPFT  312



>ref|XP_008340047.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=579

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 161/186 (87%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSDRDQ SFDEFF+ MPWLA+P+GD RK  LSR FKV+GIPML+AIG 
Sbjct  396  KAKDDAFEVIFISSDRDQGSFDEFFATMPWLALPFGDSRKAFLSRKFKVQGIPMLIAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EARNL+M HGA+AYPFTEER+KE+EAE+EEMAKGWPEK+  ALHE+HEL+L++
Sbjct  456  TGQTVTKEARNLIMRHGANAYPFTEERVKEIEAEFEEMAKGWPEKLKSALHEKHELVLSK  515

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  + CDGC E G+ WSFYC +CDFDLHPKCAL  + ++ TE  ++++++++KEGWVCDG
Sbjct  516  RTAFVCDGCEEPGEVWSFYCKECDFDLHPKCAL--EGDKKTENGAKQEEDESKEGWVCDG  573

Query  168  EVCKKA  151
            +VC KA
Sbjct  574  DVCTKA  579


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FIS+D D  SF+ +F+KMPWLA P+ D + +  +  LFKVRGIP LV +G  G+ L
Sbjct  81   FEIVFISADEDDESFEGYFAKMPWLAFPFSDSEARDRVDELFKVRGIPHLVILGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +GADAYPFT
Sbjct  141  SDSGVEIIQEYGADAYPFT  159


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  + FE++ +  D D+ SF ++F KMPW ++P GD     L+R F++  +P +V IG 
Sbjct  236  KANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDKSVQKLARYFELSTLPTVVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL     + +  HG+ AYPFT
Sbjct  296  DGKTLGENVADAIDEHGSLAYPFT  319



>ref|XP_008221829.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Prunus mume]
Length=479

 Score =   221 bits (563),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSD+DQ  FDEFFS MPW A+P+GD RK SLSR FKVRGIPMLVAIG 
Sbjct  295  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWFALPFGDLRKASLSRRFKVRGIPMLVAIGP  354

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM HGA+AYPFTEERLKE+EAE+EEMAKGWPEK+  A HEEHEL L+R
Sbjct  355  TGQTVTKEARDLVMQHGANAYPFTEERLKEIEAEFEEMAKGWPEKLKSAQHEEHELTLSR  414

Query  348  RQHYTCDGCNEGG-QGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
            R+ Y CDGCN+ G +GWSFYC++CDFDLHPKCAL  ++++ TE +++++   +KEG+ CD
Sbjct  415  RKKYVCDGCNKPGEEGWSFYCEECDFDLHPKCAL--EEDKGTESDAKEEQGPSKEGFRCD  472

Query  171  GEVCKKA  151
            G+VCKKA
Sbjct  473  GDVCKKA  479


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++F+V+ I  D D+ SF + F  MPW ++P GD     L+R F++  +P LV IG 
Sbjct  135  KANGESFQVVVIPLDDDEESFKQDFKSMPWFSLPIGDKNVEKLARYFELSTLPTLVIIGA  194

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T++      +  HG  AYPFT
Sbjct  195  DGKTISKNVAEAIEEHGVLAYPFT  218


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  627  MPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTLTTEARNLVMSHGADAYPFT  457
            MPWLAIP+ D + +  + +LFKV GIP LV +G  G+ L+     ++  +G D YPFT
Sbjct  1    MPWLAIPFFDKKARDRVDKLFKVIGIPCLVILGEDGKVLSDSGVEIIKEYGVDGYPFT  58



>ref|XP_007222806.1| hypothetical protein PRUPE_ppa005061mg [Prunus persica]
 gb|EMJ24005.1| hypothetical protein PRUPE_ppa005061mg [Prunus persica]
Length=479

 Score =   221 bits (562),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 159/187 (85%), Gaps = 3/187 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSDRDQ +FDEFFS MPWLA+P+GD RK SLSR FKV+GIPML+AIG 
Sbjct  295  KAKDDAFEVIFISSDRDQGAFDEFFSGMPWLALPFGDSRKASLSRRFKVQGIPMLIAIGP  354

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM HGA+AYPFTEERLKE+EAE EEMAKGWP+K+  A HEEHEL L R
Sbjct  355  TGQTVTKEARDLVMQHGANAYPFTEERLKEIEAESEEMAKGWPQKLKSAQHEEHELALAR  414

Query  348  RQHYTCDGCNEG-GQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
            R+ YTCDGC+E   +GWSFYC+ C+FDLHPKCAL  ++++  + +++++ +  +EGWVCD
Sbjct  415  RKDYTCDGCDEPEEEGWSFYCEACNFDLHPKCAL--EEDKGAKSDAKQEQDPPQEGWVCD  472

Query  171  GEVCKKA  151
            G VCKKA
Sbjct  473  GYVCKKA  479


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FEV+ I  D D+ SF + F  MPW ++P GD   G L+R F++  +P LV IG 
Sbjct  135  KANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNVGKLARYFELSTLPTLVIIGA  194

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T++      +  HG  AYPFT
Sbjct  195  DGKTVSKNVAEAIEEHGVLAYPFT  218


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 1/58 (2%)
 Frame = -3

Query  627  MPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTLTTEARNLVMSHGADAYPFT  457
            MPWLAIP+ D + +  +  LFKVRGIP LV +G  G+ L+     ++  HG D YPFT
Sbjct  1    MPWLAIPFSDSEARDGVDELFKVRGIPHLVILGEDGKVLSDSGVEIIEEHGVDGYPFT  58



>ref|XP_008221828.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Prunus mume]
Length=580

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 161/187 (86%), Gaps = 3/187 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSD+DQ  FDEFFS MPW A+P+GD RK SLSR FKVRGIPMLVAIG 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWFALPFGDLRKASLSRRFKVRGIPMLVAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM HGA+AYPFTEERLKE+EAE+EEMAKGWPEK+  A HEEHEL L+R
Sbjct  456  TGQTVTKEARDLVMQHGANAYPFTEERLKEIEAEFEEMAKGWPEKLKSAQHEEHELTLSR  515

Query  348  RQHYTCDGCNE-GGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
            R+ Y CDGCN+ G +GWSFYC++CDFDLHPKCAL  ++++ TE +++++   +KEG+ CD
Sbjct  516  RKKYVCDGCNKPGEEGWSFYCEECDFDLHPKCAL--EEDKGTESDAKEEQGPSKEGFRCD  573

Query  171  GEVCKKA  151
            G+VCKKA
Sbjct  574  GDVCKKA  580


 Score = 86.3 bits (212),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FIS+D D  SF+ +FSKMPWLAIP+ D + +  + +LFKV GIP LV +G  G+ L
Sbjct  81   FEVVFISADEDDESFNGYFSKMPWLAIPFFDKKARDRVDKLFKVIGIPCLVILGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G D YPFT
Sbjct  141  SDSGVEIIKEYGVDGYPFT  159


 Score = 75.9 bits (185),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++F+V+ I  D D+ SF + F  MPW ++P GD     L+R F++  +P LV IG 
Sbjct  236  KANGESFQVVVIPLDDDEESFKQDFKSMPWFSLPIGDKNVEKLARYFELSTLPTLVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T++      +  HG  AYPFT
Sbjct  296  DGKTISKNVAEAIEEHGVLAYPFT  319



>gb|KCW59852.1| hypothetical protein EUGRSUZ_H025922, partial [Eucalyptus grandis]
Length=370

 Score =   215 bits (548),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/194 (60%), Positives = 153/194 (79%), Gaps = 8/194 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  +A EVIFISSD+DQ++FD +F++MPWLA+P+GD+RK SLSR FKVRGIPMLVAIG 
Sbjct  177  KAAGNALEVIFISSDKDQTAFDNYFAQMPWLALPFGDERKKSLSRKFKVRGIPMLVAIGP  236

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T +AR+L+M HGADAYPFT E LK+ E +++E  KGWPEK+   LHEEHEL+  +
Sbjct  237  TGRTVTNKARDLIMDHGADAYPFTAEHLKKFEEKFKESIKGWPEKLKQPLHEEHELVPAQ  296

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEK--------T  193
            R+ YTCDGC+E G+GWS+YC++CDFDLHPKCA++E+K    E +   +  +         
Sbjct  297  RRRYTCDGCDEEGEGWSYYCEECDFDLHPKCAVKEEKATENELDEDNEAAEEEAKKEGDA  356

Query  192  KEGWVCDGEVCKKA  151
            KEGWVCDG+VC++A
Sbjct  357  KEGWVCDGDVCRRA  370


 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+ ++FE++ I  D D++SF++ F  MPWL++P+ D +   L R FK+  +P LV IG+
Sbjct  17   KARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKCEKLVRYFKLSTLPTLVIIGQ  76

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+       V  HG  AYPFT
Sbjct  77   DGKTVHANVAETVEEHGITAYPFT  100



>ref|XP_007044667.1| DC1 domain-containing protein [Theobroma cacao]
 gb|EOY00499.1| DC1 domain-containing protein [Theobroma cacao]
Length=577

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 156/186 (84%), Gaps = 4/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK++AFEV+F+SSDRDQ+SF+E++S+MPWLA+P+GD RK  LSR FKVRGIPMLVAIG 
Sbjct  396  KAKNEAFEVVFVSSDRDQASFEEYYSEMPWLALPFGDARKPLLSRKFKVRGIPMLVAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T E RNL+M+HGADAYPFTEERLKE+EA+YEEMAKGWPEK+ H LH+EHEL+L+R
Sbjct  456  TGKTVTKETRNLIMAHGADAYPFTEERLKEIEAQYEEMAKGWPEKLKHELHKEHELVLSR  515

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R +Y CD C + GQ WSFYC +CDFDLHPKCALEE K    +EE        KEGWVCDG
Sbjct  516  RTYYNCDACGDQGQVWSFYCGECDFDLHPKCALEEDKGSKADEEEGT----PKEGWVCDG  571

Query  168  EVCKKA  151
            EVC +A
Sbjct  572  EVCTRA  577


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IF+S D+D+ SF+ +FSKMPWLAIP+ D + +  L  LFKV GIP LV +G  G+ L
Sbjct  81   FEIIFVSGDQDEESFNGYFSKMPWLAIPFSDSETRSRLDELFKVMGIPHLVLLGENGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   ++  +G + YPF 
Sbjct  141  TDDGVGIIQEYGVEGYPFN  159


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D ++    +     PWLA+P+ D     L+R F++  +P +V IG 
Sbjct  236  KEKGENFEIVVISLDDEEEESFKESFVAPWLALPFKDKSCKKLARYFELSTLPTVVIIGP  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPF+
Sbjct  296  DGKTLHSNVAEAIEGHGIQAYPFS  319



>ref|XP_008221827.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=580

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 132/187 (71%), Positives = 158/187 (84%), Gaps = 3/187 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSD+DQ  FDEFFS MPWLA+P+GD RK SLSR FKV GIPMLVAIG 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWLALPFGDLRKASLSRRFKVNGIPMLVAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM HGA+AYPFTEERLKE+E E+EEM KGWPEK+  A HEEHEL L R
Sbjct  456  TGQTITKEARDLVMQHGANAYPFTEERLKEIEVEFEEMVKGWPEKLKSAQHEEHELTLAR  515

Query  348  RQHYTCDGCNEGG-QGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
            R+ Y CDGC+E G +GWSFYC++CDFDLHPKCAL  +K++ TE +++++ +  +EG VCD
Sbjct  516  RKGYVCDGCDESGEEGWSFYCEECDFDLHPKCAL--EKDKGTESDAKQEQDPPQEGRVCD  573

Query  171  GEVCKKA  151
            G+VCKKA
Sbjct  574  GDVCKKA  580


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FIS+D D  SF+ +FSKMPWLAIP+ D + +  +  LFKVRGIP LV +G  G+ L
Sbjct  81   FEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDRMDELFKVRGIPHLVILGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G D YPFT
Sbjct  141  SESGVEIIQEYGVDGYPFT  159


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FEV+ I  D D+ SF + F  MPW ++P GD     L+R F++  +P LV IG 
Sbjct  236  KASGESFEVVVIPLDDDEESFKQDFKSMPWFSLPIGDKNVRKLARYFELSTLPTLVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T++      +  +G  AYPFT
Sbjct  296  DGKTISKNVAEAIEENGVLAYPFT  319



>emb|CAN77321.1| hypothetical protein VITISV_008818 [Vitis vinifera]
Length=572

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 154/186 (83%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD+DQ+SFDEFFS MPWLA+P+GD RK SLSR FKV GIP L+AIG 
Sbjct  390  KTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDKRKASLSRTFKVHGIPSLIAIGP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEARNLVM HGADAYPFTEE +KE+EA+YEEMAKGWPEKM HALHEEHEL+LT+
Sbjct  450  TGRTVTTEARNLVMIHGADAYPFTEEHIKEIEAQYEEMAKGWPEKMKHALHEEHELVLTK  509

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC + G  WSFYC++CDFDLHPKCAL   +E+   ++ + +     EGW CDG
Sbjct  510  RRVYGCNGCEKQGHLWSFYCEECDFDLHPKCAL---EEDKGSKDDEMEKASPGEGWKCDG  566

Query  168  EVCKKA  151
            EVC KA
Sbjct  567  EVCYKA  572


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            + +D FE+IF+S D D  SF+ +FSKMPWLAIP+ D D +  L+ LFKV GIP LV +  
Sbjct  70   SSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVMLDE  129

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +G+ L+ +  +++  +G +AYPFT
Sbjct  130  SGKVLSEDGVDIIQEYGVEAYPFT  153


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D ++ SF ++F  MPWLA+P+ D     L+R F++  +P LV IG 
Sbjct  230  RAKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDKSCEKLARYFELSALPTLVVIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFT  313



>ref|XP_008221826.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=579

 Score =   219 bits (559),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 131/186 (70%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSD+DQ  FDEFFS MPWLA+P+GD RK SLS  FKVRGIPMLVAIG 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWLALPFGDLRKASLSHRFKVRGIPMLVAIGH  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM HGA+AYPFTEERLKE+EAE+EEMAK WP+K+  A HEEHEL L R
Sbjct  456  TGQTVTKEARDLVMQHGANAYPFTEERLKEIEAEFEEMAKRWPKKLKSAQHEEHELTLAR  515

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGC E G  WSFYC++CDFDLHPKCAL  +K+  T+ +++++ +  +EGWVCDG
Sbjct  516  RKSYVCDGCGEPGGAWSFYCEECDFDLHPKCAL--EKDRGTKSDAKQEQDPPQEGWVCDG  573

Query  168  EVCKKA  151
            +VCKKA
Sbjct  574  DVCKKA  579


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FIS+D D  SF+ +FSKMPWLAIP+ D + +  ++ LFKV GIP LV +G  G+ L
Sbjct  81   FEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDCMNELFKVIGIPHLVILGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++  +G D YPFT
Sbjct  141  CDSGVEIIQEYGVDGYPFT  159


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FEV+ I  D D+ SF + F  MPW ++P GD     L+  F++  +P LV IG 
Sbjct  236  KANGESFEVVVIPLDDDEESFKQDFKSMPWFSLPIGDKNVEKLAGYFELSTLPTLVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T++      +  HG  AYPFT
Sbjct  296  DGKTISKNVAEAIEEHGVLAYPFT  319



>ref|XP_010651402.1| PREDICTED: probable nucleoredoxin 1 [Vitis vinifera]
Length=572

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 154/186 (83%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD+DQ+SFDEFFS MPWLA+P+GD RK SLSR FKV GIP L+AIG 
Sbjct  390  KTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDKRKASLSRTFKVHGIPSLIAIGP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEARNLVM HGADAYPFTEE ++E+EA+YEEMAKGWPEK+ HALHEEHEL+LT+
Sbjct  450  TGRTVTTEARNLVMIHGADAYPFTEEHIREIEAQYEEMAKGWPEKVKHALHEEHELVLTK  509

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC + G  WSFYC++CDFDLHPKCAL   +E+   ++ + +     EGW CDG
Sbjct  510  RRVYVCNGCEKQGHLWSFYCEECDFDLHPKCAL---EEDKGSKDDEMEKASPGEGWKCDG  566

Query  168  EVCKKA  151
            EVC KA
Sbjct  567  EVCYKA  572


 Score = 91.3 bits (225),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            + +D FE+IF+S D D  SF+ +FSKMPWLAIP+ D D +  L+ LFKV GIP LV +  
Sbjct  70   SSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVMLDE  129

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +G+ L+ +  +++  +G +AYPFT
Sbjct  130  SGKVLSEDGVDIIQEYGVEAYPFT  153


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D ++ SF ++F  MPWLA+P+ D     L+R F++  +P LV IG 
Sbjct  230  RAKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDKSCEKLARYFELSALPTLVVIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFT  313



>ref|XP_007225633.1| hypothetical protein PRUPE_ppa003374mg [Prunus persica]
 gb|EMJ26832.1| hypothetical protein PRUPE_ppa003374mg [Prunus persica]
Length=580

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 160/187 (86%), Gaps = 3/187 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSDRDQ +FDEFFS MPWLA+P+GD RK  LSR FKV+GIPML+AIG 
Sbjct  396  KAKDDAFEVIFISSDRDQDAFDEFFSGMPWLALPFGDSRKACLSRRFKVQGIPMLIAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LVM HGA+AYPFTEERLKE+EAE+EEMAKGWPEK+  A HEEHEL+L R
Sbjct  456  TGQTVTKEARHLVMQHGANAYPFTEERLKEIEAEFEEMAKGWPEKLKSAQHEEHELVLAR  515

Query  348  RQHYTCDGCNEGG-QGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
            R+ Y CDGC+E G +GWSFYC+ CDFDLHPKCAL  ++++ T+ +++++ +  +E W CD
Sbjct  516  RKDYVCDGCDEPGEEGWSFYCEACDFDLHPKCAL--EEDKGTKSDAKQEQDPPQEEWACD  573

Query  171  GEVCKKA  151
            G+VCKKA
Sbjct  574  GDVCKKA  580


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FIS+D D  SF+ +FSKMPWLAIP+ D + +  + +LFKVRGIP LV +   G+ L
Sbjct  81   FEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDRVDKLFKVRGIPHLVILDEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  HG D YPFT
Sbjct  141  SDSGVEIIQEHGVDGYPFT  159


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FEV+ I  D D+ SF + F  MPW ++P GD   G L+R F++  +P LV IG 
Sbjct  236  KANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNVGKLARYFELSTLPTLVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T++      +  HG  AYPFT
Sbjct  296  DGKTVSKNVAEAIEEHGVLAYPFT  319



>ref|XP_004297482.1| PREDICTED: probable nucleoredoxin 1 [Fragaria vesca subsp. vesca]
Length=567

 Score =   217 bits (553),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 143/186 (77%), Gaps = 5/186 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSDRDQSSFD+FFS MPWLA+P+GD RK  L R FK++GIP +VAI  
Sbjct  387  KAKDNAFEVIFISSDRDQSSFDDFFSSMPWLALPFGDPRKAFLQRKFKIQGIPAVVAISP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+TT AR L+++HGADA+PFTEE LK LE + E+ AKGWPEK+   LH EH+L  TR
Sbjct  447  TGKTVTTTARKLILAHGADAFPFTEEHLKHLEEKIEQEAKGWPEKVKSELHVEHDLARTR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C+GC + G GWSFYC +CDFDLHPKCAL     +  E      + KTKEG+VCDG
Sbjct  507  RNEYVCNGCRDSGSGWSFYCKECDFDLHPKCAL-----KNNEATKDDPETKTKEGYVCDG  561

Query  168  EVCKKA  151
            +VC+KA
Sbjct  562  DVCRKA  567


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 54/80 (68%), Gaps = 3/80 (4%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD--DRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            FEV+FISSDRD+ SF  +FS+MPWLA+P+ D   RKG +  LFKVRGIP  V I   G+ 
Sbjct  73   FEVVFISSDRDEESFSGYFSEMPWLAVPFSDLETRKG-VKDLFKVRGIPHFVVIDANGKV  131

Query  516  LTTEARNLVMSHGADAYPFT  457
             T +   +V  +G + YPFT
Sbjct  132  CTDQGVVVVREYGVEGYPFT  151


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 1/84 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D ++  F E  + +PWLA+P+ D     L+R F++  +P LV IG 
Sbjct  228  KEKGEDFEIVLISLDFEEEHFKEGIA-VPWLALPFKDKNCEKLARYFELETVPTLVIIGH  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPF+
Sbjct  287  DGKTLHPNVTELIEEHGIEAYPFS  310



>ref|XP_010553606.1| PREDICTED: probable nucleoredoxin 1 [Tarenaya hassleriana]
Length=580

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 159/188 (85%), Gaps = 2/188 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+D+AFE+IFISSDRDQ+SFDE++S+MPWLA+P+GD RK SL+R FKV GIPMLVA+G 
Sbjct  393  KARDEAFELIFISSDRDQASFDEYYSEMPWLALPFGDPRKQSLARTFKVSGIPMLVALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEAR+LV +HGADAYPFT+ERLKE+EA+Y+EMAKGWPEK+ H LHEEHEL LTR
Sbjct  453  TGRTITTEARDLVGAHGADAYPFTQERLKEVEAKYDEMAKGWPEKVKHGLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL--eekkeepteeesqkddEKTKEGWVC  175
             + Y CD C+E G  WSF+CD+CDFDLHPKCAL  EE      EEE +K+  + KEGW+C
Sbjct  513  VRTYMCDKCDEEGLIWSFHCDECDFDLHPKCALGKEENDNTGEEEEVKKEGGEAKEGWIC  572

Query  174  DGEVCKKA  151
            DG VCKKA
Sbjct  573  DGNVCKKA  580


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S D D+ SF E+FSKMPWLAIP+ D + +  L  LFKVRGIP LV +    + +
Sbjct  78   FEIVFVSGDEDEESFKEYFSKMPWLAIPFTDSETRDRLDELFKVRGIPNLVILDENVKVV  137

Query  513  TTEARNLVMSHGADAYPFT  457
             T    +V  +G +AYPFT
Sbjct  138  NTNGVGMVRGYGVEAYPFT  156


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+ IS + D+ SF + F  MPWL++P+ D     L+R F + G+PMLV +G 
Sbjct  233  KEMGENFEVVMISLEDDEESFKQDFETMPWLSLPFNDKSSSKLARHFMLSGLPMLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T        V  +G  AYPFT
Sbjct  293  DGKTRHPNVVEAVEEYGVVAYPFT  316



>gb|KCW59854.1| hypothetical protein EUGRSUZ_H02593 [Eucalyptus grandis]
Length=584

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 154/194 (79%), Gaps = 8/194 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  +A EVIFISSDR+Q++FD++F++MPWLA+P+GD+RK SLS  FKVRGIPMLVAIG 
Sbjct  391  KAAGNALEVIFISSDRNQTAFDDYFAQMPWLALPFGDERKKSLSGKFKVRGIPMLVAIGP  450

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T +AR+L+M HGADAYPFT E LK+ E +++E  KGWPEK+ H LHEEHEL+  +
Sbjct  451  TGRTVTNKARDLIMDHGADAYPFTAEHLKKFEEKFKESIKGWPEKLKHPLHEEHELVPAQ  510

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEK--------T  193
            R+ YTC+GC+E G+GWS+YC++CDFDLHPKCA++E+K    E +   +  +         
Sbjct  511  RRRYTCEGCDEEGEGWSYYCEECDFDLHPKCAVKEEKATENELDEDDEAAEEEAKKEGDA  570

Query  192  KEGWVCDGEVCKKA  151
            KEGWVCDGEVC+KA
Sbjct  571  KEGWVCDGEVCRKA  584


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFISSD D+ SF  +FSKMPWLAIP+ D +++ SL  LF VRGIP LV +  TG  L
Sbjct  76   LEIIFISSDEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFNVRGIPHLVLLDGTGTVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +V  +G + +PFT
Sbjct  136  TDSGVEIVREYGEEGHPFT  154


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK+++FE++ I  D D++SF++ F  MPWL++P+ D +   L R F++  +P LV IG+
Sbjct  231  KAKEESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKWEKLVRYFELSTLPTLVIIGQ  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+       V  HG  AYPFT
Sbjct  291  DGKTVHPNVAGTVEKHGVAAYPFT  314



>ref|XP_010023556.1| PREDICTED: probable nucleoredoxin 1 [Eucalyptus grandis]
Length=599

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 154/194 (79%), Gaps = 8/194 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  +A EVIFISSDR+Q++FD++F++MPWLA+P+GD+RK SLS  FKVRGIPMLVAIG 
Sbjct  406  KAAGNALEVIFISSDRNQTAFDDYFAQMPWLALPFGDERKKSLSGKFKVRGIPMLVAIGP  465

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T +AR+L+M HGADAYPFT E LK+ E +++E  KGWPEK+ H LHEEHEL+  +
Sbjct  466  TGRTVTNKARDLIMDHGADAYPFTAEHLKKFEEKFKESIKGWPEKLKHPLHEEHELVPAQ  525

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEK--------T  193
            R+ YTC+GC+E G+GWS+YC++CDFDLHPKCA++E+K    E +   +  +         
Sbjct  526  RRRYTCEGCDEEGEGWSYYCEECDFDLHPKCAVKEEKATENELDEDDEAAEEEAKKEGDA  585

Query  192  KEGWVCDGEVCKKA  151
            KEGWVCDGEVC+KA
Sbjct  586  KEGWVCDGEVCRKA  599


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFISSD D+ SF  +FSKMPWLAIP+ D +++ SL  LF VRGIP LV +  TG  L
Sbjct  91   LEIIFISSDEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFNVRGIPHLVLLDGTGTVL  150

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +V  +G + +PFT
Sbjct  151  TDSGVEIVREYGEEGHPFT  169


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK+++FE++ I  D D++SF++ F  MPWL++P+ D +   L R F++  +P LV IG+
Sbjct  246  KAKEESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKWEKLVRYFELSTLPTLVIIGQ  305

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+       V  HG  AYPFT
Sbjct  306  DGKTVHPNVAGTVEKHGVAAYPFT  329



>ref|XP_009391725.1| PREDICTED: probable nucleoredoxin 1 [Musa acuminata subsp. malaccensis]
Length=591

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 122/192 (64%), Positives = 152/192 (79%), Gaps = 6/192 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KDDAFE+IF+S+DRD+SSF +FFS+MPWLA+P+GD+RK  L+R FK+ GIP LVAIG 
Sbjct  400  KEKDDAFEIIFVSNDRDESSFHDFFSEMPWLALPFGDERKKFLARTFKIYGIPSLVAIGP  459

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+TTEAR LVM+HGA AYPFT+ER++E+EAE EEMAKGWPEK+ H LHE+HEL+ + 
Sbjct  460  TGKTVTTEARELVMTHGAAAYPFTKERIQEIEAEIEEMAKGWPEKLKHKLHEQHELVKSH  519

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteees------qkddEKTKE  187
            R+ Y CD CNE G GWSFYCDDCDFDLHPKCA  + +      +S      ++  E  KE
Sbjct  520  RRSYICDACNEEGSGWSFYCDDCDFDLHPKCAFNDDEVANGVGDSHSDGPGEEQRENGKE  579

Query  186  GWVCDGEVCKKA  151
            G++CDGEVC KA
Sbjct  580  GYICDGEVCYKA  591


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 57/84 (68%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            +++  FE++F+S+D D+ SF ++FSKMPW AIP+ D D +  L+ LF V GIP LV    
Sbjct  80   SENGNFEIVFVSADEDEKSFTDYFSKMPWFAIPFSDSDIRDRLNDLFDVGGIPYLVIFDV  139

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+ LT+    +V  +G++AYPFT
Sbjct  140  NGKVLTSVGVQVVRDYGSNAYPFT  163


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+ +S D ++SS+++ F+ MPWLAIP+ D     L R F++  IP LV IG 
Sbjct  240  KENGENFEVVLVSLDDEESSYEQGFADMPWLAIPFKDKICDKLVRYFELDSIPTLVVIGS  299

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +    L+  HG +AYPF+
Sbjct  300  DGKTLNSNVAELIEEHGIEAYPFS  323



>ref|XP_010243057.1| PREDICTED: probable nucleoredoxin 1 [Nelumbo nucifera]
Length=570

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 148/186 (80%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDD FEVIFISSD +QSSFDEF+S MPWLA+P+GD+RK SL+R FKV GIP  VAIG 
Sbjct  387  KAKDDGFEVIFISSDSNQSSFDEFYSGMPWLALPFGDERKKSLNRRFKVTGIPTAVAIGS  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+TT+ARNL+M+HGADAYPFT+ER+KE+E++ EE+AKGWP+ +      EHEL LTR
Sbjct  447  SGRTVTTDARNLLMAHGADAYPFTDERVKEIESQLEEIAKGWPKNVK-HPLHEHELFLTR  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGC E   GWSFYC  CD+DLHP+CAL  K  +   EE+   D +TKEGW+CDG
Sbjct  506  RRIYNCDGCEEVNTGWSFYCKKCDYDLHPQCAL--KASDDAIEENANGDNETKEGWICDG  563

Query  168  EVCKKA  151
            EVC KA
Sbjct  564  EVCFKA  569


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S+D+D+  F+ +FSKMPWLAIP+ D D +  L  +F+V GIP LV +   G+  
Sbjct  72   FEIVFVSADQDEEEFNGYFSKMPWLAIPFSDSDTRDRLDGIFQVNGIPHLVILDANGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   ++  +G +AYPFT
Sbjct  132  TEEGVEIIGEYGVEAYPFT  150


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FEV+ IS D D+ S+ + F  +PWLA+P+ D     L R F++  +P LV IG 
Sbjct  227  KEKAESFEVVLISLDDDEESYKKSFEIVPWLALPFKDKSISKLVRYFELSTVPTLVIIGT  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL + A  ++  HG   YPFT
Sbjct  287  DGKTLHSNAVKIIEEHGIQGYPFT  310



>emb|CAN59927.1| hypothetical protein VITISV_043885 [Vitis vinifera]
Length=570

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 149/186 (80%), Gaps = 4/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD  FEVIFISSDRDQ+SFD+FFS+MPWLA+P+GD+RK SLS++FKV+GIP +VAIG 
Sbjct  389  KAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDERKESLSKMFKVQGIPKVVAIGP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TT+AR+LV  HGADAYPFT +   +      EMAKGWP+K++HALHEEHEL LT+
Sbjct  449  TGRTITTQARDLVADHGADAYPFT-DERLQEIEAQYEMAKGWPDKLSHALHEEHELALTQ  507

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CDGC+E G  W+F C++CDFDLHPKCAL   ++    E+   D+EK +EGW+CDG
Sbjct  508  HQIYKCDGCDEEGHAWAFSCEECDFDLHPKCAL---EDGKGTEDDAMDEEKPEEGWICDG  564

Query  168  EVCKKA  151
            +VC KA
Sbjct  565  KVCFKA  570


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+ F+S+D D   F E+FS+MPWLAIP+ D D +  L  LF+V GIP +V IG  G+ L
Sbjct  74   FEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPHIVIIGENGKVL  133

Query  513  TTEARNLVMSHGADAYPFT  457
            T     ++  +G + +PFT
Sbjct  134  TDSGVEIIREYGVEGFPFT  152


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FE++ IS D D+ SF+E    MPW A+P+ D+    L+R F++  +P LV IG 
Sbjct  229  KAMGESFEIVLISFDDDEESFNEGXGSMPWFALPFKDESCRKLARYFELSTVPTLVMIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  +G  AYPFT
Sbjct  289  DGKTLHSNVVEAIEEYGIQAYPFT  312



>ref|XP_010651408.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Vitis vinifera]
Length=570

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 5/186 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSDRDQ+SFDEFFS MPWLA+P+GD RK SL R FKVR IP L+A+  
Sbjct  390  KAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDKRKASLGRTFKVRSIPKLIAVEP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEAR LVM HGADAYPFT E   +      EMAKGWPEKM HALHEEHEL+LT+
Sbjct  450  TGRTVTTEARTLVMIHGADAYPFT-EEHIKEIEAQYEMAKGWPEKMKHALHEEHELVLTK  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C+GC + G  WSFYC++CDF+LHPKCAL    EE    +  ++  +  EGW CDG
Sbjct  509  RGIYRCNGCEKQGHLWSFYCEECDFNLHPKCAL----EEDKGSKEDEEKARPGEGWKCDG  564

Query  168  EVCKKA  151
            EVC +A
Sbjct  565  EVCSRA  570


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IF+S D+    F+E+FSKMPWLAIP+ D D +  L +LFKVRGIP L  +  +G+ L
Sbjct  75   FEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRGIPSLAMLDESGKVL  134

Query  513  TTEARNLVMSHGADAYPFT  457
            ++E   ++  +G + YPFT
Sbjct  135  SSEGVEIIKDYGVEGYPFT  153


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D +  SF   F  MPWLA+P+ D     L+R F++  +P LV IG 
Sbjct  230  RAKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCKKLARYFELSALPTLVVIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFT  313



>ref|XP_010651414.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Vitis vinifera]
Length=562

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 141/186 (76%), Gaps = 5/186 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSDRDQ+SFDEFFS MPWLA+P+GD RK SL R FKVR IP L+A+  
Sbjct  382  KAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDKRKASLGRTFKVRSIPKLIAVEP  441

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEAR LVM HGADAYPFT E   +      EMAKGWPEKM HALHEEHEL+LT+
Sbjct  442  TGRTVTTEARTLVMIHGADAYPFT-EEHIKEIEAQYEMAKGWPEKMKHALHEEHELVLTK  500

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C+GC + G  WSFYC++CDF+LHPKCAL    EE    +  ++  +  EGW CDG
Sbjct  501  RGIYRCNGCEKQGHLWSFYCEECDFNLHPKCAL----EEDKGSKEDEEKARPGEGWKCDG  556

Query  168  EVCKKA  151
            EVC +A
Sbjct  557  EVCSRA  562


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IF+S D+    F+E+FSKMPWLAIP+ D D +  L +LFKVRGIP L  +  +G+ L
Sbjct  75   FEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRGIPSLAMLDESGKVL  134

Query  513  TTEARNLVMSHGADAYPFT  457
            ++E   ++  +G + YPFT
Sbjct  135  SSEGVEIIKDYGVEGYPFT  153


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D +  SF   F  MPWLA+P+ D     L+R F++  +P LV IG 
Sbjct  222  RAKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCKKLARYFELSALPTLVVIGP  281

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  282  DGKTLHSNVAEAIQEHGIQAYPFT  305



>gb|KDP26595.1| hypothetical protein JCGZ_17753 [Jatropha curcas]
Length=572

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 123/185 (66%), Positives = 155/185 (84%), Gaps = 2/185 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQ+S+D+FFS MPWLA+P+GD+RK SLSR FKV+GIPMLVA+G 
Sbjct  389  KAKDNAFEVIFISSDSDQASYDDFFSTMPWLALPFGDERKASLSRKFKVQGIPMLVALGP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T EAR+L+  HGADAYPFT+E LKE+EA+YEEMAKGWPE++ H LHEEHEL+L R
Sbjct  449  TGRTITKEARSLITIHGADAYPFTDEHLKEIEAKYEEMAKGWPERVKHVLHEEHELVLAR  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGC+  G  WS+YC++CD+DLHPKCAL  ++   T+E+  +D+ + KEGW+C+G
Sbjct  509  RMVYNCDGCDGEGNIWSYYCEECDYDLHPKCAL--EESTKTKEDENEDEPEPKEGWICEG  566

Query  168  EVCKK  154
             VC K
Sbjct  567  GVCFK  571


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FIS+D D  SF ++FSKMPWLAIP+ + + +  L +LFK++GIP LV I   G+  
Sbjct  74   FEIVFISADEDDESFKKYFSKMPWLAIPFSESETRDRLDQLFKIQGIPHLVIIDENGKVS  133

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G +AYPFT
Sbjct  134  SESGVEIIREYGVEAYPFT  152


 Score = 76.6 bits (187),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+FIS D D+ +F +    MPWL++P+ D     L R F++  +P LV IG 
Sbjct  229  KEKGENFEVVFISLDDDEETFQQSLGGMPWLSLPFKDKCCEKLVRYFELSTVPTLVVIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  289  DGKTLHSNVAEAIEEHGVQAYPFT  312



>ref|XP_008792848.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Phoenix 
dactylifera]
Length=589

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 151/196 (77%), Gaps = 10/196 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFEVIF+SSD+DQSSFD+FFS MPWLA+P+GD+RK  LSR FK+ GIP LVAIG 
Sbjct  394  KEKDSAFEVIFVSSDQDQSSFDDFFSSMPWLALPFGDERKKXLSRTFKIYGIPSLVAIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR LVM HGADAYPFTEERLK+LEAE EEMAKGWPEK+ H LHEEHEL+ TR
Sbjct  454  TGKTITKEARELVMVHGADAYPFTEERLKQLEAESEEMAKGWPEKVKHELHEEHELVKTR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteee----------sqkddE  199
            R  Y CD C E G+GWSF+C++CDFDLHPKCALEE++++   +                E
Sbjct  514  RLGYICDRCKEEGKGWSFFCEECDFDLHPKCALEEEEDKKMNDIDEGGLLGEDPQDSQGE  573

Query  198  KTKEGWVCDGEVCKKA  151
              KEG+VC+G VC KA
Sbjct  574  GGKEGYVCEGGVCYKA  589


 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIFIS D D+ SF+ +FS+MPWLAIP+ D + +  L+ LF V GIP LV + ++G+ L
Sbjct  79   FEVIFISGDEDEESFNNYFSEMPWLAIPFSDSETRDRLNELFDVSGIPHLVVLDKSGKVL  138

Query  513  TTEARNLVMSHGADAYPFT  457
            T EA   V  +G++ YPFT
Sbjct  139  TDEAVRAVRDYGSEGYPFT  157


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FEV+ +S D + SSF++ F+ MPWLAIP  D     L+R F++  IP LV IG 
Sbjct  234  KEKGESFEVVLVSLDDEDSSFEQSFASMPWLAIPINDKSSEKLARYFELETIPTLVVIGS  293

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  LV  +G +AYPF+
Sbjct  294  DGKTLNANAAELVEDYGVEAYPFS  317



>emb|CAN63033.1| hypothetical protein VITISV_044051 [Vitis vinifera]
Length=570

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 140/186 (75%), Gaps = 5/186 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSDRDQ+SFDEFFS MPW A+P+GD RK SL R FKVR IP L+A+  
Sbjct  390  KAKDEAFEVIFISSDRDQASFDEFFSGMPWXALPFGDKRKASLGRTFKVRSIPKLIAVEP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEAR LVM HGADAYPFT E   +      EMAKGWPEKM HALHEEHEL+LT+
Sbjct  450  TGRTVTTEARTLVMIHGADAYPFT-EEHIKEIEAQYEMAKGWPEKMKHALHEEHELVLTK  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C+GC + G  WSFYC++CDF+LHPKCAL    EE    +  ++  +  EGW CDG
Sbjct  509  RGIYRCNGCEKQGHLWSFYCEECDFNLHPKCAL----EEDKGSKEDEEKARPGEGWKCDG  564

Query  168  EVCKKA  151
            EVC +A
Sbjct  565  EVCSRA  570


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IF+S D+    F+E+FSKMPWLAIP+ D D +  L +LFKVRGIP L  +  +G+ L
Sbjct  75   FEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRGIPSLAMLDESGKVL  134

Query  513  TTEARNLVMSHGADAYPFT  457
            ++E   ++  +G + YPFT
Sbjct  135  SSEGVEIIKDYGVEGYPFT  153


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D +  SF   F  MPWLA+P+ D     L+R F++  +P LV IG 
Sbjct  230  RAKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCKKLARYFELSALPTLVVIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFT  313



>gb|KHN26883.1| Putative nucleoredoxin 1 [Glycine soja]
Length=570

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 146/186 (78%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K +A EV+FISSDRDQ+SFDEFF+ MPWLA+P+GD RK  LSR FKV GIPMLVAI  
Sbjct  388  KEKGNALEVVFISSDRDQTSFDEFFAGMPWLALPFGDSRKKFLSRKFKVSGIPMLVAIAS  447

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+TLTT+AR+LV  +GADAYPFTEER+KE+E E EE AKGWPEK+      EHEL+LTR
Sbjct  448  SGQTLTTKARDLVSLYGADAYPFTEERIKEIETEQEETAKGWPEKLK-HELHEHELVLTR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CD CNE G  WS+YC DCDFDLHPKCAL  +KE+    +    +EK+K+ WVCDG
Sbjct  507  RRVYYCDACNEEGHIWSYYCGDCDFDLHPKCAL--EKEDKEGSKDDAKEEKSKDEWVCDG  564

Query  168  EVCKKA  151
            EVCKKA
Sbjct  565  EVCKKA  570


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            AK   F+++FI++D D  SF+ +FSKMPWLAIP+ D D +  L  LF VRGIP L  +  
Sbjct  68   AKKGDFQIVFITADEDDESFNGYFSKMPWLAIPFSDSDTRSRLDELFHVRGIPHLALLDE  127

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G  +T +  +++  +G + YPFT
Sbjct  128  AGNVVTEDGVDVIREYGVEGYPFT  151


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+ + FEV+ I  D D+ SF E    +PWL++P+ D   G L+R F++  +P LV IG 
Sbjct  228  KAQGENFEVVLIPLDDDEESFKELLESVPWLSLPFKDKICGKLARYFELSTLPTLVIIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  288  DGKTLHSNVAEAIEDHGVAAYPFT  311



>ref|XP_010937316.1| PREDICTED: probable nucleoredoxin 1-1 [Elaeis guineensis]
Length=614

 Score =   207 bits (527),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 154/186 (83%), Gaps = 1/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFE++F+SSDRDQ+SF++FFS MPWLA+P+GD+RK +LSRLFK+RGIP LVAIG 
Sbjct  430  KEKDSAFELVFVSSDRDQNSFEDFFSGMPWLALPFGDERKKTLSRLFKIRGIPSLVAIGP  489

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+TT+AR+L+M HGADAYPFTEER+KELE + EEMAKGWPEK+ H LHEEHEL+LTR
Sbjct  490  TGKTVTTDARHLLMIHGADAYPFTEERIKELEDQIEEMAKGWPEKLKHELHEEHELVLTR  549

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y CDGCN  G  WS+ C +C+FDLHP+CAL  +  E   EE  ++  KTKEG+VCDG
Sbjct  550  CGEYGCDGCNGLGGKWSYRCTECNFDLHPRCAL-VENREKGGEEHSEEQGKTKEGYVCDG  608

Query  168  EVCKKA  151
            +VC+KA
Sbjct  609  DVCRKA  614


 Score = 89.4 bits (220),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S DRD+ SF+ +FSKMPWLAIP+ D + +  L  LFKVRGIP LV +G  G  L
Sbjct  112  FEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDRLDELFKVRGIPHLVILGARGEVL  171

Query  513  TTEARNLVMSHGADAYPFT  457
              +    V  +G++ YPFT
Sbjct  172  NEKGVPAVREYGSEGYPFT  190


 Score = 77.0 bits (188),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + ++FEV+ +S D ++SSF   F+ MPWLAIP+ D   G L R F++R +P LV +G 
Sbjct  267  KERGESFEVVMVSLDDEESSFKGGFATMPWLAIPFQDKSCGKLVRYFELRTVPTLVVLGA  326

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL +    +V  HG +A   +PF+
Sbjct  327  DGKTLHSNIAEVVEEHGEEAWEGFPFS  353



>ref|XP_006365240.1| PREDICTED: probable nucleoredoxin 1-like [Solanum tuberosum]
Length=607

 Score =   207 bits (526),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 123/190 (65%), Positives = 152/190 (80%), Gaps = 6/190 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK+   EVIFISSDRDQ+SFD++F+ MPWLA+P+GD+RK  LSRLFKVRGIP LVA+G 
Sbjct  418  KAKNGPLEVIFISSDRDQASFDDYFASMPWLALPFGDERKTYLSRLFKVRGIPTLVAVGP  477

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T+TT ARNL+MSHGA A+PFTEER+KE+EAE  EMAKGWPEK+      EHELLL++
Sbjct  478  SGKTVTTGARNLIMSHGAKAFPFTEERMKEIEAETAEMAKGWPEKI-MHKLHEHELLLSK  536

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqk-----ddEKTKEG  184
            R  Y CD C+E GQ WSFYC++CDFD+HPKCALEEKKE   + E  +     +++K  EG
Sbjct  537  RSAYNCDVCDEAGQIWSFYCEECDFDMHPKCALEEKKESNMDTEEDQKDQGKEEQKANEG  596

Query  183  WVCDGEVCKK  154
            W+CDGEVC K
Sbjct  597  WICDGEVCFK  606


 Score = 90.9 bits (224),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+++D+D  SF E+FSKMPWLA+P+ D + +  L+ LF VRGIP LV +  +G+ +
Sbjct  101  FEVVFLTADKDDESFKEYFSKMPWLAVPFSDSETRKRLNELFAVRGIPHLVILDASGKVV  160

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +++ HG + YPFT
Sbjct  161  TNSGVEIIVEHGVEGYPFT  179


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQS--SFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAI  535
            KA++  FE++ I  D +    SF + FS+MPW ++P  D     L+R F++  +P LV I
Sbjct  256  KAQEGNFEIVMIPLDDEDEDESFKKEFSRMPWFSLPLKDKTCEKLARYFELSTLPTLVII  315

Query  534  GRTGRTLTTEARNLVMSHGADAYPFT  457
            G  G+TL +     V  HG  AYPFT
Sbjct  316  GTDGKTLHSNVAEAVEEHGILAYPFT  341



>ref|XP_003631262.2| PREDICTED: uncharacterized protein LOC100852797 [Vitis vinifera]
Length=1163

 Score =   211 bits (536),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 152/186 (82%), Gaps = 2/186 (1%)
 Frame = -3

Query  708   KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
             KAKD+AFEVIFISSDRDQ+SFDEFFS MPWLA+P+GD RK SL R FKVR IP L+A+  
Sbjct  980   KAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDKRKASLGRTFKVRSIPKLIAVEP  1039

Query  528   TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             TGRT+TTEARNLVM HGADAYPFT+E +KE+EA YEEMAKGWP K+ HALHE+HEL+LT+
Sbjct  1040  TGRTVTTEARNLVMIHGADAYPFTDEHIKEIEARYEEMAKGWPAKVKHALHEQHELVLTK  1099

Query  348   RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
              + Y C+GC + G  WSFYC +CDFDLHPKCAL   +++  +++++ +  K  EGW CDG
Sbjct  1100  HRMYRCNGCEKEGHLWSFYCAECDFDLHPKCAL--DEDKGIKDDNKLEKAKPGEGWKCDG  1157

Query  168   EVCKKA  151
             EVC +A
Sbjct  1158  EVCSRA  1163


 Score =   210 bits (534),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 149/186 (80%), Gaps = 4/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD  FEVIFISSDRDQ+SFD+FFS+MPWLA+P+GD+RK SLS++FKV+GIP +VAIG 
Sbjct  389  KAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDERKESLSKMFKVQGIPKVVAIGP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TT+AR+LV  HGADAYPFT +   +      EMAKGWP+K++HALHEEHEL LT+
Sbjct  449  TGRTITTQARDLVADHGADAYPFT-DERLQEIEAQYEMAKGWPDKLSHALHEEHELALTQ  507

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CDGC+E G  W+F C++CDFDLHPKCAL   ++    E+   D+EK +EGW+CDG
Sbjct  508  HQIYKCDGCDEEGHAWAFSCEECDFDLHPKCAL---EDGKGTEDDAMDEEKPEEGWICDG  564

Query  168  EVCKKA  151
            +VC KA
Sbjct  565  KVCFKA  570


 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D ++ SF ++F  MPW A+P+ D   G L+R FK+R +P LV IG+
Sbjct  820  RAKGESFEIVMISLDDEEQSFKKYFESMPWFALPFNDKSCGKLARYFKLRVLPTLVVIGQ  879

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  880  DGKTLHSNVAEAIEQHGIQAYPFT  903


 Score = 87.0 bits (214),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IF+S D+    F+E+FSKMPWLAIP+ D D +  L +LFK+RGIP L  +  +G+ L
Sbjct  665  FEIIFVSLDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKMRGIPSLAMLDESGKVL  724

Query  513  TTEARNLVMSHGADAYPFT  457
            ++E   ++  +G + YPFT
Sbjct  725  SSEGVEIIKDYGVEGYPFT  743


 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+ F+S+D D   F E+FS+MPWLAIP+ D D +  L  LF+V GIP LV IG  G+ L
Sbjct  74   FEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPHLVIIGENGKVL  133

Query  513  TTEARNLVMSHGADAYPFT  457
            T     ++  +G + +PFT
Sbjct  134  TDSGVEIIREYGVEGFPFT  152


 Score = 73.6 bits (179),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FE++ IS D D+ SF+E F  MP  A+P+ D+    L+R F++  +P LV IG 
Sbjct  229  KAMGESFEIVLISFDDDEESFNEGFGSMPCFALPFKDESCRKLARYFELSTVPTLVMIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  +G  AYPFT
Sbjct  289  DGKTLHSNVVEAIEEYGIQAYPFT  312



>ref|XP_003532006.1| PREDICTED: probable nucleoredoxin 1-like isoform X1 [Glycine 
max]
Length=570

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 146/186 (78%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K +A EV+FISSDRDQ+SFDEFF+ MPWLA+P+GD RK  LSR F+V GIPMLVAI  
Sbjct  388  KEKGNALEVVFISSDRDQTSFDEFFAGMPWLALPFGDSRKKFLSRKFRVSGIPMLVAIAS  447

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+TLTT+AR+LV  +GADAYPFTEER+KE+E E EE AKGWPEK+      EHEL+LTR
Sbjct  448  SGQTLTTKARDLVSLYGADAYPFTEERIKEIETEQEETAKGWPEKLK-HELHEHELVLTR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CD CNE G  WS+YC DCDFDLHPKCAL  +KE+    +    +EK+K+ WVCDG
Sbjct  507  RRVYYCDACNEEGHIWSYYCGDCDFDLHPKCAL--EKEDKEGSKDDAKEEKSKDEWVCDG  564

Query  168  EVCKKA  151
            EVCKKA
Sbjct  565  EVCKKA  570


 Score = 84.0 bits (206),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            AK   F+++FI++D D  SF+ +FSKMPWLAIP+ D D +  L  LF VRGIP L  +  
Sbjct  68   AKKGDFQIVFITADEDDESFNGYFSKMPWLAIPFSDSDTRSRLDELFHVRGIPHLALLDE  127

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G  +T +  +++  +G + YPFT
Sbjct  128  AGNVVTEDGVDVIREYGVEGYPFT  151


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+ + FEV+ I  D D+ SF E    +PWL++P+ D   G L+R F++  +P LV IG 
Sbjct  228  KAQGENFEVVLIPLDDDEESFKELLESVPWLSLPFKDKICGKLARYFELSTLPTLVIIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  288  DGKTLHSNVAEAIEDHGVAAYPFT  311



>emb|CDY24527.1| BnaA01g22310D [Brassica napus]
Length=578

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKTSLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV +HGADAYPFTEER+KE+EA+Y EMAK WPEK+ H LHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVGAHGADAYPFTEERVKEIEAKYTEMAKEWPEKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y CD C+E GQ WS++CD+CDFDLH KCAL+E      ++  ++   ++++GWVCDG
Sbjct  513  VPVYICDKCDEEGQIWSYHCDECDFDLHAKCALKEDANINGDDAVKEGGGESQDGWVCDG  572

Query  168  EVCKKA  151
             VC K+
Sbjct  573  NVCTKS  578


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D D+ SF ++FSKMPWLA+P+ D + +  L  +FKVRGIP LV I   G+ +
Sbjct  78   FEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLVMIDDEGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGVGVIRSYGADAYPFT  156


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  ++ FE++ IS + D+ +F + F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENNEDFEIVLISLEDDEEAFKQDFETNPWLALPFNDKSSSKLTRHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T  +     +  +G  AYPFT
Sbjct  293  DGKTRHSNVAEAIDDYGVVAYPFT  316



>ref|XP_010917444.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Elaeis 
guineensis]
Length=592

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 128/194 (66%), Positives = 151/194 (78%), Gaps = 8/194 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFEVIF+SSD+DQSSFD+FFS MPWLA+P+GD+RK SLSR FK+ GIP LVAIG 
Sbjct  399  KEKDSAFEVIFVSSDQDQSSFDDFFSGMPWLALPFGDERKNSLSRTFKIYGIPSLVAIGP  458

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR LVM HGADAYPFTEER+KEL+AE EEMAKGWPEK+ H LHEEHEL+ T 
Sbjct  459  TGKTITKEARELVMDHGADAYPFTEERIKELKAESEEMAKGWPEKVKHELHEEHELVKTH  518

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteee--------sqkddEKT  193
            R+ Y CD C + G+GWSFYC++CDFDLHPKCALEE K+    +E          +  E  
Sbjct  519  RRGYFCDRCGKEGKGWSFYCEECDFDLHPKCALEEDKKMDDVDEGGLPGEDPQDRQGEAG  578

Query  192  KEGWVCDGEVCKKA  151
            KEG+VC+G VC K 
Sbjct  579  KEGYVCEGGVCYKV  592


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 58/79 (73%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIFISSD D+ SF+ +FS+MPWLAIP+ D + +  L+ LF V GIP LV + ++G+ L
Sbjct  79   FEVIFISSDEDEESFNNYFSEMPWLAIPFSDSETRDHLNELFDVSGIPHLVILDKSGKVL  138

Query  513  TTEARNLVMSHGADAYPFT  457
            T EA  +V  +G++ YPFT
Sbjct  139  TDEAVQVVRDYGSEGYPFT  157


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FEV+ +S D D+SSF++ F+ MPWLAIP  D     L+R F++  IP LV IG 
Sbjct  239  KEKGESFEVVLVSLDDDESSFEQSFASMPWLAIPVKDKSSEKLARYFELETIPTLVVIGS  298

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+ L   A  LV  +G +AYPF+
Sbjct  299  DGKILNANAAELVEEYGVEAYPFS  322



>ref|XP_009103743.1| PREDICTED: probable nucleoredoxin 1 [Brassica rapa]
Length=578

 Score =   204 bits (519),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKTSLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV +HGADAYPFTEER+KE+EA+Y EMAK WPEK+ H LHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVGAHGADAYPFTEERVKEIEAKYNEMAKEWPEKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y CD C+E GQ WS++CD+CDFDLH KCAL+E      ++  ++   ++++GWVCDG
Sbjct  513  VPVYICDKCDEEGQIWSYHCDECDFDLHAKCALKEDANINGDDAVKEGGGESQDGWVCDG  572

Query  168  EVCKKA  151
             VC K+
Sbjct  573  NVCTKS  578


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D D+ SF ++FSKMPWLA+P+ D + +  L  +FKVRGIP LV I   G+ +
Sbjct  78   FEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLVMIDDEGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGVGVIRSYGADAYPFT  156


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  ++ FE++ IS + D+ +F + F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENNEDFEIVLISLEDDEEAFKQDFETNPWLALPFNDKSSSKLTRHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T  +     +  +G  AYPFT
Sbjct  293  DGKTRHSNVAEAIDDYGVVAYPFT  316



>ref|XP_006392168.1| hypothetical protein EUTSA_v10023374mg [Eutrema salsugineum]
 gb|ESQ29454.1| hypothetical protein EUTSA_v10023374mg [Eutrema salsugineum]
Length=579

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKTSLARTFKVGGIPMLAAVGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T+T EAR+LV +HGADAYPFTEERLKE+EA+Y  MAK WP K+ HALHE+HEL LTR
Sbjct  453  SGKTVTKEARDLVGAHGADAYPFTEERLKEIEAKYNGMAKEWPTKVKHALHEDHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CD CNE G+ WS++C++CDFDLH KCAL+E+     ++  +++  ++K+GWVCDG
Sbjct  513  VQVYMCDKCNEEGKIWSYHCEECDFDLHAKCALKEEANTTGDDAVKENGGESKDGWVCDG  572

Query  168  EVCKKA  151
             VC KA
Sbjct  573  NVCTKA  578


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S D D+ SF ++F+KMPWLA+P+ D + +  L +LFKV+GIP LV +   G  L
Sbjct  78   FEVIFVSGDEDEESFRDYFTKMPWLAVPFTDSETRDRLDQLFKVKGIPYLVMVDDHGNLL  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGIGVIRSYGADAYPFT  156


 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 44/84 (52%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS + D+ SF + F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENGEDFEIVLISLEDDEESFKQDFETKPWLALPFNDKSSSKLARHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+   +     +  +G  AYPF 
Sbjct  293  DGKIRHSNVAEAIDDYGVLAYPFA  316



>emb|CCD74518.1| putative nucleoredoxin 1 [Arabidopsis halleri subsp. halleri]
Length=578

 Score =   204 bits (518),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFIS+DRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KERDEAFELIFISNDRDQESFDEYYSQMPWLALPFGDSRKTSLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV++HGA+AYPFTEERLKE+EA+Y++MAK WP+K+ H LHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVVAHGAEAYPFTEERLKEIEAKYDDMAKEWPKKVKHVLHEEHELQLTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q YTCD C E G  WS++CD+CDFDLH KCAL+E  +   +E  ++ D ++ +GWVCDG
Sbjct  513  VQVYTCDKCEEEGTIWSYHCDECDFDLHAKCALKEDTKANGDEAVKEGDSESTDGWVCDG  572

Query  168  EVCKKA  151
             VC KA
Sbjct  573  NVCTKA  578


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S D D+ SF ++FSKMPWLA+P+ D + +  L  LFKVRGIP LV +   G+ +
Sbjct  78   FEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSESRDRLDELFKVRGIPNLVMVDDHGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGVGVIRSYGADAYPFT  156


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS D D+ SF++ F   PWL++ + D     L+R F +  +P LV +G 
Sbjct  233  KENKEDFEIVLISLDDDEESFNQEFKTKPWLSLLFNDKSASKLARHFMLATVPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T  +     +  +G  AYPFT
Sbjct  293  DGKTRHSNVAEAIDDYGVLAYPFT  316



>ref|XP_008389658.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=579

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/186 (67%), Positives = 153/186 (82%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFE IFISSDRDQ+SFD+FF+KMPWLA+P+GD+RK  LSR F+V+GIPMLVA+G 
Sbjct  396  KAKDDAFETIFISSDRDQTSFDDFFAKMPWLALPFGDERKVPLSRRFRVQGIPMLVALGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EARNLV  HGA+AYPFTEERLKE+E EYEEMAKGWPEK+  A HE+HEL+LTR
Sbjct  456  TGKTVTKEARNLVTLHGANAYPFTEERLKEMEVEYEEMAKGWPEKLKSARHEKHELVLTR  515

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  +TCD C++ G  WSFYC +C+F+LHPKCALE  KE   + + ++++ K     VCDG
Sbjct  516  RTGFTCDKCDKSGLVWSFYCKECNFNLHPKCALEADKETENDAKQEEEEAKEGG--VCDG  573

Query  168  EVCKKA  151
            +VC KA
Sbjct  574  DVCTKA  579


 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IFIS+D D  SF+ +FSKMPWLAIP+ D D + S+  LFKVRGIP LV +G  G+ L
Sbjct  81   FEIIFISADEDDESFNGYFSKMPWLAIPFSDSDARDSVDGLFKVRGIPHLVILGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            + +   ++  +G D+YPFT
Sbjct  141  SDDGVEILQEYGVDSYPFT  159


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ +  D D+ SF + F KMPW ++P GD     L+R F++  +P LV IG 
Sbjct  236  KGNGENFEIVLLPLDDDEKSFKKHFEKMPWFSLPNGDKNVEKLARYFELSTLPTLVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL+    + +  HG+ AYPFT
Sbjct  296  DGKTLSKNVTDAIDEHGSLAYPFT  319



>ref|NP_564756.1| protein reduce transmission through pollen [Arabidopsis thaliana]
 sp|O80763.1|NRX1_ARATH RecName: Full=Probable nucleoredoxin 1; Short=AtNrx1 [Arabidopsis 
thaliana]
 gb|AAC24068.1| Similar to red-1 (related to thioredoxin) gene gb|X92750 from 
Mus musculus. ESTs gb|AA712687 and gb|Z37223 come from this 
gene [Arabidopsis thaliana]
 gb|AAL38874.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51306.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33684.1| protein reduce transmission through pollen [Arabidopsis thaliana]
Length=578

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 153/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +++AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL++ FKV GIPML A+G 
Sbjct  393  KERNEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKASLAKTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV++HGADAYPFTEERLKE+EA+Y+E+AK WP+K+ H LHEEHEL LTR
Sbjct  453  TGQTVTKEARDLVVAHGADAYPFTEERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q YTCD C E G  WS++CD+CDFDLH KCAL E  +E  +E  +   +++K+GWVC+G
Sbjct  513  VQVYTCDKCEEEGTIWSYHCDECDFDLHAKCALNEDTKENGDEAVKVGGDESKDGWVCEG  572

Query  168  EVCKKA  151
             VC KA
Sbjct  573  NVCTKA  578


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S D D+ SF ++F KMPWLA+P+ D + +  L  LFKVRGIP LV +   G+ +
Sbjct  78   FEIVFVSGDEDEESFGDYFRKMPWLAVPFTDSETRDRLDELFKVRGIPNLVMVDDHGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGVGVIRSYGADAYPFT  156


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS + D+ SF++ F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENKEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDKSGSKLARHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T  +     +  +G  AYPFT
Sbjct  293  DGKTRHSNVAEAIDDYGVLAYPFT  316



>gb|AGV54528.1| nucleoredoxin 1-like protein [Phaseolus vulgaris]
Length=571

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 148/186 (80%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK +A EV+FISSD+DQ+SFDEFF  MPWLA+P+GD RK  LSR FKV GIP LVAIG 
Sbjct  388  KAKGNALEVVFISSDKDQASFDEFFGGMPWLALPFGDSRKKFLSRKFKVTGIPKLVAIGS  447

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T TTEAR+LV+ +GA AYPFTEE+++++EAE EE AKGWPEK+      EHEL+LTR
Sbjct  448  SGQTSTTEARDLVLQYGARAYPFTEEKIQDIEAEEEETAKGWPEKVT-HETHEHELVLTR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGCNE G  WS+YC +CDFDLHPKC L E+ +   ++   K+++K+K+GWVC+G
Sbjct  507  RKVYYCDGCNEQGYAWSYYCGECDFDLHPKCVL-EEDKGSKDDTDVKEEDKSKDGWVCEG  565

Query  168  EVCKKA  151
            EVCKK 
Sbjct  566  EVCKKV  571


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F S+D D+ SF  +FSKMPWLAIP+ D + +  L  LF VRGIP LV +  TG+ +
Sbjct  73   FEVVFASADEDEESFKGYFSKMPWLAIPFSDSETRSRLDELFHVRGIPHLVILEETGKVV  132

Query  513  TTEARNLVMSHGADAYPFT  457
            T +  ++V  +G DAYPFT
Sbjct  133  TEDGVDIVREYGVDAYPFT  151



>emb|CDY60573.1| BnaC01g43180D [Brassica napus]
Length=578

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKTSLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV +HGADAYPFTEER+KE+EA+Y EMAK WPEK+ HALHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVGAHGADAYPFTEERVKEIEAKYTEMAKEWPEKVKHALHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y CD C+E GQ WS++CD+CDFDLH KCAL+E      ++  ++   + ++GWVCDG
Sbjct  513  VPVYICDKCDEEGQIWSYHCDECDFDLHAKCALKEDANINGDDAVKEGGGEPQDGWVCDG  572

Query  168  EVCKKA  151
             VC K+
Sbjct  573  NVCTKS  578


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D D+ SF ++FSKMPWLA+P+ D + +  L  +FKVRGIP LV I   G+ +
Sbjct  78   FEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLVMIDDEGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGVGVIRSYGADAYPFT  156


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  ++ FE++ IS + D+ +F + F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENNEDFEIVLISLEDDEDAFKQDFDTNPWLALPFNDKSSSKLTRHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T  +     +  +G  AYPFT
Sbjct  293  DGKTRHSNVAEAIDDYGVVAYPFT  316



>ref|XP_002314533.2| hypothetical protein POPTR_0010s06960g [Populus trichocarpa]
 gb|EEF00704.2| hypothetical protein POPTR_0010s06960g [Populus trichocarpa]
Length=564

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSDRDQS+FDEF+S+MPWLA+P+GD RK  LSR FK++GIP  VAIG 
Sbjct  387  KRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDGRKQILSRKFKIQGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEGWVCDG
Sbjct  507  RSAYGCDGCGETGYRWSFYCKQCDFDLHPKCAL--------KEDEDTGTEKGKEGWVCDG  558

Query  168  EVCKKA  151
            +VC++A
Sbjct  559  DVCRRA  564


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D ++  F E F  MPWLA+P+ D     L R F++R IP LV IG+
Sbjct  227  KEKGENFEVVLISLDDEEEDFKESFETMPWLALPFKDKSCEKLVRYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPYVAELIEEHGIEAYPFT  310


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSD D  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFKVRGIPRLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
            +      V  HG D YPF 
Sbjct  132  SDNGVRHVKEHGVDGYPFN  150



>ref|XP_004156196.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 gb|KGN52626.1| hypothetical protein Csa_5G647480 [Cucumis sativus]
Length=561

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (78%), Gaps = 10/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD  FEVIFISSD DQ SF+EFFS MPWLA+P+GD+RK  L+R FK++GIP LVA+ R
Sbjct  386  KQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDERKKFLNRRFKIQGIPTLVALNR  445

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G T++T+AR L+ SHGADAYPFTEERLK+LEA+ EE AKGWPEK+NH LHEEHEL+ T 
Sbjct  446  SGCTVSTDARKLIQSHGADAYPFTEERLKQLEAQLEEEAKGWPEKLNHELHEEHELVRTH  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            +  Y+CDGC+E G GWSFYC++CDF LHP CA+          ++    E+ KEGW+C+G
Sbjct  506  QAEYSCDGCDEMGYGWSFYCEECDFSLHPNCAM----------KNDDGAEEQKEGWICEG  555

Query  168  EVCKKA  151
            +VC++ 
Sbjct  556  DVCRRV  561


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSD D+ SF ++FSKMPWLAIP+ D D    L+ LFKVRGIP LV +   G+ L
Sbjct  71   FEVVFVSSDNDEESFKDYFSKMPWLAIPFSDSDTNQRLNELFKVRGIPHLVVLDANGKVL  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   LV  +G +AYPFT
Sbjct  131  TNDGVRLVSEYGVNAYPFT  149


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ +S D +   F+E    +P LA+P+ D++   L R F++  IP L+ IG+
Sbjct  226  KEKGNNFEIVLLSLDDEADDFNEALETLPCLALPFQDEKCKKLIRYFELSDIPTLIIIGQ  285

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  L+  HG DAYPFT
Sbjct  286  DGKTLHPNAVELIEEHGPDAYPFT  309



>ref|XP_010417977.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=578

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKESLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV  HGADAYPFTEERLKE+EA+Y+EMAK WP+K+ H LHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVAIHGADAYPFTEERLKEIEAKYDEMAKEWPKKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CD C+E G+ WS++CD+CDFDLH KCALEE+ +   +E  +    + ++GWVCDG
Sbjct  513  VQVYVCDKCDEQGKFWSYHCDECDFDLHDKCALEEETKANGDEVVKGGGSEHQDGWVCDG  572

Query  168  EVCKKA  151
             VC KA
Sbjct  573  NVCTKA  578


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D D+ SF ++FSKMPWLA+P+ D + +  L  LFKV GIP LV +   G+ +
Sbjct  78   FEVVFVSGDEDEESFGDYFSKMPWLAVPFADSETRDRLDGLFKVTGIPNLVIVDDHGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GA AYPFT
Sbjct  138  NNNGVGVIRSYGAGAYPFT  156


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS + D+ SF++ F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENKEDFEIVLISLEDDEESFNQDFKSKPWLALPFNDKSSSKLARHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T        +  +G  AYPFT
Sbjct  293  DGKTRHLNVAEAIDDYGLLAYPFT  316



>ref|XP_004141532.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
Length=557

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 145/186 (78%), Gaps = 10/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD  FEVIFISSD DQ SF+EFFS MPWLA+P+GD+RK  L+R FK++GIP LVA+ R
Sbjct  382  KQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDERKKFLNRRFKIQGIPTLVALNR  441

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G T++T+AR L+ SHGADAYPFTEERLK+LEA+ EE AKGWPEK+NH LHEEHEL+ T 
Sbjct  442  SGCTVSTDARKLIQSHGADAYPFTEERLKQLEAQLEEEAKGWPEKLNHELHEEHELVRTH  501

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            +  Y+CDGC+E G GWSFYC++CDF LHP CA+          ++    E+ KEGW+C+G
Sbjct  502  QAEYSCDGCDEMGYGWSFYCEECDFSLHPNCAM----------KNDDGAEEQKEGWICEG  551

Query  168  EVCKKA  151
            +VC++ 
Sbjct  552  DVCRRV  557


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSD D+ SF ++FSKMPWLAIP+ D D    L+ LFKVRGIP LV +   G+ L
Sbjct  71   FEVVFVSSDNDEESFKDYFSKMPWLAIPFSDSDTNQRLNELFKVRGIPHLVVLDANGKVL  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   LV  +G +AYPFT
Sbjct  131  TNDGVRLVSEYGVNAYPFT  149


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ +S D +   F+E    +P LA+P+ D++   L R F++  IP L+ IG+
Sbjct  222  KEKGNNFEIVLLSLDDEADDFNEALETLPCLALPFQDEKCKKLIRYFELSDIPTLIIIGQ  281

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  L+  HG DAYPFT
Sbjct  282  DGKTLHPNAVELIEEHGPDAYPFT  305



>ref|XP_010473222.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Camelina sativa]
 ref|XP_010473223.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Camelina sativa]
Length=578

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 121/186 (65%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKESLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV  HGADAYPFTEERLKE+EA+Y+EMAK WP+K+ H LHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVAIHGADAYPFTEERLKEIEAKYDEMAKEWPKKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CD C+E G+ WS++CD+CDFDLH KCALEE+ +   +E  ++   + ++GWVCDG
Sbjct  513  VQVYVCDKCDEQGKFWSYHCDECDFDLHDKCALEEETKPNGDEAVKEGGGEHQDGWVCDG  572

Query  168  EVCKKA  151
             VC KA
Sbjct  573  NVCTKA  578


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D DQ SF ++FSKMPWLA+P+ D + +  L  LFKV GIP LV +   G+ +
Sbjct  78   FEVVFVSGDEDQESFADYFSKMPWLAVPFADSETRDRLDGLFKVTGIPNLVMVDDHGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GA AYPFT
Sbjct  138  NGNGVGVIRSYGAGAYPFT  156


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS + D+ SF++ F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENKEDFEIVLISLEDDEESFNQDFKSKPWLALPFNDKSSSKLARHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T        +  +G  AYPFT
Sbjct  293  DGKTRHLNVAEAIDDYGLLAYPFT  316



>ref|XP_002888143.1| DC1 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64402.1| DC1 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=578

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKTSLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV++HGA+AYPFTEERLKE+EA+Y++MAK WP+K+ H LHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVVAHGAEAYPFTEERLKEIEAKYDDMAKEWPKKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q YTCD C E G  WS+ CD+C+FDLH KCAL+E  +   +E  ++   ++ +GWVCDG
Sbjct  513  VQVYTCDKCEEEGTIWSYQCDECNFDLHAKCALKEDTKADGDEAVKEGGSESTDGWVCDG  572

Query  168  EVCKKA  151
            +VC KA
Sbjct  573  DVCTKA  578


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S D D+ SF ++FSKMPWLA+P+ D + +  L  LFKVRGIP LV +   G+ +
Sbjct  78   FEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSETRDRLDELFKVRGIPNLVMVDDHGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGVGVIRSYGADAYPFT  156


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS + D+ SF++ F   PWL++P+ D     L+R F +  +P LV +G 
Sbjct  233  KENKEDFEIVLISLEDDEESFNQEFKTKPWLSLPFNDKSASKLARHFMLATLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T  +     +  +G  AYPFT
Sbjct  293  DGKTRHSNVAEAIDDYGVLAYPFT  316



>ref|XP_010510950.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=578

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 122/186 (66%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G 
Sbjct  393  KERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKESLARTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV  HGADAYPFTEERLKE+EA+Y+EMAK WP+K+ H LHEEHEL LTR
Sbjct  453  TGKTVTKEARDLVAIHGADAYPFTEERLKEIEAKYDEMAKEWPKKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CD C+E G+ WS++CD+CDFDLH KCALEE+ +   +E  +K   + ++GWVCDG
Sbjct  513  VQVYVCDKCDEEGKFWSYHCDECDFDLHYKCALEEETKPNGDEAVKKSGGEHQDGWVCDG  572

Query  168  EVCKKA  151
             VC KA
Sbjct  573  NVCTKA  578


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D D+ SF ++FSKMPWLA+P+ D + +  L  LFKV GIP LV +   G+ +
Sbjct  78   FEVVFVSGDEDEESFGDYFSKMPWLAVPFADSETRDRLDGLFKVTGIPNLVMVDDHGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NGNGVGVIRSYGADAYPFT  156


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS + D+ SF++ F   PWL +P+ D     L+R F +  +P LV +G 
Sbjct  233  KENKEDFEIVLISLEDDEESFNQDFKSKPWLGLPFNDKSSSKLARHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T        +  +G  AYPFT
Sbjct  293  DGKTRHLNVAEAIDDYGLLAYPFT  316



>gb|AAM64945.1| PDI-like protein [Arabidopsis thaliana]
Length=578

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +++AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL++ FKV GIPML A+G 
Sbjct  393  KERNEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKASLAKTFKVGGIPMLAALGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV++HGADAYPFTEERLKE+EA+Y+E+AK WP+K+ H LHEEHEL LTR
Sbjct  453  TGQTVTKEARDLVVAHGADAYPFTEERLKEIEAKYDEIAKDWPKKVKHVLHEEHELELTR  512

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q YTCD C E G  W ++CD+CDFDLH KCAL E  +E  +E  +   +++K+GWVC+G
Sbjct  513  VQVYTCDKCEEEGTIWCYHCDECDFDLHAKCALNEYTKENGDEAVKVGGDESKDGWVCEG  572

Query  168  EVCKKA  151
             VC KA
Sbjct  573  NVCTKA  578


 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S D D+ SF ++FSKMPWLA+P+ D + +  L  LFKVRGIP LV +   G+ +
Sbjct  78   FEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSETRDRLDELFKVRGIPNLVMVDDHGKLV  137

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  138  NENGVGVIRSYGADAYPFT  156


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ IS + D+ SF++ F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  233  KENKEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDKSGSKLARHFMLSTLPTLVILGP  292

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+   +     +  +G  AYPFT
Sbjct  293  DGKIRHSNVAEAIDDYGVLAYPFT  316



>gb|KFK40790.1| hypothetical protein AALP_AA2G041400 [Arabis alpina]
Length=572

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 118/186 (63%), Positives = 150/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFISSDRD  +F E++S+MPWLA+PYGD RK +LS+ FKV GIPML A+G 
Sbjct  387  KERDEAFELIFISSDRDPEAFSEYYSQMPWLALPYGDPRKSTLSQTFKVGGIPMLAALGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T EAR+LV++HGADAYPFTEERLKE+EA+Y EMAK WP+K+ HALHEEHEL LTR
Sbjct  447  TGRTVTKEARDLVLAHGADAYPFTEERLKEIEAKYNEMAKEWPKKVKHALHEEHELELTR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CD C E GQ WS++C +CDFDLH KCAL E+ +  ++  +++   ++ +GWVCDG
Sbjct  507  IQVYMCDKCEEEGQIWSYHCGECDFDLHAKCALNEETKATSDVAAKEGGGESNDGWVCDG  566

Query  168  EVCKKA  151
             VC KA
Sbjct  567  NVCTKA  572


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            A    FEV+F+S D D+ SF ++FSKMPWLA+P+ D + +  L  +FKVRGIP LV I  
Sbjct  67   APKAGFEVVFVSGDEDEESFTDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLVIIDD  126

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+         + S+GA+AYPFT
Sbjct  127  QGKLENENGVGNIRSYGAEAYPFT  150


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++ IS + D+ SF + F   PWLA+P+ D     L+R F +  +P LV +G  G+T  
Sbjct  233  FEIVLISLEDDEESFKQDFETKPWLALPFNDKSSSKLARHFMLSTLPTLVILGPDGKTRH  292

Query  510  TEARNLVMSHGADAYPFT  457
            +     +  HG  AYPFT
Sbjct  293  SNVAEAIEEHGIVAYPFT  310



>ref|XP_010023548.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Eucalyptus grandis]
 gb|KCW59850.1| hypothetical protein EUGRSUZ_H02590 [Eucalyptus grandis]
Length=573

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 132/153 (86%), Gaps = 0/153 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA DDAFEVIFISSD+DQ++FD++F++MPWLA+P+GD+RK  LSR FKV+GIPMLVAIG 
Sbjct  391  KATDDAFEVIFISSDKDQTAFDDYFAQMPWLALPFGDERKKFLSRRFKVKGIPMLVAIGP  450

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT++ +AR+L+M HGADAYPFT E LK+ E +++E  KGWPEK+ H LHE+HEL+  +
Sbjct  451  TGRTVSKKARDLIMDHGADAYPFTAEHLKKFEEKFKESIKGWPEKLKHPLHEKHELVPAQ  510

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
            R+ Y CDGC + G+GWS+YC++CDFDLHPKCA+
Sbjct  511  RRRYNCDGCGKAGEGWSYYCEECDFDLHPKCAV  543


 Score = 89.7 bits (221),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFIS+D+D+ SF  +FSKMPWLAIP+ D D++ SL  LFKVRGIP LV +  TG  L
Sbjct  76   LEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRGIPHLVILDGTGTVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +V  +G + +PFT
Sbjct  136  TDSGVAIVREYGVEGHPFT  154


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+ ++FE++ I  D D++SF++ F  MPWL++P+ D +   L R FK+  +P LV IG+
Sbjct  231  KARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKCEKLVRYFKLSTLPTLVIIGQ  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+       V  HG  AYPFT
Sbjct  291  DGKTVHANVAETVEEHGITAYPFT  314



>ref|XP_007153741.1| hypothetical protein PHAVU_003G061100g [Phaseolus vulgaris]
 gb|ESW25735.1| hypothetical protein PHAVU_003G061100g [Phaseolus vulgaris]
Length=571

 Score =   201 bits (511),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 147/186 (79%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K +A EV+FISSD+DQ+SFDEFF  MPWLA+P+GD RK  LSR FKV GIP LVAIG 
Sbjct  388  KEKGNALEVVFISSDKDQASFDEFFGGMPWLALPFGDSRKKFLSRKFKVTGIPKLVAIGS  447

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T TTEAR+LV+ +GA AYPFTEE+++++EAE EE AKGWPEK+      EHEL+LTR
Sbjct  448  SGQTSTTEARDLVLQYGARAYPFTEEKIQDIEAEEEETAKGWPEKVT-HETHEHELVLTR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGCNE G  WS+YC +CDFDLHPKC L E+ +   ++   K+++K+K+GWVC+G
Sbjct  507  RKVYYCDGCNEQGYAWSYYCGECDFDLHPKCVL-EEDKGSKDDTDVKEEDKSKDGWVCEG  565

Query  168  EVCKKA  151
            EVCKK 
Sbjct  566  EVCKKV  571


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F S+D D+ SF  +FS+MPWLAIP+ D + +  L  LF VRGIP LV +  TG+ +
Sbjct  73   FEVVFASADEDEESFKGYFSEMPWLAIPFSDSETRSRLDELFHVRGIPHLVILEETGKVV  132

Query  513  TTEARNLVMSHGADAYPFT  457
            T +  ++V  +G +AYPFT
Sbjct  133  TEDGVDIVREYGVEAYPFT  151


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FEV+ I  D D+ SF +    +PWL++P+ D   G L++ F++  +P LV IG 
Sbjct  228  KAKGENFEVVLIPLDEDEESFKKVLGSVPWLSLPFKDKFCGKLAQYFELSTLPTLVIIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL       +  HG DAYPFT
Sbjct  288  DGKTLNPNVAEAIEDHGVDAYPFT  311



>ref|XP_002314534.2| hypothetical protein POPTR_0010s07000g [Populus trichocarpa]
 gb|EEF00705.2| hypothetical protein POPTR_0010s07000g [Populus trichocarpa]
Length=564

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSDRDQS+FDEF+S+MPWLA+P+GD RK  LSR FK++GIP  VAIG 
Sbjct  387  KRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDGRKQILSRKFKIQGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEGW CDG
Sbjct  507  RKTYICDGCGETGNRWSFYCKQCDFDLHPKCAL--------KEDEDTGIEKGKEGWNCDG  558

Query  168  EVCKKA  151
            +VC++A
Sbjct  559  DVCRRA  564


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D ++  F E F  MPWLA+P+ D     L R F++R IP LV IG+
Sbjct  227  KEKRENFEVVLISLDDEEEDFKESFETMPWLALPFKDKSCEKLVRYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEEHGIEAYPFT  310


 Score = 80.9 bits (198),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSD D  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFKVRGIPRLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                   V  HG D YPF 
Sbjct  132  CDNGVRHVKEHGVDGYPFN  150



>ref|XP_010682546.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=566

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 140/186 (75%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFIS D+DQ SFDEFFS MPWLAIPY D R   LSRLFKV GIP LVAIG 
Sbjct  383  KAKDDAFEVIFISGDKDQISFDEFFSAMPWLAIPYDDQRTAYLSRLFKVFGIPKLVAIGP  442

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T++TEAR L+M HGA +YPFT ERLK +E+E EEM KGWPEK+NHALHE+HELLLTR
Sbjct  443  SGKTISTEARKLIMVHGAKSYPFTSERLKVVESELEEMTKGWPEKVNHALHEDHELLLTR  502

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGC+  GQ WSF C++CDFDLHPKCAL E        +  +    +  GW+C+ 
Sbjct  503  RNVYRCDGCDGDGQLWSFNCEECDFDLHPKCALAEADGTGNNLKDHET---SNAGWICND  559

Query  168  EVCKKA  151
              C +A
Sbjct  560  HECDRA  565


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FI++D D  SFD +FSKMPWLAIP+ D + +  L  +FKV G+P  V +  TG+ L
Sbjct  71   FEVVFITADDDDESFDNYFSKMPWLAIPFSDSETRDKLDDMFKVDGLPHFVILDETGKVL  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   ++  + A  YPFT
Sbjct  131  TDDGVAIIQDYEAQGYPFT  149


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FE++ I  D D+  F + F+ MPW ++P  D     L+R F +  +P LV +G 
Sbjct  223  KAKGENFEIVLIPLDEDEELFKQGFASMPWYSLPVKDKSCVKLARYFDLSTLPTLVIVGP  282

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             GRTL    R  +  HG +AYPFT
Sbjct  283  DGRTLHYNGREAIEDHGVEAYPFT  306



>ref|XP_011041579.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=282

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 135/186 (73%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  L R FK+ GIP  VAIG 
Sbjct  106  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILGRKFKIEGIPAAVAIGP  165

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFT E   +   E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  166  SGRTITKEARMHLTAYGADAFPFT-EEHLKQLEELEEKAKGWPEKVKHELHTEHELIRTK  224

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C GC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEGW+CD 
Sbjct  225  RVAYICHGCRETGHRWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGWICDT  276

Query  168  EVCKKA  151
            +VC++A
Sbjct  277  DVCRRA  282



>ref|XP_006302027.1| hypothetical protein CARUB_v10020010mg, partial [Capsella rubella]
 gb|EOA34925.1| hypothetical protein CARUB_v10020010mg, partial [Capsella rubella]
Length=602

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/186 (64%), Positives = 152/186 (82%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K +D+AFE+IFISSDRDQ SFDE++S+MPWLA+P+GD RK SL+R FKV GIPML A+G+
Sbjct  417  KERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDPRKESLARTFKVGGIPMLAALGQ  476

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EAR+LV++HGADAYPFTEERLKE+EA+Y+EMAK WP K+ H LHEEHEL L+R
Sbjct  477  TGKTVTKEARDLVVAHGADAYPFTEERLKEIEAKYDEMAKEWPTKVKHVLHEEHELELSR  536

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             Q Y CD C+E G  WS++CD+CDFDLH KCAL+E+ +   +E  ++     ++GWVCDG
Sbjct  537  IQVYVCDKCDEEGAIWSYHCDECDFDLHVKCALKEETKGNGDEAVKEGGGDPEDGWVCDG  596

Query  168  EVCKKA  151
             VC KA
Sbjct  597  NVCTKA  602


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDD-RKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S D D+ SF ++FSKMPWLA+P+ D   +  L   FKVRGIP LV +   G+ L
Sbjct  102  FEIVFVSGDEDEESFSDYFSKMPWLAVPFADSVTRDRLDGFFKVRGIPNLVMVDDHGKLL  161

Query  513  TTEARNLVMSHGADAYPFT  457
                  ++ S+GADAYPFT
Sbjct  162  NENGVGVIRSYGADAYPFT  180


 Score = 65.1 bits (157),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/84 (35%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + + FE++ IS + D+ SF++ F   PWLA+P+ D     L+R F +  +P LV +G 
Sbjct  257  KERTEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDKSSSKLARHFMLSTLPTLVILGP  316

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T        +  +G   YPFT
Sbjct  317  DGKTRHMNVAEAIDDYGILPYPFT  340



>ref|XP_004509957.1| PREDICTED: probable nucleoredoxin 1-like [Cicer arietinum]
Length=569

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 120/187 (64%), Positives = 146/187 (78%), Gaps = 6/187 (3%)
 Frame = -3

Query  708  KAKD-DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIG  532
            KA+D DA EVIFIS  RDQ+SFDEFF+ MPWLA+P+GD RK  LSR FKV GIP LVAIG
Sbjct  388  KAQDNDALEVIFISRYRDQASFDEFFAXMPWLALPFGDSRKEFLSRKFKVSGIPKLVAIG  447

Query  531  RTGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLT  352
              GRT+T EAR+LV  +GADAYPFTEER+KE+EA+ +++AKGWPEK+      EHEL LT
Sbjct  448  SNGRTVTKEARDLVALYGADAYPFTEERIKEIEAQNDDIAKGWPEKVT-HKTHEHELELT  506

Query  351  RRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
            RR+ Y CDGC+E G  WS+YC++CDFDLHPKCAL    E+    +  K++EKTKEGWVC+
Sbjct  507  RRRVYYCDGCSEEGHVWSYYCEECDFDLHPKCAL----EDKESIDHAKEEEKTKEGWVCE  562

Query  171  GEVCKKA  151
            G+VC K 
Sbjct  563  GDVCTKV  569


 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FI++D D  +F  +FSKMPWLAIP+ D D +  L  LF V GIP L  +  TG+ +
Sbjct  73   FEVVFITADEDDEAFKSYFSKMPWLAIPFSDSDTRNRLDELFHVNGIPHLALLDETGKVV  132

Query  513  TTEARNLVMSHGADAYPFT  457
              +  +++  +G +A+PFT
Sbjct  133  AEDGVDIIREYGPEAFPFT  151


 Score = 58.9 bits (141),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+ + FEV+ I  D ++ S ++    + WL++P  D     L + F++  +P LV IG 
Sbjct  228  KAEGENFEVVVIPLDDEEESLEKELESVHWLSLPIKDKTCAKLVQYFELSALPTLVIIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  ++  HG  AYPFT
Sbjct  288  NGKTLHPNAAEIIEDHGITAYPFT  311



>ref|XP_008459530.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
 gb|AAU04767.1| protein disulfide isomerase (PDI)-like protein 3 [Cucumis melo]
Length=561

 Score =   199 bits (507),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/186 (60%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD  FEVIFISSD DQ SF+EFFS MPWLA+P+GD+RK  L+R FK+ GIP LVA+ R
Sbjct  386  KQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDERKKFLNRRFKIEGIPTLVALNR  445

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT++T+AR L+ SHGADAYPFTEERLK+LE + EE AKGWPEK+ H LHEEHEL+ T 
Sbjct  446  SGRTVSTDARKLITSHGADAYPFTEERLKQLEEQLEEEAKGWPEKLKHELHEEHELVRTH  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            +  Y+CD C+E G GWSFYC++CDF LHP CA+          ++  + E+ KEGW+C+G
Sbjct  506  QAEYSCDACDEMGYGWSFYCEECDFSLHPNCAM----------KNDGEAEEQKEGWICEG  555

Query  168  EVCKKA  151
            +VC++ 
Sbjct  556  DVCRRV  561


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGS-LSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSD D+ SF ++FSKMPWL+IP+ D      L+ LFKVRGIP LV +   G+ L
Sbjct  71   FEVVFVSSDNDEESFKDYFSKMPWLSIPFSDSETNQRLNELFKVRGIPHLVVLDANGKVL  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   LV  +G +AYPFT
Sbjct  131  TNDGVRLVSEYGVNAYPFT  149


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D +   F+E    MP LA+P+ D++   L R F++  IP L+ IG+
Sbjct  226  KEKGNNFEIVLISLDDEADDFNEALKAMPCLALPFQDEKCKKLIRYFELSDIPTLIIIGQ  285

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  L+  HG+DAYPFT
Sbjct  286  DGKTLHPNAVELIEEHGSDAYPFT  309



>ref|XP_010682545.1| PREDICTED: probable nucleoredoxin 1 [Beta vulgaris subsp. vulgaris]
Length=572

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 139/185 (75%), Gaps = 5/185 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK+ AFE+IF+SSDRDQSSFDE++S MPWLA+P+GD+RK  LSR FKV+GIP LVAIG 
Sbjct  392  KAKESAFEIIFVSSDRDQSSFDEYYSHMPWLALPFGDERKAYLSRKFKVKGIPCLVAIGP  451

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+TTEAR L+ SHGADA+PF E  +K LE + E+MAKGWPEK+      EHELL  R
Sbjct  452  QGKTITTEARELIGSHGADAFPFNEGHMKNLEEKIEQMAKGWPEKLK-HELHEHELLKVR  510

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGCN  G  WSFYC +CDFDL PKCAL    ++  + + ++   + KE ++C+G
Sbjct  511  RDGYYCDGCNNPGHSWSFYCKECDFDLDPKCAL----KKEAQAKDEESKIENKEEYICEG  566

Query  168  EVCKK  154
            +VC+K
Sbjct  567  DVCRK  571


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSD D+ SF  +FSKMPWLAIP  D+    SL   F V GIP LV + + G+  
Sbjct  76   FEVVFVSSDFDEESFQNYFSKMPWLAIPISDEATIKSLGEKFSVMGIPHLVILNKDGKVS  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   +V  H A+AYPFT
Sbjct  136  TDEGVKVVKEHEAEAYPFT  154


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 51/85 (60%), Gaps = 1/85 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRD-QSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIG  532
            K   + FEV+ I  D D +  F E  ++MPW+A+P+ D +   L R F++R IP LV IG
Sbjct  231  KENGENFEVVLIYLDEDDEGGFKEGLAEMPWVALPFKDKKIARLVRYFELRNIPRLVIIG  290

Query  531  RTGRTLTTEARNLVMSHGADAYPFT  457
              G+TL  +   L+  HGA AYPFT
Sbjct  291  PDGKTLNPDVVELIDEHGAVAYPFT  315



>ref|XP_011041505.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=561

 Score =   198 bits (504),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/186 (61%), Positives = 138/186 (74%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD RK  LSR FK++GIP  VAIG 
Sbjct  385  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDGRKQILSRKFKIQGIPAAVAIGP  444

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFT E   +   E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  445  SGRTITKEARMHLTAYGADAFPFT-EEHLKQLEELEEKAKGWPEKVKHELHAEHELIRTK  503

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEGW+CD 
Sbjct  504  RKTYICDGCRETGHRWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGWICDT  555

Query  168  EVCKKA  151
            +VC++A
Sbjct  556  DVCRRA  561


 Score = 86.7 bits (213),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D D+  F E F  MPWLA+P+ D     L R F++R IP LV IG+
Sbjct  225  KEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKSCKKLVRYFELRTIPNLVIIGQ  284

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  285  DGKTLNPNVAELIEEHGVEAYPFT  308


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP  V     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNHVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDNGVSTVKEHGVDGYPFN  150



>ref|XP_004141529.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 ref|XP_004156195.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 gb|KGN52625.1| hypothetical protein Csa_5G647470 [Cucumis sativus]
Length=562

 Score =   198 bits (503),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 139/186 (75%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FEVIFISSDRD +SF EFFS MPWLA+P+GD+RK  L+R FK++GIP +VAI  
Sbjct  386  KQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFGDERKNFLNRRFKIQGIPAVVAINE  445

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT++TEAR L+  HGA+AYPFTEERL++LE + EE +KGWPEK+ H LH+ HEL+ TR
Sbjct  446  SGRTVSTEARKLITEHGANAYPFTEERLEQLEKQLEEESKGWPEKLKHELHDAHELVRTR  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CD C+  G GWSFYC +CDFDLHPKCAL         +   + + + KEGW+C+G
Sbjct  506  RTSYICDACDGMGSGWSFYCKECDFDLHPKCAL---------KNEVEANGEGKEGWICEG  556

Query  168  EVCKKA  151
             VC+KA
Sbjct  557  GVCRKA  562


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIFISSDRD+ SF ++FSKMPWL+ P+ D      L  LF+VRGIP LV +  +G+  
Sbjct  71   FEVIFISSDRDEDSFKDYFSKMPWLSFPFSDSEIVKRLKELFEVRGIPRLVVLDPSGKVS  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   LV  HG  AYPFT
Sbjct  131  TDQGVRLVTEHGISAYPFT  149


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FE++ IS D     F E    +PWLA+P+ D++   L+R F +  IP LV IG+
Sbjct  226  KEKGQNFEIVLISLDDANKDFSEALKTVPWLALPFQDEKCRKLTRYFDLSTIPTLVIIGQ  285

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL + A  LV  HG DAYPFT
Sbjct  286  DGKTLISNAAELVEEHGVDAYPFT  309



>ref|XP_008782777.1| PREDICTED: probable nucleoredoxin 1-1 [Phoenix dactylifera]
Length=583

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 120/186 (65%), Positives = 151/186 (81%), Gaps = 0/186 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFEV+FISSDRDQ SF++F S MPWLA+P+GD+RK SL+R+FK+RGIP LVAIG 
Sbjct  398  KDKDSAFEVVFISSDRDQKSFEDFLSGMPWLALPFGDERKKSLNRVFKIRGIPSLVAIGP  457

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T +A+ L+M HGADAYPFTEER+KELE + EEMAKGWPEK+ H LHEEHEL+L R
Sbjct  458  TGRTVTKDAKLLLMIHGADAYPFTEERIKELEDQLEEMAKGWPEKLKHDLHEEHELVLIR  517

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y CDGC+  G  WS+ C +C+FDLHP+CAL E K++  EE+  ++  KT+EG+VCDG
Sbjct  518  CGKYGCDGCDGLGDKWSYRCTECNFDLHPRCALAEDKKKTGEEDHGEEQGKTEEGYVCDG  577

Query  168  EVCKKA  151
            + C+KA
Sbjct  578  DACRKA  583


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S+DRD+ SF+ +F+KMPWLAIP+ D + +  L  +FKVRGIP LV +  +G  L
Sbjct  80   FEVVFVSADRDEDSFNGYFAKMPWLAIPFSDTKARDRLDEVFKVRGIPHLVILDASGEVL  139

Query  513  TTEARNLVMSHGADAYPFT  457
              E    V  +G++ YPFT
Sbjct  140  NEEGVQAVGDYGSEGYPFT  158


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FEV+ +S D ++SSF E F+ MPWLAIP+GD+    L R F++R IP LV +G 
Sbjct  235  KEKGESFEVVMVSLDDEESSFKEGFAGMPWLAIPFGDESCKKLVRYFELRTIPTLVVLGS  294

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL +    LV  HG +A   +PF+
Sbjct  295  DGKTLHSNIAELVEEHGEEAWEGFPFS  321



>ref|XP_006378295.1| hypothetical protein POPTR_0010s07010g [Populus trichocarpa]
 gb|ERP56092.1| hypothetical protein POPTR_0010s07010g [Populus trichocarpa]
Length=470

 Score =   196 bits (497),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+A EVIFISSD DQ++FDEF+S+MPWLA+P+GD+RK  LSR FK++GIP  VAIG 
Sbjct  293  KAKDNAVEVIFISSDSDQTTFDEFYSEMPWLALPFGDERKQILSRKFKIQGIPAAVAIGP  352

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  353  SGRTITKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  412

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC E G  WSFYC  CDF+L PKCAL        +E+     EK KEGWVCDG
Sbjct  413  RKAYVCNGCRETGYRWSFYCKQCDFNLQPKCAL--------KEDEDTGTEKGKEGWVCDG  464

Query  168  EVCKKA  151
            +VC++A
Sbjct  465  DVCRRA  470


 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D D+  F E F  MPWLA+P+ D     L++ F++R IP LV IG+
Sbjct  133  KEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKSCKKLAQYFELRTIPNLVIIGQ  192

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  193  DGKTLNPNVAELIEDHGIEAYPFT  216


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 34/58 (59%), Gaps = 1/58 (2%)
 Frame = -3

Query  627  MPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTLTTEARNLVMSHGADAYPFT  457
            MPWLAIP+ D + +  L  +F+VRGIP LV     G+    +  + VM HG D YPF 
Sbjct  1    MPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDTNGKVSCDDGVSTVMEHGVDGYPFN  58



>ref|XP_006378294.1| hypothetical protein POPTR_0010s06990g [Populus trichocarpa]
 gb|ERP56091.1| hypothetical protein POPTR_0010s06990g [Populus trichocarpa]
Length=553

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+ D RK  LSR FK++GIP  VAIG 
Sbjct  376  KGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFVDGRKQILSRKFKIQGIPAAVAIGP  435

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE  KGWPEK+ H LH EHEL+ T+
Sbjct  436  SGRTITKEARKHLTAYGADAFPFTEEHLKQLEEELEEKEKGWPEKVKHELHTEHELIRTK  495

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEGW CDG
Sbjct  496  RKAYVCNGCRETGHSWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGWNCDG  547

Query  168  EVCKKA  151
            +VC++A
Sbjct  548  DVCRRA  553


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D ++  F E F  MPWLA+P+ D     L R F++  IP LV IG+
Sbjct  225  KEKGENFEVVLISLDDEEEDFKESFETMPWLALPFNDKSCEKLVRYFELSTIPNLVIIGQ  284

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +    L+  HG +AYPFT
Sbjct  285  DGKTLNSNVAELIEEHGIEAYPFT  308


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSD D  SF+ +FS+MPWLAIP+ D + +  L  +F+VRGIP LV     G+  
Sbjct  72   FEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
              +  + VM HG D YPF 
Sbjct  132  CDDGVSTVMEHGVDGYPFN  150



>ref|XP_006378293.1| disulfide isomerase family protein [Populus trichocarpa]
 gb|ERP56090.1| disulfide isomerase family protein [Populus trichocarpa]
Length=553

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+ D RK  LSR FK++GIP  VAIG 
Sbjct  376  KGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFVDGRKQILSRKFKIQGIPAAVAIGP  435

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE  KGWPEK+ H LH EHEL+ T+
Sbjct  436  SGRTITKEARKHLTAYGADAFPFTEEHLKQLEEELEEKEKGWPEKVKHELHTEHELIRTK  495

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEGW CDG
Sbjct  496  RKAYVCNGCRETGHSWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGWNCDG  547

Query  168  EVCKKA  151
            +VC++A
Sbjct  548  DVCRRA  553


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D ++  F E F  MPWLA+P+ D     L R F++  IP LV IG+
Sbjct  225  KEKGENFEVVLISLDDEEEDFKESFETMPWLALPFNDKSCEKLVRYFELSTIPNLVIIGQ  284

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +    L+  HG +AYPFT
Sbjct  285  DGKTLNSNVAELIEEHGIEAYPFT  308


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSD D  SF+ +FS+MPWLAIP+ D + +  L  +F+VRGIP LV     G+  
Sbjct  72   FEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
              +  + VM HG D YPF 
Sbjct  132  CDDGVSTVMEHGVDGYPFN  150



>ref|XP_002314537.2| hypothetical protein POPTR_0010s06940g [Populus trichocarpa]
 gb|EEF00708.2| hypothetical protein POPTR_0010s06940g [Populus trichocarpa]
Length=564

 Score =   196 bits (498),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 143/186 (77%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  LSR FK++GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILSRKFKIQGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC   G  WSFYC  CDFDLHPKCAL        +E+     EK KEG +CDG
Sbjct  507  RKVYICNGCRGTGHSWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGRICDG  558

Query  168  EVCKKA  151
            +VC++A
Sbjct  559  DVCRRA  564


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
              +  + V  HG D YPF 
Sbjct  132  CDDGVSTVKEHGVDGYPFN  150


 Score = 83.6 bits (205),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D ++  F E F  MPW A+P+ D     L+R F++R IP LV IG+
Sbjct  227  KEKGENFEVVLISLDSEEKHFKESFETMPWFALPFKDKSCEKLARYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEDHGIEAYPFT  310



>ref|XP_006378292.1| hypothetical protein POPTR_0010s06950g [Populus trichocarpa]
 gb|ERP56089.1| hypothetical protein POPTR_0010s06950g [Populus trichocarpa]
Length=564

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQ++FDEF+S+MPWLA+P+GD RK  LSR FK++GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQTTFDEFYSEMPWLALPFGDGRKQILSRKFKIQGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGC E G  WSF+C  CDFDLHPKCAL        +E+     EK KEGW CDG
Sbjct  507  RKTYICDGCGETGNRWSFHCKQCDFDLHPKCAL--------KEDEDTGTEKGKEGWNCDG  558

Query  168  EVCKKA  151
            + C++A
Sbjct  559  DACRRA  564


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D ++  F E F  MPW A+P+ D     L+R F++R IP LV IG+
Sbjct  227  KEKGENFEVVLISLDSEEKHFKESFETMPWFALPFKDKSCEKLARYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEDHGIEAYPFT  310


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSD D  SF+ +FS+MPWLAIP+ + + +  L  LFKVRGIP LV     G+  
Sbjct  72   FEVVFISSDGDDESFNTYFSEMPWLAIPFSETETRQRLKELFKVRGIPRLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDNGVSTVKEHGVDGYPFN  150



>gb|AAU04766.1| protein disulfide isomerase (PDI)-like protein 2 [Cucumis melo]
Length=563

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 141/186 (76%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FEVIFISSDRD +SF EFFS MPWLA+P+GD+RK  ++R FK++GIP +VAI  
Sbjct  387  KQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFGDERKNFINRRFKIQGIPAVVAINE  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT++TEAR L+  +GA+AYPFTEERLK+LE + EE AKGWPEK+ H LH+ HEL+ TR
Sbjct  447  SGRTVSTEARKLITEYGANAYPFTEERLKQLEEQLEEEAKGWPEKLKHELHDAHELVRTR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CD C+  G GWSFYC +CDFDLHPKCAL         +  ++ D + KEGW+C+G
Sbjct  507  RRSYICDACDGMGSGWSFYCKECDFDLHPKCAL---------KNEEEADGEGKEGWICEG  557

Query  168  EVCKKA  151
             VC+KA
Sbjct  558  GVCRKA  563


 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIFISSDRD+ SF ++FSKMPWL+IP+ D      L  LFKVRGIP LV +  +G+  
Sbjct  71   FEVIFISSDRDEDSFKDYFSKMPWLSIPFSDSEIVKRLKELFKVRGIPHLVVLDPSGKVS  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   LV  HG +AYPFT
Sbjct  131  TDQGVRLVSEHGINAYPFT  149


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FE++ IS D     F E    +PWLA+P+ D++   L+R F++  IP LV IG+
Sbjct  226  KEKGQNFEIVSISLDDANEDFSEALKTVPWLALPFQDEKCRKLTRYFELSTIPTLVIIGQ  285

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL + A  LV  HG DAYPFT
Sbjct  286  DGKTLISNAAELVEEHGVDAYPFT  309



>ref|XP_008459528.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
Length=562

 Score =   195 bits (496),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 141/186 (76%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FEVIFISSDRD +SF EFFS MPWLA+P+GD+RK  ++R FK++GIP +VAI  
Sbjct  386  KQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFGDERKNFINRRFKIQGIPAVVAINE  445

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT++TEAR L+  +GA+AYPFTEERLK+LE + EE AKGWPEK+ H LH+ HEL+ TR
Sbjct  446  SGRTVSTEARKLITEYGANAYPFTEERLKQLEEQLEEEAKGWPEKLKHELHDAHELVRTR  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CD C+  G GWSFYC +CDFDLHPKCAL         +  ++ D + KEGW+C+G
Sbjct  506  RRSYICDACDGMGSGWSFYCKECDFDLHPKCAL---------KNEEEADGEGKEGWICEG  556

Query  168  EVCKKA  151
             VC+KA
Sbjct  557  GVCRKA  562


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIFISSDRD+ SF ++FSKMPWL+IP+ D      L  LFKVRGIP LV +  +G+  
Sbjct  71   FEVIFISSDRDEDSFKDYFSKMPWLSIPFSDSEIVKRLKELFKVRGIPHLVVLDPSGKVS  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   LV  HG +AYPFT
Sbjct  131  TDQGVRLVSEHGINAYPFT  149


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FE++ IS D     F E    +PWLA+P+ D++   L+R F++  IP LV IG+
Sbjct  226  KEKGQNFEIVSISLDDANEDFSEALKTVPWLALPFQDEKCRKLTRYFELSTIPTLVIIGQ  285

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL + A  LV  HG DAYPFT
Sbjct  286  DGKTLISNAAELVEEHGVDAYPFT  309



>ref|XP_006378291.1| hypothetical protein POPTR_0010s06930g [Populus trichocarpa]
 gb|ERP56088.1| hypothetical protein POPTR_0010s06930g [Populus trichocarpa]
Length=564

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 142/186 (76%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  LSR FK++GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILSRKFKIQGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + S+GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTSYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y C+GC   G  WSFYC  CDFDLHPKCAL        +E+     EK KEG +C G
Sbjct  507  RKVYICNGCRGTGHSWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGRICHG  558

Query  168  EVCKKA  151
            +VC++A
Sbjct  559  DVCRRA  564


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFYTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDNGVSTVKEHGVDGYPFN  150


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS + ++  F E F  MPW A+P+ D     L+R F++R IP LV IG+
Sbjct  227  KEKGENFEVVLISLNSEEKHFKESFETMPWFALPFKDKSCEKLARYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEDHGIEAYPFT  310



>emb|CDP00158.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 119/187 (64%), Positives = 138/187 (74%), Gaps = 27/187 (14%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK+ AFEV+FISSDRDQ+SFDEFFSKMPWLA+P+GD RK SLSR+FKV GIPMLVAIG 
Sbjct  389  KAKNGAFEVVFISSDRDQNSFDEFFSKMPWLALPFGDGRKESLSRVFKVLGIPMLVAIGP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+TTEAR+L+  HGA+AYPFTEERLKE+E EY+EMAKGWPEK               
Sbjct  449  TGKTVTTEARDLITYHGANAYPFTEERLKEIEEEYDEMAKGWPEK---------------  493

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEK-TKEGWVCD  172
                       GGQ WSFYC +CD+DLHPKCALEE   E T+E   +   K  KEGW+CD
Sbjct  494  -----------GGQVWSFYCGECDYDLHPKCALEEDMMEITDEAETEVSNKDQKEGWICD  542

Query  171  GEVCKKA  151
            G+VC KA
Sbjct  543  GDVCYKA  549


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 53/81 (65%), Gaps = 1/81 (1%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGR  520
            D FE++F+S+D D  SF  +FSKMPWLAIP+ D + +  L  LF VRGIP LV IG  G+
Sbjct  72   DDFEIVFVSADEDDESFAAYFSKMPWLAIPFSDSETRDRLDELFSVRGIPHLVIIGENGK  131

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +   +V   GA+ YPF+
Sbjct  132  VSTDDGVEVVQGCGAEGYPFS  152


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FE++ I  D D+ S+  +F  MPWL++P  D     L R F++  +P +V IG 
Sbjct  229  KAKGENFEIVMIPLDDDEESYKLWFKNMPWLSLPVKDKGCEKLVRYFELFTLPTVVIIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  289  DGKTLHSNVAEAIEEHGVQAYPFT  312



>ref|XP_011041502.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Populus euphratica]
Length=562

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 141/186 (76%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD RK  LSR FK+ GIP  VAIG 
Sbjct  385  KGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDGRKQILSRKFKIEGIPAAVAIGP  444

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWP+K+ H LH EHEL+ T+
Sbjct  445  SGRTITKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPQKVKHDLHAEHELIRTK  504

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEG +CDG
Sbjct  505  RKTYICDGCRETGHRWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGRICDG  556

Query  168  EVCKKA  151
            +VC++A
Sbjct  557  DVCRRA  562


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D D+  F E F  MPWLA+P+ D     L R F++R IP LV IG+
Sbjct  225  KEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICKKLVRYFELRTIPNLVIIGQ  284

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  285  DGKTLNPNVAELIEEHGVEAYPFT  308


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +F+V GIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
              +  + VM HG D YPF 
Sbjct  132  CDDGVSTVMEHGVDGYPFN  150



>gb|EPS71977.1| hypothetical protein M569_02774, partial [Genlisea aurea]
Length=573

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 143/186 (77%), Gaps = 4/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K +  EVIFISSDRDQ SFDEFFS MPWLA+P+GD RK SL R FKVRGIPM++AIG 
Sbjct  392  KEKGNEIEVIFISSDRDQQSFDEFFSTMPWLALPFGDGRKESLGRAFKVRGIPMVIAIGP  451

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+TLTTEAR L+MSHGA AYPFT ER+KE+EAE E++A+ WP+++      EH+L LT+
Sbjct  452  NGKTLTTEARELIMSHGAGAYPFTAERVKEIEAEVEKLAEAWPKELK-IDAHEHDLQLTK  510

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ + CDGC E GQ WSFYC +CD+DLHP CAL   K    EEE ++++E+ +EGW CDG
Sbjct  511  RRIFFCDGCGERGQVWSFYCSECDYDLHPNCAL---KSNGKEEEEEEEEEEEEEGWTCDG  567

Query  168  EVCKKA  151
            E C KA
Sbjct  568  EKCFKA  573


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            A+D  FE++F S D++ +SFD +FS+MPWLAIP+ D + +  L  LF V GIP LV +  
Sbjct  68   ARDKDFEIVFSSGDQEDASFDAYFSEMPWLAIPFSDSETREKLGELFSVAGIPHLVFLDE  127

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+ LT +    V  +G+DA+PFT
Sbjct  128  KGKLLTGDGVEAVREYGSDAFPFT  151


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 51/87 (59%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRD---QSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVA  538
            K + D FE++ I  D D   + +F + F K+PWL++P  D     L++ F++ G+P +V 
Sbjct  228  KQEGDNFEIVMIPLDDDDDKEEAFQQQFEKLPWLSLPAKDKISMKLAKYFELAGLPTVVV  287

Query  537  IGRTGRTLTTEARNLVMSHGADAYPFT  457
            IG  G T+ ++    +  HGA AYPFT
Sbjct  288  IGPEGNTIHSDVAEAIEEHGAKAYPFT  314



>ref|XP_002314535.2| hypothetical protein POPTR_0010s06980g [Populus trichocarpa]
 gb|EEF00706.2| hypothetical protein POPTR_0010s06980g [Populus trichocarpa]
Length=564

 Score =   193 bits (491),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 140/186 (75%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFEVIFISSDRDQS+FDEF+S+MPWLA+P+GD RK  LSR FK++GIP  +AIG 
Sbjct  387  KRKDKAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDGRKQILSRKFKIQGIPAALAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTVTKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGC E G  WSF+C  CDFDLHPKCAL        +E+     EK KEGW CDG
Sbjct  507  RSAYGCDGCGETGYRWSFFCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGWNCDG  558

Query  168  EVCKKA  151
            + C++A
Sbjct  559  DACRRA  564


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ +S D ++  F E F  MPWLA+P+ D     L R F++R IP LV IG+
Sbjct  227  KEKRENFEVVLLSLDDEEEDFKESFETMPWLALPFKDKSCEKLVRYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEEHGIEAYPFT  310


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSD D  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFVSSDGDDESFNTYFSEMPWLAIPFPDTETRQRLKEVFKVRGIPKLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                   V  HG D YPF 
Sbjct  132  CDNGVRHVKEHGVDGYPFN  150



>ref|XP_002525368.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF37006.1| nucleoredoxin, putative [Ricinus communis]
Length=553

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 0/153 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFE+IFISSDRDQSSFDEF+++MPWLA+P+GDDRK  L R FK++GIP  +AI  
Sbjct  390  KAKDNAFEIIFISSDRDQSSFDEFYTEMPWLALPFGDDRKTILQRKFKIKGIPAAIAISP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+TLT EAR  + ++GADAYPF E+ LK+L  + EE+AKGWPEK+ H LH EHEL+  +
Sbjct  450  TGKTLTKEAREHITAYGADAYPFNEDHLKQLNDKQEEIAKGWPEKVRHELHPEHELVRMK  509

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
            R  Y CDGC E G GWSFYC  CDFDLHPKCAL
Sbjct  510  RNGYGCDGCKEAGSGWSFYCKKCDFDLHPKCAL  542


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SFD +FSKMPWLAIP+ D      L  LFKVRGIP LV +   G+  
Sbjct  75   FEVVFISSDRDAESFDAYFSKMPWLAIPFSDQETCKHLKDLFKVRGIPNLVFLDADGKVS  134

Query  513  TTEARNLVMSHGADAYPFT  457
              +    +  +GA+ YPFT
Sbjct  135  CDQGVRFIREYGAEGYPFT  153


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D D+++F +    MPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  230  KEKGEKFEVVLISMDYDENNFKQGLETMPWLALPFEDKSRERLARYFELSALPTLVIIGE  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG  AYPFT
Sbjct  290  DGKTLNKNVAELIEGHGIQAYPFT  313



>ref|XP_004238662.1| PREDICTED: probable nucleoredoxin 1 [Solanum lycopersicum]
Length=601

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 118/214 (55%), Positives = 153/214 (71%), Gaps = 30/214 (14%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K+K+   EVIF+SSD+DQ+SFDE+F+ MPWLA+P+GD+RK  LSRLFKVRGIP LVA+G 
Sbjct  388  KSKNGPLEVIFLSSDQDQASFDEYFATMPWLALPFGDERKTYLSRLFKVRGIPTLVAVGP  447

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T+TT+AR+L+M HGA A+PFTEER++E+EAE  EMAKGWPEK+      EHELLL++
Sbjct  448  SGKTVTTDARSLIMCHGAKAFPFTEERMEEIEAETAEMAKGWPEKI-MHKLHEHELLLSK  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeept-------------------  226
            R  Y CD C E GQ WSFYC++CDFD+HPKCALEE+KE                      
Sbjct  507  RSAYNCDVCEELGQIWSFYCEECDFDMHPKCALEEEKESNMDIEEDQKDHMHPNYALEEE  566

Query  225  ----------eeesqkddEKTKEGWVCDGEVCKK  154
                      +++  K+++KT EGW+CDGEVC K
Sbjct  567  KESNMDIEEDQKDQGKEEQKTNEGWICDGEVCFK  600


 Score = 89.4 bits (220),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+++D D  SF E+FSKMPWLA+P+ D + +  L+ LF VRGIP LV +  +G+ +
Sbjct  71   FEVVFLTADMDDESFKEYFSKMPWLAVPFSDSETRKRLNELFAVRGIPHLVILDASGKVV  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +++ HG + YPFT
Sbjct  131  TNSGVEIIVEHGVEGYPFT  149


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 49/86 (57%), Gaps = 2/86 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDR--DQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAI  535
            K++ + FE++ I  D   D  SF + FS+MPW ++P  D     L+R F++  +P LV I
Sbjct  226  KSQGENFEIVMIPLDDEDDDESFKKEFSRMPWFSLPLKDKTCKKLARYFELSTLPTLVII  285

Query  534  GRTGRTLTTEARNLVMSHGADAYPFT  457
            G  G+TL +     V  HG  AYPF+
Sbjct  286  GTDGKTLHSNVAEAVEEHGILAYPFS  311



>ref|XP_008353015.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=399

 Score =   187 bits (476),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/153 (71%), Positives = 125/153 (82%), Gaps = 3/153 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSDRDQ SFDEFF+ MPWLA+P+GD RK  LSR FKV+GIPMLVAIG 
Sbjct  230  KAKDDAFEVIFISSDRDQDSFDEFFATMPWLALPFGDSRKAFLSRKFKVQGIPMLVAIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EARN +M+HGA AYPFT    + LEAE EEMAKGWPEK+  ALHE+HEL+L++
Sbjct  290  TGQTVTREARNHIMAHGAKAYPFT---EEHLEAESEEMAKGWPEKLKSALHEKHELVLSK  346

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
            R  + CDGC + G  WSF C +CDFDLHPKCA 
Sbjct  347  RTVFVCDGCRKPGALWSFCCKECDFDLHPKCAF  379


 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 56/84 (67%), Gaps = 2/84 (2%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            AK D FEV+FISSDRD+ S+  +FSKMPWL+IP+ D + +  L   FKVRGIP LV I  
Sbjct  71   AKGD-FEVVFISSDRDEESYTGYFSKMPWLSIPFWDSETRKRLKEFFKVRGIPNLVIIDA  129

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+    +   +V  +GA+ YPFT
Sbjct  130  NGKVSIDDGTKIVRDYGANGYPFT  153



>ref|XP_006836611.1| hypothetical protein AMTR_s00131p00113720 [Amborella trichopoda]
 gb|ERM99464.1| hypothetical protein AMTR_s00131p00113720 [Amborella trichopoda]
Length=603

 Score =   192 bits (487),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 110/201 (55%), Positives = 143/201 (71%), Gaps = 15/201 (7%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  D  FE++FISSD+DQ  FDEFFS MPWLA+P+GD  K  LSR FK+RGIP LVA+ +
Sbjct  403  KTNDSNFEIVFISSDQDQGKFDEFFSSMPWLALPFGDKAKEKLSRTFKIRGIPSLVALDK  462

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             GR +T +ARNL+M HG+ A+PFTEERLKE+E E EEMAKGWP+++   +H +H L+L  
Sbjct  463  KGRLVTNDARNLIMRHGSKAFPFTEERLKEVEQELEEMAKGWPKELKLEVHSQHPLMLIS  522

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTK-------  190
            ++ YTCDGCNEGG GWS+YC +CD+DLHPKCAL+EK +     +  + ++  +       
Sbjct  523  QRWYTCDGCNEGGNGWSYYCKECDYDLHPKCALKEKDKIVDSVDEVEMEKTEEEGKIIDG  582

Query  189  --------EGWVCDGEVCKKA  151
                    EGWVCDGE C+KA
Sbjct  583  AEGENGHGEGWVCDGEACRKA  603


 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ +SSD +   F+E FS MPWLA+P+ D     L RLF+++G P L  IG 
Sbjct  243  KEKGESFEIVLVSSDENIKDFNEHFSSMPWLALPFEDIALSRLRRLFELQGFPTLTVIGP  302

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL  +    +  HG +AYPFT
Sbjct  303  DGKTLKDDVVETIGDHGPEAYPFT  326


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 52/79 (66%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D D+ SF+++F KMPWLAIP+ D   +  L   F+V GIP LV +G+  + L
Sbjct  88   FEVVFVSGDSDEKSFEDYFHKMPWLAIPFSDSTVRSKLDEGFEVYGIPHLVIVGKDSKIL  147

Query  513  TTEARNLVMSHGADAYPFT  457
            T+E    V  +G D YPFT
Sbjct  148  TSEGVGTVSEYGVDGYPFT  166



>ref|XP_011041503.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Populus euphratica]
Length=562

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 138/186 (74%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD RK  LSR FK+ GIP  VAIG 
Sbjct  385  KGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDGRKQILSRKFKIEGIPAAVAIGP  444

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFTEE LK+LE E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  445  SGRTITKEARMHLTAYGADAFPFTEEHLKQLEEELEEKAKGWPEKVKHELHTEHELIRTK  504

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGC E G  WSF+C  CDFDLHPKCAL        + +     EK  EG +CDG
Sbjct  505  RSAYGCDGCGETGYRWSFHCKQCDFDLHPKCAL--------KVDEDTGSEKGTEGRICDG  556

Query  168  EVCKKA  151
            +VC++A
Sbjct  557  DVCRRA  562


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D D+  F E F  MPWLA+P+ D     L R F++R IP LV IG+
Sbjct  225  KEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICKKLVRYFELRTIPNLVIIGQ  284

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  285  DGKTLNPNVAELIEEHGVEAYPFT  308


 Score = 84.0 bits (206),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +F+V GIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
              +  + VM HG D YPF 
Sbjct  132  CDDGVSTVMEHGVDGYPFN  150



>ref|XP_011014069.1| PREDICTED: probable nucleoredoxin 1 isoform X4 [Populus euphratica]
Length=563

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 134/186 (72%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  L R FK+ GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILGRKFKIEGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFT E   +   E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFT-EEHLKQLEELEEKAKGWPEKVKHELHTEHELIRTK  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C GC E G  WSFYC  CDFDLHPKCAL        +E+     EK KE W+CD 
Sbjct  506  RVAYICHGCRETGHRWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKERWMCDT  557

Query  168  EVCKKA  151
            +VC++A
Sbjct  558  DVCRRA  563


 Score = 84.3 bits (207),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDSGVSTVKEHGVDGYPFN  150


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + K + FEV+ IS D ++  F E F  MPWLA+P+ D     L+R F++R IP LV IG+
Sbjct  227  REKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDRSCEKLARYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEDHGIEAYPFT  310



>ref|XP_011071086.1| PREDICTED: probable nucleoredoxin 1 [Sesamum indicum]
Length=585

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 140/183 (77%), Gaps = 5/183 (3%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            +  EV+FISSDRD++SFDEFFSKMPWLA+P+GD+RK  L RLFKVRGIPM++AIG  GRT
Sbjct  401  NVLEVVFISSDRDETSFDEFFSKMPWLALPFGDERKEFLGRLFKVRGIPMVIAIGPNGRT  460

Query  516  LTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHY  337
            ++TE R L+M HGA+A+PFT ERL+E+EA +E+MA+GWP K + +   +HEL+LT+RQ +
Sbjct  461  VSTEVRELIMYHGAEAFPFTTERLEEIEAAHEKMAEGWP-KNSKSALHDHELVLTKRQFF  519

Query  336  TCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTK----EGWVCDG  169
             CD C E G+ WS+YC++CDFDLHPKCAL +  +    +   K+    +    EGW+CDG
Sbjct  520  NCDDCGEEGRIWSYYCEECDFDLHPKCALGDNSKGTEGDVGGKESVDAEGAPAEGWICDG  579

Query  168  EVC  160
            + C
Sbjct  580  DKC  582


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 54/81 (67%), Gaps = 1/81 (1%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGR  520
            + FE++F+SSD D  SF+ +FSKMPWLAIP+ D + +G L  LF V GIP L  +   G+
Sbjct  80   NNFEIVFVSSDEDDESFNAYFSKMPWLAIPFSDSETRGQLDELFAVSGIPHLEILDENGK  139

Query  519  TLTTEARNLVMSHGADAYPFT  457
             LT++   ++  HG + YPFT
Sbjct  140  VLTSDGVEIIQEHGVEGYPFT  160


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + + FE++ I  D D+ SF E F  +PW ++P  D     L R F++  +P +V IG 
Sbjct  237  KEQGENFEIVMIPLDDDEQSFKEAFEHLPWFSLPVKDKCCAKLLRYFELESLPTVVVIGP  296

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +   + V  HG  AYPFT
Sbjct  297  DGKTLHSNVADAVDEHGTKAYPFT  320



>tpg|DAA45727.1| TPA: PDI-like protein [Zea mays]
Length=569

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSD DQSSFD+FFS+MPWLA+P+ D+RK SL + FK+RGIP LVAIG 
Sbjct  394  KEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDERKASLKKTFKIRGIPSLVAIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T++ +A++ +M HGADA+PFTEERL+EL+ + +EMAKGWP+K+ H LH+EHEL+L R
Sbjct  454  TGQTVSRDAKSQLMIHGADAFPFTEERLEELQKKLDEMAKGWPQKLKHELHDEHELVLLR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGCNE G  WS+ CD+CDFDLHPKCAL            +K  E+   G+VC+G
Sbjct  514  RGTYRCDGCNEMGSSWSYRCDECDFDLHPKCAL----------GEEKMGEEAPAGYVCEG  563

Query  168  EVCKKA  151
             VC+KA
Sbjct  564  GVCRKA  569


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F S+DR++ +F+E+F+KMPWLA+P+ D   + +L   FKV GIP LV +  +TG 
Sbjct  74   SFEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGQFKVSGIPHLVILDAKTGE  133

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +    V  +G +AYPFT
Sbjct  134  VYTEDGVEFVSEYGVEAYPFT  154


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D ++SSF+E F+KMPWLAIP GD +  +L R F++  +P LV IG  G+T
Sbjct  235  EKFEVVAVSLDSEESSFNESFAKMPWLAIPQGDIKCQTLVRYFELSSLPTLVLIGPDGKT  294

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L     +++  HG +A   +PF+
Sbjct  295  LNNNVADIIDDHGFEAWEGFPFS  317



>ref|NP_001105407.1| nucleoredoxin1 [Zea mays]
 gb|AAD04231.1| PDI-like protein [Zea mays]
Length=569

 Score =   189 bits (481),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSD DQSSFD+FFS+MPWLA+P+ D+RK SL + FK+RGIP LVAIG 
Sbjct  394  KEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDERKASLKKTFKIRGIPSLVAIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T++ +A++ +M HGADA+PFTEERL+EL+ + +EMAKGWP+K+ H LH+EHEL+L R
Sbjct  454  TGQTVSRDAKSQLMIHGADAFPFTEERLEELQKKLDEMAKGWPQKLKHELHDEHELVLLR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGCNE G  WS+ CD+CDFDLHPKCAL            +K  E+   G+VC+G
Sbjct  514  RGTYRCDGCNEMGSSWSYRCDECDFDLHPKCAL----------GEEKMGEEAPAGYVCEG  563

Query  168  EVCKKA  151
             VC+KA
Sbjct  564  GVCRKA  569


 Score = 81.3 bits (199),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F S+DR++ +F+E+F+KMPWLA+P+ D   + +L   FKV GIP LV +  +TG 
Sbjct  74   SFEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGQFKVSGIPHLVILDAKTGE  133

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +    V  +G +AYPFT
Sbjct  134  VYTEDGVEFVSEYGVEAYPFT  154


 Score = 77.4 bits (189),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D ++SSF+E F+KMPWLAIP GD +  +L R F++  +P LV IG  G+T
Sbjct  235  EKFEVVAVSLDSEESSFNESFAKMPWLAIPQGDIKCQTLVRYFELSSLPTLVLIGPDGKT  294

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L     +++  HG +A   +PF+
Sbjct  295  LNNNVADIIDDHGFEAWEGFPFS  317



>ref|XP_011014068.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Populus euphratica]
Length=563

 Score =   189 bits (480),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 135/186 (73%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  L R FK+ GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILGRKFKIEGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFT E   +   E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFT-EEHLKQLEELEEKAKGWPEKVKHELHTEHELIRTK  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDG  E G  WSFYC  CDFDLHPKCAL        +E+     EK KE W+CD 
Sbjct  506  RKTYICDGWEETGNRWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKERWMCDT  557

Query  168  EVCKKA  151
            +VC++A
Sbjct  558  DVCRRA  563


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDSGVSTVKEHGVDGYPFN  150


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + K + FEV+ IS D ++  F E F  MPWLA+P+ D     L+R F++R IP LV IG+
Sbjct  227  REKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDRSCEKLARYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEDHGIEAYPFT  310



>ref|XP_011014066.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Populus euphratica]
Length=563

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 133/186 (72%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  L R FK+ GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILGRKFKIEGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFT E   +   E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFT-EEHLKQLEELEEKAKGWPEKVKHELHTEHELIRTK  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C GC E G  WSFYC  CDFDLHPKCAL        + +     EK KEG +CDG
Sbjct  506  RVAYICHGCRETGHRWSFYCKQCDFDLHPKCAL--------KVDEDTGSEKGKEGRICDG  557

Query  168  EVCKKA  151
            + C++A
Sbjct  558  DGCRRA  563


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDSGVSTVKEHGVDGYPFN  150


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + K + FEV+ IS D ++  F E F  MPWLA+P+ D     L+R F++R IP LV IG+
Sbjct  227  REKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDRSCEKLARYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEDHGIEAYPFT  310



>ref|XP_011014067.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Populus euphratica]
Length=563

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 134/186 (72%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  L R FK+ GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILGRKFKIEGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR  + ++GADA+PFT E   +   E EE AKGWPEK+ H LH EHEL+ T+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFT-EEHLKQLEELEEKAKGWPEKVKHELHTEHELIRTK  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y C GC E G  WSFYC  CDFDLHPKCAL        +E+     EK KEG +CDG
Sbjct  506  RVAYICHGCRETGHRWSFYCKQCDFDLHPKCAL--------KEDEDTGSEKGKEGRICDG  557

Query  168  EVCKKA  151
            + C++A
Sbjct  558  DGCRRA  563


 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDSGVSTVKEHGVDGYPFN  150


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + K + FEV+ IS D ++  F E F  MPWLA+P+ D     L+R F++R IP LV IG+
Sbjct  227  REKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDRSCEKLARYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEDHGIEAYPFT  310



>ref|XP_008340046.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Malus domestica]
Length=578

 Score =   189 bits (479),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 141/186 (76%), Gaps = 3/186 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSD+ Q++FD+ F+ MPWLA+P+GD RK  L   FKV  IP L+AIG 
Sbjct  396  KAKDDAFEVIFISSDKGQNAFDKVFATMPWLALPFGDSRKAFLISKFKVLFIPKLIAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EARNL+  HGA+AYPFT E   +      EMA+GWPEK+  ALHE+HEL+L++
Sbjct  456  TGQTVTKEARNLIKDHGANAYPFT-EERMKEIKAEFEMARGWPEKLKSALHEKHELVLSK  514

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  + CDGC + G  WSFYC +CDF+LHPKCAL  + ++  E  +++++E++KEGWVCDG
Sbjct  515  RTAFVCDGCGKPGVVWSFYCKECDFNLHPKCAL--EGDKKIENGAKQEEEESKEGWVCDG  572

Query  168  EVCKKA  151
             VC +A
Sbjct  573  GVCTEA  578


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGS-LSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FIS+D D  SF  +F++MPWLAIP+ D +  S +  LFKVR IP LV +G  G+ L
Sbjct  81   FEIVFISADEDDESFKGYFAEMPWLAIPFSDSKARSRVDELFKVREIPHLVTLGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +GADAYPFT
Sbjct  141  SDSGVWIIRKYGADAYPFT  159


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  + FE++ +  D D+ SF ++F KMPW ++P GD     L+R F+   +P +V IG 
Sbjct  236  KANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDKSVKKLARYFEHSTLPTVVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL+    + +  HG+ AYPFT
Sbjct  296  DGKTLSENVADAIDEHGSLAYPFT  319



>gb|ACF82903.1| unknown [Zea mays]
Length=569

 Score =   188 bits (477),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 143/186 (77%), Gaps = 10/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSD DQSSFD+FFS+MPWLA+P+ D+RK SL + FK+RGIP LVAIG 
Sbjct  394  KEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDERKASLKKTFKIRGIPSLVAIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T++ +A++ +M HGADA+PFTEERL+EL+ + +EMAKGWP+K+ H LH+EHEL+L R
Sbjct  454  TGQTVSRDAKSQLMIHGADAFPFTEERLEELQKKLDEMAKGWPQKLKHELHDEHELVLLR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGC+E G  WS+ CD+CDFDLHPKCAL            +K  E+   G+VC+G
Sbjct  514  RGTYRCDGCDEMGSSWSYRCDECDFDLHPKCAL----------GEEKMSEEAPAGYVCEG  563

Query  168  EVCKKA  151
             VC+KA
Sbjct  564  GVCRKA  569


 Score = 80.9 bits (198),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F S+DR++ +F+E+F+KMPWLA+P+ D   + +L   FKV GIP LV +  +TG 
Sbjct  74   SFEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGRFKVSGIPHLVILDAKTGE  133

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +    V  +G +AYPFT
Sbjct  134  VYTEDGVEFVSEYGVEAYPFT  154


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 55/83 (66%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D ++SSF+E F+KMPWLAIP GD +  +L R F++  +P LV IG  G+T
Sbjct  235  EKFEVVAVSLDSEESSFNESFAKMPWLAIPQGDIKCQTLVRYFELSSLPTLVLIGPDGKT  294

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L     +++  HG +A   +PF+
Sbjct  295  LNNNVADIIDDHGFEAWEGFPFS  317



>emb|CBI28536.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 119/186 (64%), Gaps = 33/186 (18%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSDRDQ+SFDEFFS MPWLA+P+GD RK SL R FKVR IP L+A+  
Sbjct  390  KAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDKRKASLGRTFKVRSIPKLIAVEP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEARNLVM HGADAYPFT                                   +
Sbjct  450  TGRTVTTEARNLVMIHGADAYPFT-------------------------------DEHIK  478

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
                 C+GC + G  WSFYC +CDFDLHPKCAL   +++  +++++ +  K  EGW CDG
Sbjct  479  EIEARCNGCEKEGHLWSFYCAECDFDLHPKCAL--DEDKGIKDDNKLEKAKPGEGWKCDG  536

Query  168  EVCKKA  151
            EVC +A
Sbjct  537  EVCSRA  542


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D ++ SF ++F  MPW A+P+ D   G L+R FK+R +P LV IG+
Sbjct  230  RAKGESFEIVMISLDDEEQSFKKYFESMPWFALPFNDKSCGKLARYFKLRVLPTLVVIGQ  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  290  DGKTLHSNVAEAIEQHGIQAYPFT  313


 Score = 86.7 bits (213),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IF+S D+    F+E+FSKMPWLAIP+ D D +  L +LFK+RGIP L  +  +G+ L
Sbjct  75   FEIIFVSLDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKMRGIPSLAMLDESGKVL  134

Query  513  TTEARNLVMSHGADAYPFT  457
            ++E   ++  +G + YPFT
Sbjct  135  SSEGVEIIKDYGVEGYPFT  153



>gb|KEH20025.1| protein disulfide isomerase (PDI)-like protein [Medicago truncatula]
Length=570

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 138/183 (75%), Gaps = 5/183 (3%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            +DA EV+FISSDRDQ SF+EFF+ MPWLA+P+GD RK  LSR FKV GIP LVAIG +G+
Sbjct  393  NDALEVVFISSDRDQESFNEFFAGMPWLALPFGDTRKEFLSRKFKVSGIPKLVAIGPSGQ  452

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
            T+T EAR LV  +GADAYPFTE+R+KE+EA+ +++AKGWPEK+      EHEL+L+RR  
Sbjct  453  TVTKEARGLVGLYGADAYPFTEKRIKEIEAQKDDIAKGWPEKVT-HETHEHELVLSRRNV  511

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDGEVC  160
            Y CDGC + G  WS+ C +CDFDLHP CAL     +       K++EK K+GWVCDG+VC
Sbjct  512  YCCDGCKDEGDTWSYLCAECDFDLHPNCAL----GDKGSINGAKEEEKPKDGWVCDGDVC  567

Query  159  KKA  151
             KA
Sbjct  568  TKA  570


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S+D+D  +F  +FSKMPWLAIP+ D + +G L  LF V GIP L  +   G+ +
Sbjct  74   FEVVFVSADKDDEAFKSYFSKMPWLAIPFSDSETRGRLDELFHVNGIPHLALLDEAGKVI  133

Query  513  TTEARNLVMSHGADAYPFT  457
            T +  +++  +GA+AYPFT
Sbjct  134  TEDGVDIIRVYGAEAYPFT  152


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+FI  D ++ +F +     PWL++P  D     L + F++  +P LV IG 
Sbjct  229  KENGENFEVVFIPLDDEEDAFKKELESAPWLSLPLKDKTCAKLIQYFELSELPTLVIIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A   +  HG DAYPFT
Sbjct  289  DGKTLHPNAAEAIEDHGVDAYPFT  312



>gb|ACJ85567.1| unknown [Medicago truncatula]
 gb|AFK46193.1| unknown [Medicago truncatula]
Length=570

 Score =   186 bits (472),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 138/183 (75%), Gaps = 5/183 (3%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            +DA EV+FISSDRDQ SF+EFF+ MPWLA+P+GD RK  LSR FKV GIP LVAIG +G+
Sbjct  393  NDALEVVFISSDRDQESFNEFFAGMPWLALPFGDTRKEFLSRKFKVSGIPELVAIGPSGQ  452

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
            T+T EAR LV  +GADAYPFTE+R+KE+EA+ +++AKGWPEK+      EHEL+L+RR  
Sbjct  453  TVTKEARGLVGLYGADAYPFTEKRIKEIEAQKDDIAKGWPEKVT-HETHEHELVLSRRNV  511

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDGEVC  160
            Y CDGC + G  WS+ C +CDFDLHP CAL     +       K++EK K+GWVCDG+VC
Sbjct  512  YCCDGCKDEGDTWSYLCAECDFDLHPNCAL----GDKGSINGAKEEEKPKDGWVCDGDVC  567

Query  159  KKA  151
             KA
Sbjct  568  TKA  570


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S+D+D  +F  +FSKMPWLAIP+ D + +G L  LF V GIP L  +   G+ +
Sbjct  74   FEVVFVSADKDDEAFKSYFSKMPWLAIPFSDSETRGRLDELFHVNGIPHLALLDEAGKVI  133

Query  513  TTEARNLVMSHGADAYPFT  457
            T +  +++  +GA+AYPFT
Sbjct  134  TEDGVDIIRVYGAEAYPFT  152


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+FI  D ++ +F +     PWL++P  D     L + F++  +P LV IG 
Sbjct  229  KENGENFEVVFIPLDDEEDAFKKELESAPWLSLPLKDKTCAKLIQYFELSELPTLVIIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A   +  HG DAYPFT
Sbjct  289  DGKTLHPNAAEAIEDHGVDAYPFT  312



>emb|CBI28543.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 115/186 (62%), Gaps = 35/186 (19%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSDRDQ+SFDEFFS MPWLA+P+GD RK SL R FKVR IP L+A+  
Sbjct  390  KAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDKRKASLGRTFKVRSIPKLIAVEP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+TTEAR LVM HGADAYPFT                                   +
Sbjct  450  TGRTVTTEARTLVMIHGADAYPFT-------------------------------EEHIK  478

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
                 C+GC + G  WSFYC++CDF+LHPKCAL    EE    +  ++  +  EGW CDG
Sbjct  479  EIEAQCNGCEKQGHLWSFYCEECDFNLHPKCAL----EEDKGSKEDEEKARPGEGWKCDG  534

Query  168  EVCKKA  151
            EVC +A
Sbjct  535  EVCSRA  540


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+IF+S D+    F+E+FSKMPWLAIP+ D D +  L +LFKVRGIP L  +  +G+ L
Sbjct  75   FEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRGIPSLAMLDESGKVL  134

Query  513  TTEARNLVMSHGADAYPFT  457
            ++E   ++  +G + YPFT
Sbjct  135  SSEGVEIIKDYGVEGYPFT  153


 Score = 77.8 bits (190),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D +  SF   F  MPWLA+P+ D     L+R F++  +P LV IG 
Sbjct  230  RAKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCKKLARYFELSALPTLVVIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFT  313



>gb|KDO82403.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=477

 Score =   183 bits (465),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K ++++ EV+FISSDRDQ+SFDEFF  MPWLA+P+GD RK SLSR FKV GIPMLVAIG 
Sbjct  295  KERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDARKASLSRKFKVSGIPMLVAIGP  354

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR+++  HGA+AYPFTEER+KE++ +Y EMAKGWPE +      EHEL+L R
Sbjct  355  SGRTITKEARDMIAVHGAEAYPFTEERMKEIDGQYNEMAKGWPENVK-HALHEHELVLDR  413

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y+CDGC+E G+ W+F CD+CDF LHP CAL   +++ T+++  ++   +KEGW CDG
Sbjct  414  CGVYSCDGCDEEGRVWAFSCDECDFCLHPNCAL--GEDKGTKDDKSEEQNPSKEGWRCDG  471

Query  168  EVCKK  154
             +C K
Sbjct  472  GLCYK  476


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ IS D ++ SF      MPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  135  KGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDKSREKLARYFELSTLPTLVIIGP  194

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  A+PFT
Sbjct  195  DGKTLHSNVAEAIEEHGVGAFPFT  218


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  627  MPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTLTTEARNLVMSHGADAYPFT  457
            MPWLA+P+ D + +  L  LFKV GIP LV +   G+ L+     ++  +G + YPFT
Sbjct  1    MPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYPFT  58



>ref|XP_006438372.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
 gb|ESR51612.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
Length=477

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K ++++ EV+FISSDRDQ+SFDEFF  MPWLA+P+GD RK SLSR FKV GIPMLVAIG 
Sbjct  295  KERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDARKASLSRKFKVSGIPMLVAIGP  354

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EA++++  HGA+AYPFTEER+KE++ +Y EMAKGWPE +      EHEL+L R
Sbjct  355  SGRTITKEAKDMIAVHGAEAYPFTEERMKEIDGQYNEMAKGWPENVK-HALHEHELVLDR  413

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y+CDGC+E G+ W+F CD+CDF LHP CAL   +++ T+++  ++   +KEGW CDG
Sbjct  414  CGVYSCDGCDEEGRVWAFSCDECDFCLHPNCAL--GEDKGTKDDKSEEQNPSKEGWRCDG  471

Query  168  EVCKK  154
             +C K
Sbjct  472  GLCYK  476


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ IS D ++ SF      MPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  135  KGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDKSREKLARYFELSTLPTLVIIGP  194

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  A+PFT
Sbjct  195  DGKTLHSNVAEAIEEHGVGAFPFT  218


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 35/58 (60%), Gaps = 1/58 (2%)
 Frame = -3

Query  627  MPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTLTTEARNLVMSHGADAYPFT  457
            MPWLA+P+ D + +  L  LFKV GIP LV +   G+ L+     ++  +G + YPFT
Sbjct  1    MPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYPFT  58



>ref|XP_007222607.1| hypothetical protein PRUPE_ppa003530mg [Prunus persica]
 gb|EMJ23806.1| hypothetical protein PRUPE_ppa003530mg [Prunus persica]
Length=567

 Score =   184 bits (466),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/186 (58%), Positives = 130/186 (70%), Gaps = 7/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD AFE+IFISSDRD SSF EFFS MPWLA+P GD RK  + R FK++GIP LVAI  
Sbjct  389  KAKDSAFEIIFISSDRDHSSFKEFFSTMPWLALPLGDPRKALVQRKFKIQGIPALVAISP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+TL+T+AR L+ ++GADAYPFTEE LK LE + EE AKGWPEK+   LH EHEL    
Sbjct  449  NGQTLSTQARQLIQAYGADAYPFTEEHLKHLEEKLEEEAKGWPEKVKSELHAEHELTRVL  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y C  C E G GWSFYC +CDF LHP+CAL        +E ++ D     EG++CDG
Sbjct  509  HHEYVC-WCREPGSGWSFYCKECDFHLHPRCAL------SNKEGTKADAPNAMEGYICDG  561

Query  168  EVCKKA  151
            +VC+K 
Sbjct  562  DVCRKV  567


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF  +FS+MPWLAIP+ D + +  L  LFKVRGIP LV I   G+  
Sbjct  75   FEVVFISSDRDDKSFSGYFSEMPWLAIPFSDLEARKRLKELFKVRGIPNLVIIDANGKVS  134

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   +VM HG D YPFT
Sbjct  135  TDQGTRVVMEHGVDGYPFT  153


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D ++  F + F ++PWLA+P+       L+R F++  +P LV IG+
Sbjct  230  KEKGENFEIVLISLDYEEEHFKQGF-QVPWLALPFKAKSCEKLARHFELENVPTLVIIGQ  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  L+  +G +AYPFT
Sbjct  289  DGKTLRPNAVELIEEYGIEAYPFT  312



>ref|XP_006483868.1| PREDICTED: probable nucleoredoxin 1-like [Citrus sinensis]
Length=570

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K ++++ EV+FISSDRDQ+SFDEFF  MPWLA+P+GD RK SLSR FKV GIPMLVAIG 
Sbjct  388  KERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDARKASLSRKFKVSGIPMLVAIGP  447

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR+++  HGA+AYPFTEER+KE++ +Y EMAKGWPE +      EHEL+L R
Sbjct  448  SGRTITKEARDMIAVHGAEAYPFTEERMKEIDGQYNEMAKGWPENVK-HALHEHELVLDR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y+CDGC+E G+ W+F CD+CDF LHP CAL   +++ T+++  ++   +KEGW CDG
Sbjct  507  CGVYSCDGCDEEGRVWAFSCDECDFCLHPNCAL--GEDKGTKDDKSEEQNPSKEGWRCDG  564

Query  168  EVCKK  154
             +C K
Sbjct  565  GLCYK  569


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S D D  +F  +FSKMPWLA+P+ D + +  L  LFKV GIP LV +   G+ L
Sbjct  73   FEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVL  132

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G + YPFT
Sbjct  133  SDGGVEIIREYGVEGYPFT  151


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ IS D ++ SF      MPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  228  KGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDKSREKLARYFELSTLPTLVIIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  A+PFT
Sbjct  288  DGKTLHSNVAEAIEEHGVGAFPFT  311



>gb|KDO82402.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=551

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K ++++ EV+FISSDRDQ+SFDEFF  MPWLA+P+GD RK SLSR FKV GIPMLVAIG 
Sbjct  369  KERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDARKASLSRKFKVSGIPMLVAIGP  428

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR+++  HGA+AYPFTEER+KE++ +Y EMAKGWPE +      EHEL+L R
Sbjct  429  SGRTITKEARDMIAVHGAEAYPFTEERMKEIDGQYNEMAKGWPENVK-HALHEHELVLDR  487

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y+CDGC+E G+ W+F CD+CDF LHP CAL   +++ T+++  ++   +KEGW CDG
Sbjct  488  CGVYSCDGCDEEGRVWAFSCDECDFCLHPNCAL--GEDKGTKDDKSEEQNPSKEGWRCDG  545

Query  168  EVCKK  154
             +C K
Sbjct  546  GLCYK  550


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S D D  +F  +FSKMPWLA+P+ D + +  L  LFKV GIP LV +   G+ L
Sbjct  54   FEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVL  113

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G + YPFT
Sbjct  114  SDGGVEIIREYGVEGYPFT  132


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ IS D ++ SF      MPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  209  KGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDKSREKLARYFELSTLPTLVIIGP  268

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  A+PFT
Sbjct  269  DGKTLHSNVAEAIEEHGVGAFPFT  292



>gb|KDO82401.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=569

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K ++++ EV+FISSDRDQ+SFDEFF  MPWLA+P+GD RK SLSR FKV GIPMLVAIG 
Sbjct  387  KERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDARKASLSRKFKVSGIPMLVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR+++  HGA+AYPFTEER+KE++ +Y EMAKGWPE +      EHEL+L R
Sbjct  447  SGRTITKEARDMIAVHGAEAYPFTEERMKEIDGQYNEMAKGWPENVK-HALHEHELVLDR  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y+CDGC+E G+ W+F CD+CDF LHP CAL   +++ T+++  ++   +KEGW CDG
Sbjct  506  CGVYSCDGCDEEGRVWAFSCDECDFCLHPNCAL--GEDKGTKDDKSEEQNPSKEGWRCDG  563

Query  168  EVCKK  154
             +C K
Sbjct  564  GLCYK  568


 Score = 80.5 bits (197),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S D D  +F  +FSKMPWLA+P+ D + +  L  LFKV GIP LV +   G+ L
Sbjct  72   FEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVL  131

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G + YPFT
Sbjct  132  SDGGVEIIREYGVEGYPFT  150


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ IS D ++ SF      MPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  227  KGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDKSREKLARYFELSTLPTLVIIGP  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  A+PFT
Sbjct  287  DGKTLHSNVAEAIEEHGVGAFPFT  310



>ref|XP_006438373.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
 gb|ESR51613.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
Length=570

 Score =   182 bits (462),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 143/185 (77%), Gaps = 3/185 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K ++++ EV+FISSDRDQ+SFDEFF  MPWLA+P+GD RK SLSR FKV GIPMLVAIG 
Sbjct  388  KERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDARKASLSRKFKVSGIPMLVAIGP  447

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EA++++  HGA+AYPFTEER+KE++ +Y EMAKGWPE +      EHEL+L R
Sbjct  448  SGRTITKEAKDMIAVHGAEAYPFTEERMKEIDGQYNEMAKGWPENVK-HALHEHELVLDR  506

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y+CDGC+E G+ W+F CD+CDF LHP CAL   +++ T+++  ++   +KEGW CDG
Sbjct  507  CGVYSCDGCDEEGRVWAFSCDECDFCLHPNCAL--GEDKGTKDDKSEEQNPSKEGWRCDG  564

Query  168  EVCKK  154
             +C K
Sbjct  565  GLCYK  569


 Score = 80.5 bits (197),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S D D  +F  +FSKMPWLA+P+ D + +  L  LFKV GIP LV +   G+ L
Sbjct  73   FEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVL  132

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +G + YPFT
Sbjct  133  SDGGVEIIREYGVEGYPFT  151


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ IS D ++ SF      MPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  228  KGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDKSREKLARYFELSTLPTLVIIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  A+PFT
Sbjct  288  DGKTLHSNVAEAIEEHGVGAFPFT  311



>ref|XP_010937371.1| PREDICTED: probable nucleoredoxin 1-1 [Elaeis guineensis]
Length=564

 Score =   181 bits (460),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 124/153 (81%), Gaps = 0/153 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFE++FISSDRDQ+SF++FFS MPWLA+PYGD+RK SLS +FK+RGIP LVAIG 
Sbjct  402  KDKDSAFEMVFISSDRDQNSFEDFFSGMPWLALPYGDERKKSLSSVFKIRGIPSLVAIGP  461

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TGRT+T +A+ L+M HGADAYPFTEER+KELE + EEMAKGWPEK+    HE HEL+LTR
Sbjct  462  TGRTITKDAKLLMMVHGADAYPFTEERIKELEDQLEEMAKGWPEKLKDDRHEGHELVLTR  521

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
               Y CDGCN  G  WS+ C +C FDLH +CAL
Sbjct  522  CGKYVCDGCNGLGDKWSYRCTECTFDLHTRCAL  554


 Score = 82.8 bits (203),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+ +S DRD+ SF+  FSKMPWLAIP+ D + +  L  LFKVRGIP LV +   G  L
Sbjct  83   FEVVLVSGDRDEDSFNGSFSKMPWLAIPFSDSKARDRLDELFKVRGIPHLVILDANGEVL  142

Query  513  TTEARNLVMSHGADAYPFT  457
              +    V  +G++ YPFT
Sbjct  143  NKKGVQAVGDYGSEGYPFT  161


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 57/88 (65%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAIG  532
            K + ++FEV+ +S D ++SSF E F+ MPWLAIP+ D +    L+R F++RGIP LV +G
Sbjct  238  KERGESFEVVMVSLDDEESSFKEGFATMPWLAIPFNDKKSCKRLARYFELRGIPTLVVLG  297

Query  531  RTGRTLTTEARNLVMSHGADA---YPFT  457
              G+TL      +V  HG +A   +PF+
Sbjct  298  TDGKTLHNNIAEIVEEHGEEAWEGFPFS  325



>ref|XP_008353016.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Malus 
domestica]
Length=571

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 130/187 (70%), Gaps = 2/187 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+A E+IF+SSDRD  SF EFF  MPWLAIP GD RK  L R FK++ IP LVAI  
Sbjct  386  KAKDNAIEIIFLSSDRDHHSFKEFFETMPWLAIPLGDPRKALLQRKFKIQAIPALVAISP  445

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+TL+T+AR L+ +HGADAYPFTEE LK+LE + EE AKGWPEK+   LH EHEL+   
Sbjct  446  SGQTLSTQARQLIQAHGADAYPFTEEHLKQLEEKLEEEAKGWPEKVKSILHAEHELIRVL  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL-eekkeepteeesqkddEKTKEGWVCD  172
               Y C  C E G GWSFYC DCDFDLHP+CAL      +     ++ D  K  E ++CD
Sbjct  506  HHDYVC-WCREPGSGWSFYCKDCDFDLHPRCALGNNGGTKDDPPTAKDDPSKAAEDYICD  564

Query  171  GEVCKKA  151
            G+VC+K 
Sbjct  565  GDVCRKV  571


 Score = 93.6 bits (231),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 57/84 (68%), Gaps = 2/84 (2%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            AK D FEV+FISSDRD+ SF+ +FSKMPWL+IP+ D + +  L   FKVRGIP LV I  
Sbjct  71   AKGD-FEVVFISSDRDEESFNGYFSKMPWLSIPFSDLETRKRLKEFFKVRGIPHLVIIDA  129

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+    +   +VM HG D YPFT
Sbjct  130  NGKVSIDDGTKIVMDHGVDGYPFT  153


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 1/84 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D ++  F E F ++ WLA+P+ D     L+R F +  +P LV IG+
Sbjct  230  KEKGENFEIVLISLDLEEEHFKEGF-QVSWLALPFKDKNCEKLARYFALESLPRLVIIGQ  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL + A  L+  +GA+AYPFT
Sbjct  289  DGKTLHSNAAELIEEYGAEAYPFT  312



>ref|XP_002467709.1| hypothetical protein SORBIDRAFT_01g032910 [Sorghum bicolor]
 gb|EER94707.1| hypothetical protein SORBIDRAFT_01g032910 [Sorghum bicolor]
Length=584

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 110/186 (59%), Positives = 143/186 (77%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSDRDQSSFD+FFS+MPWLA+P  D+RK SL + FK+RGIP LVAIG 
Sbjct  401  KEKNSDFEIVFISSDRDQSSFDDFFSQMPWLALPLEDERKVSLKKTFKIRGIPSLVAIGP  460

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T++ +A+  +M HGADA+PFTEERL+EL+ + +EMAKGWP+K+ H LH+EHEL+L R
Sbjct  461  TGQTVSRDAKAQLMIHGADAFPFTEERLEELQKKLDEMAKGWPQKLKHELHDEHELVLLR  520

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CDGC E G  WS+ CD+CDFDLHPKCAL E+K+   EE    ++     G+VC+ 
Sbjct  521  RGTYGCDGCEEMGSTWSYRCDECDFDLHPKCALAEEKKGEEEEGKSTEEAPA--GYVCEE  578

Query  168  EVCKKA  151
             VC+K 
Sbjct  579  GVCRKV  584


 Score = 80.1 bits (196),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEVIF S+D+++  F+E+F+KMPWLA+P+ D + + +L   FKV GIP LV +  +TG 
Sbjct  81   SFEVIFASADQNEEGFNEYFAKMPWLAVPFSDTEGRAALDARFKVSGIPHLVILDAKTGE  140

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +    V  +G +AYPFT
Sbjct  141  VYTEDGVEFVSEYGVEAYPFT  161


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 56/83 (67%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D ++S+F+E F+KMPWLAIP GD +   L R F++R +P LV IG  G+T
Sbjct  242  EKFEVVAVSLDSEESAFNESFAKMPWLAIPQGDQKCEKLVRYFELRSLPTLVLIGPDGKT  301

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L +   +++  HG +A   +PF+
Sbjct  302  LNSNVADIIDEHGFEAWEGFPFS  324



>ref|XP_003562828.1| PREDICTED: probable nucleoredoxin 1-2 [Brachypodium distachyon]
Length=577

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSDRDQSSFD+FFS MPWLA+P  D+RK  L ++FK+RGIP LVAIG 
Sbjct  393  KEKNSDFEIVFISSDRDQSSFDDFFSGMPWLALPLEDERKAYLKKMFKIRGIPSLVAIGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T+ T+A+  +  HGADA+PFTEE+++ELE   +EMAKGWPEK+ H LHEEHEL+LTR
Sbjct  453  SGKTVNTDAKAPLAVHGADAFPFTEEKIQELEKNIDEMAKGWPEKLKHELHEEHELVLTR  512

Query  348  -RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
             R+ + CDGC+E G  WS+YC +CDFDLH  CAL EKK+   E+    +      G+VC+
Sbjct  513  HRRPFGCDGCDEMGNSWSYYCAECDFDLHTSCALGEKKKGEEEKGHDAEAAPA--GYVCE  570

Query  171  GEVCKKA  151
            G+VC+KA
Sbjct  571  GDVCRKA  577


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F+S D+D+ +F+ +F+KMPWLA+P+ D   + SL   F+VRGIP LV +  +TG+
Sbjct  73   SFEVVFVSGDQDEEAFNAYFAKMPWLAVPFTDSEGRKSLDERFQVRGIPHLVILDAKTGK  132

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +    V  +G DAYPFT
Sbjct  133  VCTEDGVEFVSEYGIDAYPFT  153


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+ +S D D++SF+E F  MPWLAIP GD     L   F++  +P LV IG  G+TL 
Sbjct  236  FEVVAVSMDNDEASFNESFQNMPWLAIPQGDKMCQKLVSYFELNDLPTLVLIGPDGKTLN  295

Query  510  TEARNLVMSHGADA---YPFT  457
            +   +++  +G ++   +PF 
Sbjct  296  SNIADIIEENGVESWEGFPFN  316



>ref|XP_003557743.1| PREDICTED: probable nucleoredoxin 1-2 [Brachypodium distachyon]
Length=577

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 108/187 (58%), Positives = 143/187 (76%), Gaps = 3/187 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSDRDQSSFD+FFS MPWLA+P  D+RK  L ++FK+RGIP LVAIG 
Sbjct  393  KEKNSDFEIVFISSDRDQSSFDDFFSGMPWLALPLEDERKAYLKKMFKIRGIPSLVAIGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T+ T+A+  +  HGADA+PFTEE+++ELE   +EMAKGWPEK+ H LH+EHEL+LTR
Sbjct  453  SGKTVNTDAKAPLAVHGADAFPFTEEKIQELEKNIDEMAKGWPEKLKHELHKEHELVLTR  512

Query  348  -RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCD  172
             R+ + CDGC+E G  WS+YC +CDFDLH  CAL EKK+   E+    +      G+VC+
Sbjct  513  HRRPFGCDGCDEMGNSWSYYCAECDFDLHTSCALGEKKKGEEEKGHDAEAAPA--GYVCE  570

Query  171  GEVCKKA  151
            G+VC+KA
Sbjct  571  GDVCRKA  577


 Score = 84.0 bits (206),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 56/81 (69%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F+S D+D+ +F+ +F+KMPWLA+P+ D   + SL   F+VRGIP LV +  +TG+
Sbjct  73   SFEVVFVSGDQDEEAFNAYFAKMPWLAVPFTDSEGRKSLDERFQVRGIPHLVILDAKTGK  132

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +    V  +G DAYPFT
Sbjct  133  VCTEDGVEFVSEYGIDAYPFT  153


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D D++SF+E F  MPWLAIP GD     L   F++  +P LV IG  G+T
Sbjct  234  EKFEVVAVSMDNDEASFNESFQNMPWLAIPQGDKMCQKLVSYFELNDLPTLVLIGPDGKT  293

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L +   +++  +G ++   +PF 
Sbjct  294  LNSNIADIIEENGVESWEGFPFN  316



>dbj|BAJ87919.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   178 bits (452),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSD+DQSSFD+FFS MPWLAIP  D+RK  L + FK+RGIP LVAIG 
Sbjct  394  KEKNSDFEIVFISSDKDQSSFDDFFSGMPWLAIPLEDERKADLKKRFKIRGIPSLVAIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+ T+A+  +  HGADA+PFT+ER++ELE + +EMAKGWPEK+ H LHE   +L+ R
Sbjct  454  DGKTVNTDAKTSLAVHGADAFPFTDERIEELEKKIDEMAKGWPEKLKHELHEHELVLVRR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ Y CDGC E G  WS+ C +CDFDLH KCAL E+K+    +  +        G+VC+G
Sbjct  514  RRPYGCDGCEEMGNSWSYNCAECDFDLHTKCALGEEKKGEEVKGQEDAAAPA--GYVCEG  571

Query  168  EVCKKA  151
            +VC+KA
Sbjct  572  DVCRKA  577


 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F+S D+D+ +F+ +F+KMPWLA+P+ D   + +L   F+V GIP LV +  +TG 
Sbjct  74   SFEVVFVSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKNLDERFEVNGIPHLVFLDAKTGE  133

Query  519  TLTTEARNLVMSHGADAYPFT  457
             LT E    V  +G +AYPFT
Sbjct  134  VLTDEGVEFVSEYGIEAYPFT  154


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D D+ SF+  FS MPWLAIP GD     L   F++  +P LV IG  G+T
Sbjct  235  EKFEVVAVSLDSDEESFNTSFSSMPWLAIPQGDKMCQKLVSYFELSDLPTLVLIGPDGKT  294

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L++    ++  HG DA   +PF+
Sbjct  295  LSSNIAGIIDEHGLDAWEGFPFS  317



>gb|KDP26596.1| hypothetical protein JCGZ_17754 [Jatropha curcas]
Length=567

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 137/186 (74%), Gaps = 8/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD  FE+IF+SSDRDQSSF+EF+S MPWLA+P+GD+RK  L + FK++GIP  +AI  
Sbjct  390  KEKDSRFEIIFVSSDRDQSSFEEFYSGMPWLALPFGDERKTILQKKFKIKGIPAAIAISS  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G+T+T EA+  + ++GADAYPFTE+ LK+L+ + EE+AKGWPEK+ H LH+EHEL+  +
Sbjct  450  SGKTVTKEAKEHLTAYGADAYPFTEQHLKQLKEKLEEIAKGWPEKLKHELHKEHELVRIK  509

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R+ + C+GC E G GWSFYC +CDFDLHP CAL++K+     +  +          +C G
Sbjct  510  RKGFVCNGCREMGHGWSFYCKECDFDLHPNCALKKKENGEEGKGEEGR--------ICQG  561

Query  168  EVCKKA  151
            + C+KA
Sbjct  562  DTCRKA  567


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 57/81 (70%), Gaps = 5/81 (6%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSR---LFKVRGIPMLVAIGRTGR  520
            FEV+FISSDRD  SF+ +FSKMPWLAIP+ D  +G+L R   LFKVRGIP LV +   G+
Sbjct  75   FEVVFISSDRDDESFNGYFSKMPWLAIPFPD--QGTLKRLKELFKVRGIPNLVVLDANGK  132

Query  519  TLTTEARNLVMSHGADAYPFT  457
                   +++ ++GA+ YPFT
Sbjct  133  VSCDRGVDIIRNYGAEGYPFT  153


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D D+  F + F KMPWLA+P+ D  +  L+R F++  +P LV IG 
Sbjct  230  KEKGENFEIVLISIDYDEKDFKQSFEKMPWLALPFQDKGREKLARYFELSALPSLVIIGE  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  290  DGKTLNQNVAELIEDHGIEAYPFT  313



>gb|EMT12941.1| Nucleoredoxin [Aegilops tauschii]
Length=577

 Score =   176 bits (446),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 133/186 (72%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FISSDRDQSSFD+FFS MPWLAIP  D+RK  L + FK+RGIP LVAIG 
Sbjct  394  KEKNSDFEIVFISSDRDQSSFDDFFSGMPWLAIPLEDERKAYLKKKFKIRGIPSLVAIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+ T+A+  +  HGADA+PFT ER++ELE + +EMAKGWPEK+ H LHE   +L+ R
Sbjct  454  DGKTVNTDAKTSLAVHGADAFPFTSERIQELEKKIDEMAKGWPEKVKHELHEHELVLVRR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             + Y CDGC E G  WS+ C +CDFDLH KCAL E+K+       +        G+VC+G
Sbjct  514  PRPYGCDGCEEMGTSWSYNCAECDFDLHAKCALGEEKKGEEVNGQEHAAAPA--GYVCEG  571

Query  168  EVCKKA  151
            +VC+KA
Sbjct  572  DVCRKA  577


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEVIF+S D+D+ +F+ +F+KMPWLA+P+ D   + SL   F+V GIP LV +  +TG 
Sbjct  74   SFEVIFVSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKSLDERFEVNGIPHLVFLDAKTGE  133

Query  519  TLTTEARNLVMSHGADAYPFT  457
             LT E    V  +G +AYPFT
Sbjct  134  VLTDEGVEFVSEYGIEAYPFT  154


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D D+ SF+  FS MPWLAIP GD     L   F++  +P LV IG  G+T
Sbjct  235  EKFEVVAVSLDSDEESFNNSFSSMPWLAIPQGDKMCQKLVSYFELSDLPTLVLIGPDGKT  294

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L++   +++  HG DA   +PF 
Sbjct  295  LSSNIADIINEHGLDAWEGFPFN  317



>ref|XP_008389657.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=566

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 128/186 (69%), Gaps = 5/186 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK +A E+IF+SSDRDQ SF E F+ MPWLAIP GD R+  L   FK++GIP LVAI  
Sbjct  386  KAKGNAIEIIFLSSDRDQPSFKELFATMPWLAIPLGDPRQALLQHKFKIQGIPALVAISP  445

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+TL+T+AR L+ +HG+DAYPFTEE LK+LE + EE AKGWPEK+   LH EH+L    
Sbjct  446  NGQTLSTQARQLIQAHGSDAYPFTEEHLKQLEEKLEEEAKGWPEKVKSILHAEHDLTRVL  505

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y C  C E G GWSFYC DC+FDLHPKCAL     +     ++ D  K  E ++CDG
Sbjct  506  HHDYVC-WCREPGSGWSFYCKDCNFDLHPKCAL----NKSNNGGTEDDPPKATEDYICDG  560

Query  168  EVCKKA  151
            +VC+K 
Sbjct  561  DVCRKV  566


 Score = 98.6 bits (244),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            A    FEV+FISSDRD+ SF  +FSKMPWL+IP+ D + +  L   FKVRGIP LV I  
Sbjct  70   AAKGGFEVVFISSDRDEESFTGYFSKMPWLSIPFSDLETRKRLKEFFKVRGIPHLVIIDA  129

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             GR  T +   +VM HGAD YPFT
Sbjct  130  NGRVCTNDGTKIVMDHGADGYPFT  153


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D ++  F E F ++ WLA+P+ D     L+R F++  +P LV IG+
Sbjct  230  KEKGENFEIVLISLDLEEEHFKEGF-QVSWLALPFKDKNCEKLARYFELENLPTLVIIGQ  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL + A  L+  +GA+AYPFT
Sbjct  289  DGKTLHSNAAELIEEYGAEAYPFT  312



>gb|AHL29285.1| nucleoredoxin [Triticum aestivum]
Length=577

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 134/186 (72%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++F+SSDRDQSSFD+FFS MPWLAIP  D+RK  L + FK+RGIP LVAIG 
Sbjct  394  KEKNSDFEIVFVSSDRDQSSFDDFFSGMPWLAIPLEDERKAYLKKKFKIRGIPSLVAIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+ T+A+  +  HGADA+PFT+ER++ELE + EEMAKGWPEK+ H LHE   +L+ R
Sbjct  454  DGKTVNTDAKTSLAVHGADAFPFTDERIQELEKKIEEMAKGWPEKLKHELHEHELMLIRR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
             + Y CDGC E G  WS+ C +CDFDLH KCAL E+K+       +        G+VC+G
Sbjct  514  PRPYGCDGCEEMGTSWSYNCAECDFDLHTKCALGEEKKGEEVNGQEHAAAPA--GYVCEG  571

Query  168  EVCKKA  151
            +VC+KA
Sbjct  572  DVCRKA  577


 Score = 83.6 bits (205),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEVIF+S D+D+ +F+ +F+KMPWLA+P+ D   + SL   F+V GIP LV +  +TG 
Sbjct  74   SFEVIFVSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKSLDERFEVNGIPHLVFLDAKTGE  133

Query  519  TLTTEARNLVMSHGADAYPFT  457
             LT E    V  +G +AYPFT
Sbjct  134  VLTDEGVEFVSEYGIEAYPFT  154


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D D+ SF+  FS MPWLAIP GD     L   F++  +P LV IG  G+T
Sbjct  235  EKFEVVAVSLDSDEESFNNSFSSMPWLAIPQGDKMCQKLVSYFELSDLPTLVLIGPDGKT  294

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L++   +++  HG DA   +PF 
Sbjct  295  LSSNIADIINEHGLDAWEGFPFN  317



>ref|XP_008340045.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Malus domestica]
Length=583

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 117/153 (76%), Gaps = 1/153 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSD+ Q++FD+ F+ MPWLA+P+GD RK  L   FKV  IP L+AIG 
Sbjct  396  KAKDDAFEVIFISSDKGQNAFDKVFATMPWLALPFGDSRKAFLISKFKVLFIPKLIAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EARNL+  HGA+AYPFT E   +      EMA+GWPEK+  ALHE+HEL+L++
Sbjct  456  TGQTVTKEARNLIKDHGANAYPFT-EERMKEIKAEFEMARGWPEKLKSALHEKHELVLSK  514

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
            R  + CDGC + G  WSFYC +CDF+LHPKCAL
Sbjct  515  RTAFVCDGCGKPGVVWSFYCKECDFNLHPKCAL  547


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGS-LSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FIS+D D  SF  +F++MPWLAIP+ D +  S +  LFKVR IP LV +G  G+ L
Sbjct  81   FEIVFISADEDDESFKGYFAEMPWLAIPFSDSKARSRVDELFKVREIPHLVTLGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  +GADAYPFT
Sbjct  141  SDSGVWIIRKYGADAYPFT  159


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  + FE++ +  D D+ SF ++F KMPW ++P GD     L+R F+   +P +V IG 
Sbjct  236  KANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDKSVKKLARYFEHSTLPTVVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL+    + +  HG+ AYPFT
Sbjct  296  DGKTLSENVADAIDEHGSLAYPFT  319



>gb|EAY90397.1| hypothetical protein OsI_11974 [Oryza sativa Indica Group]
Length=588

 Score =   174 bits (442),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 137/186 (74%), Gaps = 5/186 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE+IFISSDRDQSS+DEFFS MPWLA+P GD+RK  LS+ F+VRGIP LVAIG 
Sbjct  408  KEKHNDFEIIFISSDRDQSSYDEFFSGMPWLALPLGDERKQHLSKTFRVRGIPSLVAIGA  467

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             GRT+  +A+  + +HGADA+PFTEERL E+E + +EMAKGWP K+ H LH+EHEL+LTR
Sbjct  468  DGRTVARDAKTPLTAHGADAFPFTEERLLEMERKIDEMAKGWPGKLKHELHDEHELVLTR  527

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y CDGC+E G  WS+ C +CDFDLHPKCAL        EE+   D+ + +    C+G
Sbjct  528  CTTYGCDGCDEMGSSWSYRCRECDFDLHPKCAL-----GKEEEKKGDDEAEAEADPACEG  582

Query  168  EVCKKA  151
             VC+KA
Sbjct  583  GVCRKA  588


 Score = 90.1 bits (222),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRT-GRT  517
            FEV+F+S D+DQ +FD +F+KMPWLA+P+ D   +  L++ FKVRGIP LV +  T G  
Sbjct  89   FEVVFVSGDKDQEAFDAYFAKMPWLAVPFSDSECRAKLNKRFKVRGIPHLVILNATSGEV  148

Query  516  LTTEARNLVMSHGADAYPFT  457
             T +   LV  HG +AYPFT
Sbjct  149  YTEDGVELVTVHGTEAYPFT  168


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D D+   +E F+ MPWLAIP  D     L+R F++RG+P LV IG  G+T
Sbjct  249  EKFEVVAVSLDSDEELSNESFAGMPWLAIPQEDKMGEKLARYFELRGLPTLVLIGPDGKT  308

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L     +++  HG DA   +PFT
Sbjct  309  LNNNVADIIDEHGQDAWEGFPFT  331



>ref|NP_001050329.1| Os03g0405500 [Oryza sativa Japonica Group]
 sp|Q7Y0E8.1|NRX11_ORYSJ RecName: Full=Probable nucleoredoxin 1-1; Short=OsNrx1-1 [Oryza 
sativa Japonica Group]
 gb|AAP50936.1| putative trypanothione-dependent peroxidase [Oryza sativa Japonica 
Group]
 gb|ABF96507.1| PDI, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12243.1| Os03g0405500 [Oryza sativa Japonica Group]
 gb|EAZ27269.1| hypothetical protein OsJ_11206 [Oryza sativa Japonica Group]
 dbj|BAG91502.1| unnamed protein product [Oryza sativa Japonica Group]
Length=569

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 137/186 (74%), Gaps = 5/186 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE+IFISSDRDQSS+DEFFS MPWLA+P GD+RK  LS+ F+VRGIP LVAIG 
Sbjct  389  KEKHNDFEIIFISSDRDQSSYDEFFSGMPWLALPLGDERKQHLSKTFRVRGIPSLVAIGA  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             GRT+  +A+  + +HGADA+PFTEERL E+E + +EMAKGWP K+ H LH+EHEL+LTR
Sbjct  449  DGRTVARDAKTPLTAHGADAFPFTEERLLEMERKIDEMAKGWPGKLKHELHDEHELVLTR  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y CDGC+E G  WS+ C +CDFDLHPKCAL        EE+   D+ + +    C+G
Sbjct  509  CTTYGCDGCDEMGSSWSYRCRECDFDLHPKCAL-----GKEEEKKGDDEAEAEADPACEG  563

Query  168  EVCKKA  151
             VC+KA
Sbjct  564  GVCRKA  569


 Score = 89.7 bits (221),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRT-GRT  517
            FEV+F+S D+DQ +FD +F+KMPWLA+P+ D   +  L++ FKVRGIP LV +  T G  
Sbjct  70   FEVVFVSGDKDQEAFDAYFAKMPWLAVPFSDSECRAKLNKRFKVRGIPHLVILNATSGEV  129

Query  516  LTTEARNLVMSHGADAYPFT  457
             T +   LV  HG +AYPFT
Sbjct  130  YTEDGVELVTVHGTEAYPFT  149


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 51/83 (61%), Gaps = 3/83 (4%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            + FEV+ +S D D+   +E F+ MPWLAIP  D     L+R F++RG+P LV IG  G+T
Sbjct  230  EKFEVVAVSLDSDEELSNESFAGMPWLAIPQEDKMGEKLARYFELRGLPTLVLIGPDGKT  289

Query  516  LTTEARNLVMSHGADA---YPFT  457
            L     +++  HG DA   +PFT
Sbjct  290  LNNNVADIIDEHGQDAWEGFPFT  312



>gb|EYU22493.1| hypothetical protein MIMGU_mgv1a003730mg [Erythranthe guttata]
Length=567

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 130/179 (73%), Gaps = 11/179 (6%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             EVIFISSDRDQ +F+++FS+MPWLA+P+GD RK SLS  FKV GIP LVA+G TG+T++
Sbjct  399  LEVIFISSDRDQKAFEDYFSEMPWLALPFGDKRKESLSSWFKVDGIPTLVALGPTGKTVS  458

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYTC  331
            T+AR L+M+HGA+AYPFT ER++E+E  +E++  GW   +       HEL LT+R+++ C
Sbjct  459  TDARGLIMAHGAEAYPFTRERIEEIEKAFEKILAGWAPNLK-CGAHGHELFLTKRKNFVC  517

Query  330  DGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDGEVCKK  154
            DGC+E G  WS+YC+ CDFDLHPKCA +E+ ++ T            + WVCDG+ C K
Sbjct  518  DGCSEDGSVWSYYCEKCDFDLHPKCAFDEESKDKT----------AAQEWVCDGDKCYK  566


 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 58/84 (69%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            A+ + FE++FIS D D  SFD +FSKMPWLAIP+ D D +  L+ LF V GIP LV +  
Sbjct  73   AQSNNFEIVFISGDEDDESFDAYFSKMPWLAIPFSDSDTREKLNELFGVSGIPHLVILNE  132

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+ LT+E   +++ +G+D YPFT
Sbjct  133  DGKILTSEGVQVIVENGSDGYPFT  156


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            ++FE++ +  D D+ SF E F K+PWL++P  D     L R F++  +P +V IG  G+T
Sbjct  237  ESFEIVMVPLDEDEESFGEEFEKLPWLSLPINDKCCLKLVRYFELGALPTVVIIGPNGKT  296

Query  516  LTTEARNLVMSHGADAYPFT  457
            L +     +  HG  AYPFT
Sbjct  297  LQSNVVEAIEEHGMKAYPFT  316



>ref|NP_001050331.2| Os03g0405900 [Oryza sativa Japonica Group]
 dbj|BAF12245.2| Os03g0405900 [Oryza sativa Japonica Group]
Length=413

 Score =   169 bits (429),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++FISSDR+QSS+DEFFS MPWLA+P GD+RK  LS++FK+ GIP LVAIG 
Sbjct  228  KEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLGDERKQQLSKIFKITGIPSLVAIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT----eerlkeleaeyeemaKGWPEKMNhalheehel  361
             G+T+T +A+  +++HGADA+PFT    +E  KE E +  +MAKGWPEK+      +HEL
Sbjct  288  DGKTVTKDAKTPLVAHGADAFPFTEEKLQELEKEKEKKINDMAKGWPEKLK-HDLHDHEL  346

Query  360  lLTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGW  181
            +LTR   Y CDGC+E G  WS+ C +CDFDLHPKCALEEK +    EE+ +       G+
Sbjct  347  VLTRCTTYGCDGCDEMGDSWSYRCKECDFDLHPKCALEEKGDVEMGEENAEA---APAGY  403

Query  180  VCDGEVCKKA  151
            VC+G+VC+K 
Sbjct  404  VCEGDVCRKV  413


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  + FEV+ +S D D+ SF+E F+ MPWLAIP GD     L+R F++ G+PMLV IG 
Sbjct  65   KAVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDKMCEKLARYFELSGLPMLVLIGP  124

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL  +  +++  HG DA   +PF+
Sbjct  125  DGKTLNDDIADIIDEHGPDAWEGFPFS  151



>gb|EEC75442.1| hypothetical protein OsI_11975 [Oryza sativa Indica Group]
Length=581

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 141/190 (74%), Gaps = 8/190 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++FISSDR+QSS+DEFFS MPWLA+P GD+RK  LS++FK+ GIP LVAIG 
Sbjct  396  KEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLGDERKQQLSKIFKITGIPSLVAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyee----maKGWPEKMNhalheehel  361
             G+T+T +A+  +++HGADA+PFTEE+L+ELE E E+    MAKGWPEK+      +HEL
Sbjct  456  DGKTVTKDAKTPLVAHGADAFPFTEEKLQELEKEKEKKINDMAKGWPEKLK-HDLHDHEL  514

Query  360  lLTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGW  181
            +LTR   Y CDGC+E G  WS+ C +CDFDLHPKCALEEK +    EE+ +       G+
Sbjct  515  VLTRCTTYGCDGCDEMGDSWSYRCKECDFDLHPKCALEEKGDVEMGEENAEA---APAGY  571

Query  180  VCDGEVCKKA  151
            VC+G+VC+K 
Sbjct  572  VCEGDVCRKV  581


 Score = 81.6 bits (200),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 56/87 (64%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+ +S D D+ SF+E F+ MPWLAIP GD     L+R F++ G+PMLV IG 
Sbjct  233  KVVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDKMCEKLARYFELSGLPMLVLIGP  292

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL  +  +++  HG DA   +PF+
Sbjct  293  DGKTLNDDIADIIDEHGPDAWEGFPFS  319


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F+S D DQ +F+ +F+KMPWLA+P+ D      L+  +KV GIP LV +  ++G 
Sbjct  76   SFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKVMGIPHLVILDAKSGE  135

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +   LV  +G +AYPFT
Sbjct  136  IYTEDGVELVHEYGTEAYPFT  156



>sp|Q7Y0F2.1|NRX12_ORYSJ RecName: Full=Probable nucleoredoxin 1-2; Short=OsNrx1-2 [Oryza 
sativa Japonica Group]
 gb|AAP50932.1| putative trypanothione-dependent peroxidase [Oryza sativa Japonica 
Group]
 gb|ABF96516.1| PDI, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE59229.1| hypothetical protein OsJ_11208 [Oryza sativa Japonica Group]
Length=581

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 107/190 (56%), Positives = 141/190 (74%), Gaps = 8/190 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++FISSDR+QSS+DEFFS MPWLA+P GD+RK  LS++FK+ GIP LVAIG 
Sbjct  396  KEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLGDERKQQLSKIFKITGIPSLVAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyee----maKGWPEKMNhalheehel  361
             G+T+T +A+  +++HGADA+PFTEE+L+ELE E E+    MAKGWPEK+      +HEL
Sbjct  456  DGKTVTKDAKTPLVAHGADAFPFTEEKLQELEKEKEKKINDMAKGWPEKLK-HDLHDHEL  514

Query  360  lLTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGW  181
            +LTR   Y CDGC+E G  WS+ C +CDFDLHPKCALEEK +    EE+ +       G+
Sbjct  515  VLTRCTTYGCDGCDEMGDSWSYRCKECDFDLHPKCALEEKGDVEMGEENAEA---APAGY  571

Query  180  VCDGEVCKKA  151
            VC+G+VC+K 
Sbjct  572  VCEGDVCRKV  581


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  + FEV+ +S D D+ SF+E F+ MPWLAIP GD     L+R F++ G+PMLV IG 
Sbjct  233  KAVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDKMCEKLARYFELSGLPMLVLIGP  292

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL  +  +++  HG DA   +PF+
Sbjct  293  DGKTLNDDIADIIDEHGPDAWEGFPFS  319


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F+S D DQ +F+ +F+KMPWLA+P+ D      L+  +KV GIP LV +  ++G 
Sbjct  76   SFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKVMGIPHLVILDAKSGE  135

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +   LV  +G +AYPFT
Sbjct  136  IYTEDGVELVHEYGTEAYPFT  156



>ref|XP_010100450.1| putative nucleoredoxin 1 [Morus notabilis]
 gb|EXB82584.1| putative nucleoredoxin 1 [Morus notabilis]
Length=568

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 141/186 (76%), Gaps = 7/186 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+ FEVIFISSD DQSSFDE+FS MPWLA+PYGD+RK  L R FK+  IP  +AIG 
Sbjct  390  KEKDNQFEVIFISSDSDQSSFDEYFSSMPWLALPYGDERKKLLDRKFKIEAIPAAIAIGS  449

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +GRT+T EAR+L+  HGA+AYPFTEE LK LE + EE AKGWP+K+ H LH+EHEL+LTR
Sbjct  450  SGRTVTKEARDLIGVHGANAYPFTEEHLKHLEEQAEEQAKGWPQKLKHELHDEHELVLTR  509

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  Y CD C+E G GWSFYC +CDFDLHPKCALE+ +E   E         T EG+VC+G
Sbjct  510  RNVYCCDACDETGHGWSFYCGECDFDLHPKCALEKNEEAKDEPT-------TMEGYVCEG  562

Query  168  EVCKKA  151
            +VC+K 
Sbjct  563  DVCRKV  568


 Score = 96.3 bits (238),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSDRD+ SF+++FS+MPWLAIP+ D D +  L  LFKVRGIP LV I   G   
Sbjct  75   FEVVFVSSDRDEESFNDYFSEMPWLAIPFSDSDTRKHLKELFKVRGIPNLVIIDSNGEVT  134

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +VM +G D YPFT
Sbjct  135  TENGTMVVMEYGVDGYPFT  153


 Score = 74.3 bits (181),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ I  D ++    + F  MPWLA+P+ D     L R F++  IP LV IG 
Sbjct  230  KEKGENFEVVLIPLDYEEEEHKQGFEAMPWLALPFKDKSCEKLVRYFELETIPTLVIIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL       +  HG DAYPFT
Sbjct  290  DGKTLDPNVAERIEEHGIDAYPFT  313



>gb|AAU89249.1| C1-like domain containing protein [Oryza sativa Japonica Group]
Length=764

 Score =   164 bits (415),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++FISSDR+QSS+DEFFS MPWLA+P GD+RK  LS++FK+ GIP LVAIG 
Sbjct  396  KEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLGDERKQQLSKIFKITGIPSLVAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyee----maKGWPEKMNhalheehel  361
             G+T+T +A+  +++HGADA+PFTEE+L+ELE E E+    MAKGWPEK+      +HEL
Sbjct  456  DGKTVTKDAKTPLVAHGADAFPFTEEKLQELEKEKEKKINDMAKGWPEKLK-HDLHDHEL  514

Query  360  lLTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
            +LTR   Y CDGC+E G  WS+ C +CDFDLHPKCAL
Sbjct  515  VLTRCTTYGCDGCDEMGDSWSYRCKECDFDLHPKCAL  551


 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  + FEV+ +S D D+ SF+E F+ MPWLAIP GD     L+R F++ G+PMLV IG 
Sbjct  233  KAVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDKMCEKLARYFELSGLPMLVLIGP  292

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL  +  +++  HG DA   +PF+
Sbjct  293  DGKTLNDDIADIIDEHGPDAWEGFPFS  319


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 53/81 (65%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEV+F+S D DQ +F+ +F+KMPWLA+P+ D      L+  +KV GIP LV +  ++G 
Sbjct  76   SFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKVMGIPHLVILDAKSGE  135

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +   LV  +G +AYPFT
Sbjct  136  IYTEDGVELVHEYGTEAYPFT  156


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 46/83 (55%), Gaps = 7/83 (8%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRG-IPMLVAI--GRT  526
            +FE++ +S D  + SFD   + + W A+P+ D +R+ +L   F   G +P LV +    T
Sbjct  589  SFEIVLVSCDDGEESFD---AHLAWHAVPFSDSERRRALVARFNAAGEVPRLVVVLEATT  645

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
            G  +T     L+  HGAD YPFT
Sbjct  646  GEAVTECGVELIAEHGADTYPFT  668



>gb|ABR18079.1| unknown [Picea sitchensis]
Length=487

 Score =   161 bits (407),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 130/191 (68%), Gaps = 6/191 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + +AFE++FISSD+DQ +F++++  MPWLA+P+GD  K  LSR+F+VRGIP L+ +G 
Sbjct  295  KERGEAFEIVFISSDKDQEAFEDYYKSMPWLALPFGDKTKKDLSRIFRVRGIPSLIVVGP  354

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+TLT  AR  V +HGA AYPFT+  L+ LE E EE+ +  P+++      EH L+LTR
Sbjct  355  DGKTLTDNARGAVSTHGAKAYPFTDAHLERLEKEMEELVEKSPKEIR-YSQHEHPLVLTR  413

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKE-----G  184
            R  + CDGCNEGG  WS+YC DCD+DLH  CA +++ +   +++ Q  D    E     G
Sbjct  414  RPVFCCDGCNEGGTAWSYYCKDCDYDLHLTCAFKDQPDLGNQDKGQGTDAAMDENCKPAG  473

Query  183  WVCDGEVCKKA  151
             +CDG+VC KA
Sbjct  474  VICDGDVCYKA  484


 Score = 92.8 bits (229),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            K +AFE++F+S D+++ +F+E+++ MPWLA+P+ D+ +  LSR F++ GIP L+ +G  G
Sbjct  137  KGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADNTQKKLSRYFRIEGIPTLIILGPDG  196

Query  522  RTLTTEARNLVMSHGADAYPFT  457
            +T+  +A  L+  +G  AYPFT
Sbjct  197  KTIRNDAVGLIREYGIRAYPFT  218


 Score = 61.2 bits (147),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 1/58 (2%)
 Frame = -3

Query  627  MPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTLTTEARNLVMSHGADAYPFT  457
            MPWLA+P+ D+  +  L ++FKV GIP LV + + GR +TTE    +  +G +AYPFT
Sbjct  1    MPWLALPFSDENTRKKLDQVFKVDGIPCLVFLDKEGRAITTEGVETIGEYGVEAYPFT  58



>gb|ABK25413.1| unknown [Picea sitchensis]
Length=587

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 92/191 (48%), Positives = 130/191 (68%), Gaps = 6/191 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + +AFE++FISSD+DQ +F++++  MPWLA+P+GD  K  LSR+F+VRGIP L+ +G 
Sbjct  395  KERGEAFEIVFISSDKDQEAFEDYYKSMPWLALPFGDKTKKDLSRIFRVRGIPSLIVVGP  454

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+TLT  AR  V +HGA AYPFT+  L+ LE E EE+ +  P+++      EH L+LTR
Sbjct  455  DGKTLTDNARGAVSTHGAKAYPFTDAHLERLEKEMEELVEKSPKEIR-YSQHEHPLVLTR  513

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKE-----G  184
            R  + CDGCNEGG  WS+YC DCD+DLH  CA +++ +   +++ Q  D    E     G
Sbjct  514  RPVFCCDGCNEGGTAWSYYCKDCDYDLHLTCAFKDQPDLGNQDKGQGTDAAMDENCKPAG  573

Query  183  WVCDGEVCKKA  151
             +CDG+VC KA
Sbjct  574  VICDGDVCYKA  584


 Score = 93.2 bits (230),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 60/82 (73%), Gaps = 0/82 (0%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            K +AFE++F+S D+++ +F+E+++ MPWLA+P+ D+ +  LSR F++ GIP L+ +G  G
Sbjct  237  KGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADNTQKKLSRYFRIEGIPTLIILGPDG  296

Query  522  RTLTTEARNLVMSHGADAYPFT  457
            +T+  +A  L+  +G  AYPFT
Sbjct  297  KTIRNDAVGLIREYGIRAYPFT  318


 Score = 87.8 bits (216),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FIS+DRD+ SF+E+   MPWLA+P+ D+  +  L ++FKV GIP LV + + GR +
Sbjct  80   FEIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKKLDQVFKVDGIPCLVFLDKEGRAI  139

Query  513  TTEARNLVMSHGADAYPFT  457
            TTE    +  +G +AYPFT
Sbjct  140  TTEGVETIGEYGVEAYPFT  158



>ref|XP_006292691.1| hypothetical protein CARUB_v10018937mg, partial [Capsella rubella]
 gb|EOA25589.1| hypothetical protein CARUB_v10018937mg, partial [Capsella rubella]
Length=496

 Score =   160 bits (404),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 91/153 (59%), Positives = 114/153 (75%), Gaps = 3/153 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRG--IPMLVAIGR  529
            KD AFE+IFISSDRDQ +F+E++S+MPWLA+P+GD +K SL++ FKV+G  IP LV+ G+
Sbjct  323  KDQAFELIFISSDRDQEAFEEYYSQMPWLALPFGDSKKPSLAKTFKVKGNCIPRLVSAGQ  382

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EA +LV    ADAYP T     +      EMAKGWPEK+ H LHEEHEL L+ 
Sbjct  383  TGKTVTKEAIDLVRCLLADAYPVT-VERMKEIQVEYEMAKGWPEKLQHPLHEEHELKLSF  441

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
            R  Y CD C+E G+ WS+YC DCDFDLH KCAL
Sbjct  442  RMRYICDKCDESGKIWSYYCRDCDFDLHLKCAL  474


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+S D D+ SF ++F KMPWLA+P+        L+ +FKVRG P LV +   G  +
Sbjct  43   FEIVFVSFDEDEESFKDYFIKMPWLAVPFTSSETCKHLAEMFKVRGSPTLVIVNDRGEVV  102

Query  513  TTEARNLVMSHGADAYPFT  457
              +A     ++GADAYPFT
Sbjct  103  NEDAFCFTRTYGADAYPFT  121



>ref|XP_007222066.1| hypothetical protein PRUPE_ppa003234mg [Prunus persica]
 gb|EMJ23265.1| hypothetical protein PRUPE_ppa003234mg [Prunus persica]
Length=590

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 110/126 (87%), Gaps = 0/126 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSDRDQ  FDEFFS MPWLA+P+GD RK SLSR FKV+GIPMLVAIG 
Sbjct  396  KAKDDAFEVIFISSDRDQGDFDEFFSGMPWLALPFGDLRKASLSRKFKVKGIPMLVAIGP  455

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+T+T EARNLVM HGA+AYPFTEERLKE+EAEY EMAKGWPEK+  A HEEHEL+L R
Sbjct  456  TGQTVTKEARNLVMQHGANAYPFTEERLKEIEAEYLEMAKGWPEKLKSAQHEEHELVLAR  515

Query  348  RQHYTC  331
            R++Y  
Sbjct  516  RKNYIV  521


 Score = 92.4 bits (228),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 41/79 (52%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FIS+D D  SF+ +FSKMPWLAIP+ D + +  + +LFKVRGIP LV +G  G+ L
Sbjct  81   FEVVFISADEDDESFNGYFSKMPWLAIPFSDKEARDRVDKLFKVRGIPHLVILGEDGKVL  140

Query  513  TTEARNLVMSHGADAYPFT  457
            +     ++  HG D YPFT
Sbjct  141  SDSGVEIIKEHGVDGYPFT  159


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FEV+ I  D D+ SF + F  MPW ++P GD   G L+R F++  +P LV IG 
Sbjct  236  KANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNIGKLARYFELSTLPTLVIIGA  295

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T++      +  HG  AYPFT
Sbjct  296  DGKTVSKNVAEAIEEHGVLAYPFT  319



>ref|XP_009626672.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana tomentosiformis]
Length=547

 Score =   158 bits (400),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 107/152 (70%), Gaps = 0/152 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+ FEVIFISSD+D+SSF+  FS MPWLA+P+ D+RK  LSR F + GIP+ +AI  
Sbjct  389  KKKDENFEVIFISSDQDESSFNNLFSSMPWLALPFDDERKTFLSRRFNIVGIPVAIAIST  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G T+ T+ R L+ +HGA AYPFTEE +K L+   ++   GWP+K    +H EHEL L  
Sbjct  449  SGCTVNTQVRQLLETHGAGAYPFTEEHIKNLQQRLDKTTMGWPKKGKDEIHNEHELALIH  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            +Q Y C GC E G GWSF+C  CD+ LHPKCA
Sbjct  509  QQVYLCSGCKEIGYGWSFFCKRCDYGLHPKCA  540


 Score = 92.0 bits (227),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FISSD+D  SF+E+F KMPWLA+P+ D D + +L +LFKVR IP  V +  TG+ L
Sbjct  76   FEIVFISSDKDNESFNEYFGKMPWLAVPFSDADARKNLKQLFKVRAIPHFVILDGTGKVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            + E    +   G++AYPFT
Sbjct  136  SNEGVKFIKHFGSEAYPFT  154


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 43/84 (51%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FE+  IS D     F + F  MPWL +P+ D     L R F+ + +P LV I  
Sbjct  229  KLKQKNFEIALISLDEKYEDFKQGFETMPWLGLPFKDKNCERLVRYFEHKLLPQLVVISP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  LV  +G  A+PFT
Sbjct  289  DGKTLQQNAVKLVEEYGDQAFPFT  312



>ref|XP_009762379.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana sylvestris]
Length=547

 Score =   158 bits (399),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/152 (54%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+ FEVIFISSD+D+SSF+  FS+MPWL +P+ DDRK  L R F + GIP+++AI  
Sbjct  389  KKKDETFEVIFISSDQDESSFNNLFSRMPWLELPFDDDRKAFLWRRFNIVGIPVVIAISP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G T+ T+ R L+ +HGA AYPFTEE +K L+   ++ + GWP+K    +H EHEL L  
Sbjct  449  SGCTVNTQVRQLLETHGAGAYPFTEEHIKNLQQRLDKTSTGWPKKGKDEIHNEHELALIH  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            +Q Y C GC E G GWSF+C  CD+ LHPKCA
Sbjct  509  QQVYLCSGCKEMGYGWSFFCKRCDYGLHPKCA  540


 Score = 89.0 bits (219),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FISSD+D  SF+E+F KMPWLA+P+ D + +  L + FKVR IP LV +  TG+ L
Sbjct  76   FEIVFISSDKDNESFNEYFGKMPWLAVPFADAEARKKLKQSFKVRAIPHLVILDGTGKVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            + E    +   G +AYPFT
Sbjct  136  SNEGVKFIKHFGPEAYPFT  154


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 45/84 (54%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FE++ +S D     F+E F  MPWLA+ + D     L R F+ + +P LV I  
Sbjct  229  KLKQKNFEIVLLSLDEKYEDFNEGFEAMPWLALSFKDKNCERLVRYFEHKLLPQLVVISP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  LV  +G  A+PFT
Sbjct  289  DGKTLQQNAVKLVEEYGDQAFPFT  312



>ref|XP_004239348.2| PREDICTED: probable nucleoredoxin 1 [Solanum lycopersicum]
Length=540

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 108/152 (71%), Gaps = 0/152 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+ FEVIFISSD+D+SSF  FFS MPWLA+P+ D+R+  LSR F + GIP+ +AI  
Sbjct  382  KKKDENFEVIFISSDQDESSFTNFFSSMPWLALPFDDERRSFLSRRFNIVGIPVAIAISP  441

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G T+ T+ R L+ +HG+ AYPFTEE +K L+ + ++   GWP+K  +  H EHEL L  
Sbjct  442  SGFTVNTQVRQLLETHGSGAYPFTEEHIKNLQQQLDKNTTGWPKKDRNESHNEHELALIH  501

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            +Q Y C GC E G GW+F+C  CD+ LHPKCA
Sbjct  502  QQVYLCSGCKEMGYGWAFFCKRCDYGLHPKCA  533


 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FISSD+D  SF+E+F KM WLA+P+ D + + +L +LFKVR IP LV +  TG+ L
Sbjct  69   FEIVFISSDKDDESFNEYFEKMLWLAVPFSDVEARKNLKQLFKVRTIPHLVILDGTGKVL  128

Query  513  TTEARNLVMSHGADAYPFT  457
            +++    +   G +AYPFT
Sbjct  129  SSDGVKYIKHFGPEAYPFT  147


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D     F E F  MPWLA+P+ D     L + F+ + +P LV +  
Sbjct  222  KHKGNNFEIVLISLDEKYEDFKESFEAMPWLALPFKDKNCERLVQYFEHKLLPQLVVLSP  281

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A   V  +G +A+PFT
Sbjct  282  DGKTLQQNAVKFVEEYGDEAFPFT  305



>ref|XP_004984067.1| PREDICTED: probable nucleoredoxin 1-1-like [Setaria italica]
Length=580

 Score =   157 bits (398),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 111/186 (60%), Positives = 141/186 (76%), Gaps = 2/186 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K   FE++FISSD DQSSFDEFF++MPWLA+P  D+RK  L + F++RGIP LVAIG 
Sbjct  397  KEKHSDFEIVFISSDSDQSSFDEFFTEMPWLALPLEDERKAFLEKTFRIRGIPSLVAIGP  456

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T++ +A+  +M HGA+A+PFTEERL+EL+ E +EMAKGWPEK+ H LHEEHEL+L R
Sbjct  457  NGQTVSRDAKAQLMIHGAEAFPFTEERLEELQKELDEMAKGWPEKLKHELHEEHELVLER  516

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
            R  + CDGC E G  WS+ C+ CDFDLHPKCAL   +EE   EE  K  E+T  G+VC+G
Sbjct  517  RGTFCCDGCEEMGNTWSYSCNKCDFDLHPKCAL--AEEEKKGEEDGKAAEETPAGYVCEG  574

Query  168  EVCKKA  151
             VC+KA
Sbjct  575  GVCRKA  580


 Score = 83.2 bits (204),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAI-G  532
            ++  +FEV+F+S D+D+ +F+E+F+KMPWLA+P+ D   + +L   FKV GIP LV +  
Sbjct  73   SQGKSFEVVFVSGDQDEEAFNEYFAKMPWLAVPFSDSEGREALDGRFKVSGIPHLVILDA  132

Query  531  RTGRTLTTEARNLVMSHGADAYPFT  457
            +TG   T +   LV  +G +AYPFT
Sbjct  133  KTGEVYTEDGVGLVSEYGVEAYPFT  157


 Score = 80.5 bits (197),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+ +S D D+SSF+E  +KMPWLAIP GD     L R F++R +P LV IG 
Sbjct  234  KEVGEKFEVVAVSLDSDESSFNESLAKMPWLAIPQGDKMCEKLVRYFELRTLPTLVLIGT  293

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL T   +++  HG +A   +PF+
Sbjct  294  DGKTLNTNVADIIEEHGFEAWEGFPFS  320



>ref|XP_006452948.1| hypothetical protein CICLE_v10010235mg [Citrus clementina]
 gb|ESR66188.1| hypothetical protein CICLE_v10010235mg [Citrus clementina]
Length=397

 Score =   155 bits (391),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 93/198 (47%), Positives = 132/198 (67%), Gaps = 12/198 (6%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+   FEVI++S D D+ SF +++S+MPWL++PY D R+  L + F+  GIP LVA+G 
Sbjct  200  KARHSDFEVIYVSLDNDEESFHDYYSEMPWLSLPYNDKREVPLRQSFEFSGIPHLVAVGP  259

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+TLT EA++LV+ +G++AYPFT+ + +ELE   EEMAKGWPEK+ +  HE HEL+L R
Sbjct  260  TGKTLTNEAKDLVVLYGSEAYPFTDIKKRELEGRLEEMAKGWPEKVRNERHEYHELVLAR  319

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALe------------ekkeepteeesqkd  205
               Y CDGC + G  WSF CD+C F+LHP+CAL             ++     E  + +D
Sbjct  320  CGVYACDGCKQLGVRWSFNCDECYFNLHPECALMGEKVVSGDDGNDKQNNIVVEANNNED  379

Query  204  dEKTKEGWVCDGEVCKKA  151
            +   +E W+CDG+ C KA
Sbjct  380  EAAGRERWICDGQGCYKA  397


 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ +S D D+ SF   F  MPWLAIP+GD     L + F++R IP +V +G 
Sbjct  40   KEKGESFEIVLVSLDDDKESFQRQFVNMPWLAIPFGDKALEKLPKYFELRAIPTMVILGP  99

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   AR  +   G  AYPF+
Sbjct  100  DGKTLHLNARGYIEEFGIQAYPFS  123



>ref|XP_008221830.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=561

 Score =   156 bits (394),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 120/185 (65%), Gaps = 13/185 (7%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD AFE+IFISSDRD SSF EFF  MPWLA+P GD RK  + R FK++          
Sbjct  389  KAKDSAFEIIFISSDRDHSSFKEFFLTMPWLALPLGDPRKALVQRKFKIQ------PPND  442

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +   +TT+AR L+ ++GADAYPFTEE LK LE + EE AKGWPEK+   LH EHEL    
Sbjct  443  SSHHITTQARQLIQAYGADAYPFTEEHLKHLEEKLEEEAKGWPEKVKSELHAEHELTRVL  502

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y C  C E G GWSFYC +CDF LHP+CAL        +E ++ D     EG++CDG
Sbjct  503  HHEYVC-WCREPGSGWSFYCKECDFHLHPRCAL------SNKEGTKADAPNAMEGYICDG  555

Query  168  EVCKK  154
            +VC+K
Sbjct  556  DVCRK  560


 Score = 94.7 bits (234),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF  +FS+MPWLAIP+ D + +  L  LFKVRGIP LV I   G+  
Sbjct  75   FEVVFISSDRDDKSFSGYFSEMPWLAIPFSDLEARKRLKELFKVRGIPNLVIIDANGKVS  134

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   +VM HG D YPFT
Sbjct  135  TDQGTRVVMEHGVDGYPFT  153


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D ++  F E F + PWLA+P+       L+R F++  +P LV IG+
Sbjct  230  KEKGENFEIVLISLDYEEEHFKEGF-QAPWLALPFKAKSCEKLARHFELENVPTLVIIGQ  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A  L+  +G +AYPFT
Sbjct  289  DGKTLRPNAVELIEEYGIEAYPFT  312



>ref|XP_006474525.1| PREDICTED: probable nucleoredoxin 1-like [Citrus sinensis]
Length=414

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 94/198 (47%), Positives = 131/198 (66%), Gaps = 12/198 (6%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+   FE+I++S D D+ SF +++S+MPWL++PY D R+  L + F+  GIP LVA+G 
Sbjct  217  KARHSDFELIYVSLDNDEESFHDYYSEMPWLSLPYNDKREVLLRQSFEFSGIPHLVAVGP  276

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            TG+TLT EA++LV+ +G++AYPFT+ + KELE   EEMAKGWPEK+ +  HE HEL+L R
Sbjct  277  TGKTLTNEAKDLVVLYGSEAYPFTDIKKKELEGRLEEMAKGWPEKVRNKRHEYHELVLAR  336

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALe------------ekkeepteeesqkd  205
               Y CDGC E G  WSF CD+C F+LHP+CAL             ++     E  + +D
Sbjct  337  CGVYACDGCKELGVRWSFNCDECYFNLHPECALMGEKVVSGDDGNDKQNNIVVEANNNED  396

Query  204  dEKTKEGWVCDGEVCKKA  151
            +   +E W+CDG  C KA
Sbjct  397  EAAGRERWICDGHGCYKA  414


 Score = 80.1 bits (196),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K ++FE++ +S D D+ SF   F  MPWL IP+GD     L + F++R IP +V +G 
Sbjct  57   KEKGESFEIVLVSLDDDKESFQRQFVNMPWLTIPFGDKALEKLPKYFELRAIPTMVILGP  116

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   AR  +   G  AYPF+
Sbjct  117  DGKTLHLNARGYIEEFGIQAYPFS  140



>ref|XP_002467708.1| hypothetical protein SORBIDRAFT_01g032890 [Sorghum bicolor]
 gb|EER94706.1| hypothetical protein SORBIDRAFT_01g032890 [Sorghum bicolor]
Length=526

 Score =   155 bits (392),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 97/186 (52%), Positives = 131/186 (70%), Gaps = 5/186 (3%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            D  E++F+S D+DQS++DE+FS MPWLA+P  D+RK +L   F++R IP LVA+G +G T
Sbjct  342  DDLEIVFVSVDKDQSAYDEYFSGMPWLALPLEDERKQTLMNKFRIRAIPSLVAVGSSGAT  401

Query  516  LTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK-MNhalheehellLTRRQH  340
            LTT+A++ +++HGADA+PFTEE L+EL  + +E A+ WP K M H LHE HEL LTRR  
Sbjct  402  LTTDAQSHIVAHGADAFPFTEEVLEELGRKLDEEARAWPGKVMRHELHELHELALTRRDA  461

Query  339  ---YTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               YTCD C   G  WS+ CD CDFDLHPKCAL +++EE   E   +   +    +VC+G
Sbjct  462  AVTYTCDECEGLGSLWSYRCDRCDFDLHPKCALGKEEEEEEAEAGIEQLLQAA-AYVCEG  520

Query  168  EVCKKA  151
             VC+KA
Sbjct  521  GVCRKA  526


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+ +    D+S F E F+ MPWLAIP+GD     L R F +R +P LV +G  G+T+ 
Sbjct  139  FEVVAVYFRCDESVFQESFASMPWLAIPHGDSMCEKLVRYFDLRALPTLVLVGPDGKTMN  198

Query  510  TEARNLVMSHGADA---YPF  460
            +   ++V  HG DA   +PF
Sbjct  199  SNIADVVEEHGVDAWEGFPF  218


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 35/61 (57%), Gaps = 6/61 (10%)
 Frame = -3

Query  627  MPWLAIPYGDDRKGSLSRL---FKVRGIPMLVAIG-RTGRTLTTEARNLVMSHGADAYPF  460
            MPWLA+P+ D    S+ RL   FKV GIP LV +G  TG   T E    +  +GA A PF
Sbjct  1    MPWLAVPFSDSE--SIKRLMSRFKVNGIPNLVVLGAETGEIYTKEGVKFISEYGAGASPF  58

Query  459  T  457
            T
Sbjct  59   T  59



>ref|XP_006365237.1| PREDICTED: probable nucleoredoxin 1-like [Solanum tuberosum]
Length=547

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 107/152 (70%), Gaps = 0/152 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+ FEVIFISSD+D+ SF+  FS MPWLA+P+ D+R+  LSR F + GIP+ +AI  
Sbjct  389  KKKDETFEVIFISSDQDEPSFNNIFSSMPWLALPFDDERRSFLSRRFSIVGIPVAIAISP  448

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G T+ T+ R L+ +HGA AYPFTE+ +K L+ + ++   GWP+K  + +H EHEL L  
Sbjct  449  NGCTVNTQVRQLLEAHGAGAYPFTEDHIKILQQQLDKNTTGWPKKDRNEIHNEHELALIH  508

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            +Q Y C GC E G GW+F+C  CD+ LHPKCA
Sbjct  509  QQVYLCSGCKEMGYGWAFFCKRCDYGLHPKCA  540


 Score = 90.1 bits (222),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FISSD+D  SF+E+F KMPWLA+P+ D + + +L +LFKVR IP LV +  TG+ L
Sbjct  76   FEIVFISSDKDDESFNEYFGKMPWLAVPFSDAEARKNLKQLFKVRAIPHLVILDGTGKVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            + +    + + G +AYPFT
Sbjct  136  SNDGVKFIKNFGPEAYPFT  154


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FE++ IS D     F E F  MPWLA+P+ D     L + F+ + +P LV +  
Sbjct  229  KLKGNNFEIVLISLDEKYEDFKEGFEAMPWLALPFKDKNCERLVQYFEHKLLPQLVVLSP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A   V  +G +A+PFT
Sbjct  289  DGKTLQQNAVKFVEEYGDEAFPFT  312



>ref|XP_008448920.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
Length=562

 Score =   153 bits (386),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 112/155 (72%), Gaps = 2/155 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVR--GIPMLVAI  535
            K KDD  EVIFIS DRD+SSF   FS+MPWLA+P+ D RK S+ R FKV+  G+P L++I
Sbjct  391  KKKDDNLEVIFISCDRDESSFKNMFSRMPWLAVPFDDQRKASIRRKFKVQVEGMPALISI  450

Query  534  GRTGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellL  355
            G  GRT+T +A  L+ ++GA AYPF   R++EL+ E E MAK WP+++ H LHEEH + L
Sbjct  451  GEDGRTVTDDAVELISNYGAKAYPFNAGRIEELKLEIEVMAKNWPQEVKHILHEEHPISL  510

Query  354  TRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
              RQ Y CDGC + G+ WS+ C  C+FDLHP+CAL
Sbjct  511  VSRQGYVCDGCEKDGRLWSYCCKKCNFDLHPRCAL  545


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S+D D+ SF ++FSKMPWLA+P+ D +R+  L  LF+VRGIP L+ + + G+  
Sbjct  76   FEVIFVSADDDEKSFRKYFSKMPWLAVPFSDLERRDHLDSLFEVRGIPQLIILDKNGKFS  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T    + V+  GA+ YPFT
Sbjct  136  TDSGVDFVLEFGAEGYPFT  154


 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FE++ I+ D+D+  + E    +PW A+P+ D+R   L R F+V  +P LV IG+
Sbjct  231  KAKGEKFEIVLIAIDQDEELYKEALRNVPWFALPFRDNRCDKLIRYFEVSTLPTLVIIGQ  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +   N V  HG   YPFT
Sbjct  291  DGKTLHSNVANAVAEHGFLPYPFT  314



>gb|ABR16144.1| unknown [Picea sitchensis]
 gb|ACN41140.1| unknown [Picea sitchensis]
Length=586

 Score =   153 bits (386),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/191 (45%), Positives = 128/191 (67%), Gaps = 6/191 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + + FE++FIS DR+Q +F++++  MPWLA+P+GD  K  LSR F+VRGIP L+ +G 
Sbjct  397  KERGETFEIVFISMDRNQDAFEDYYKSMPWLALPFGDKTKKDLSRFFRVRGIPSLIVVGP  456

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T+ AR+ V +HGA AYPFTE   + L+ E +E+ +  P+++      EH L+LT+
Sbjct  457  DGKTVTSNARSAVSTHGARAYPFTEAHFQRLQKEMKELVENSPKEIK-YNQHEHPLVLTQ  515

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKE-----G  184
            R  + CDGCN+ G  WS+YC  CD+DLH  CAL+++++   +E+ Q  D    E     G
Sbjct  516  RPVFVCDGCNKDGSAWSYYCKKCDYDLHLPCALKDQQDPGNQEKGQNTDNAVDENCKPAG  575

Query  183  WVCDGEVCKKA  151
             +CDG+VC KA
Sbjct  576  VICDGDVCYKA  586


 Score = 94.4 bits (233),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            K +AFE++F+S D+++ +F+E+++ MPWLA+P+ D+ + +LSR F+V GIP L+ +G  G
Sbjct  239  KGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADNTEKNLSRYFRVPGIPTLIILGPDG  298

Query  522  RTLTTEARNLVMSHGADAYPFT  457
            +T+ T+A  L+  +G  AYPFT
Sbjct  299  KTVQTDAVGLIRDYGIRAYPFT  320


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            F+++FIS+DRD+ SF+E+   MPWLA+P+ D+  + +L++ F+V GIP LV + + GR +
Sbjct  82   FDIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKNLNQAFQVHGIPCLVILDKEGRVI  141

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   ++  + A+AYPFT
Sbjct  142  TAKGVEIIKEYSAEAYPFT  160



>ref|XP_004986914.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1-2-like 
[Setaria italica]
Length=554

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/186 (46%), Positives = 119/186 (64%), Gaps = 9/186 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FE++FIS D+D+ S+DEFFS MPWLA+P GD+RK  L + F++R IP L+ IG 
Sbjct  378  KEKNSDFEILFISIDKDEXSYDEFFSDMPWLALPLGDERKELLMKKFRIREIPSLIVIGP  437

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
            +G TLT +A++ +++HGADA+PFTEE L+ELE + +  AK WPEK+ H L  +       
Sbjct  438  SGLTLTKDAKSHLLAHGADAFPFTEETLQELEKKLDGKAKAWPEKVKHELVLKRSGTTVT  497

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKTKEGWVCDG  169
               Y+CDGC   G  WS  CD CDF L+P CAL        +    +  ++   G+ C+G
Sbjct  498  ---YSCDGCEGLGSSWSXRCDRCDFVLYPNCAL------GKKTRKGEATDEAPAGYACEG  548

Query  168  EVCKKA  151
             VCKKA
Sbjct  549  GVCKKA  554


 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 53/87 (61%), Gaps = 6/87 (7%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRL---FKVRGIPMLVAI  535
            ++D++ EV+F+S DRD+ SF+ + +KMPWLA+P  D     L RL   +KV GIP LV +
Sbjct  57   SQDNSLEVVFVSRDRDEESFNAYLAKMPWLAVPLADSE--CLQRLMKGYKVNGIPNLVIL  114

Query  534  -GRTGRTLTTEARNLVMSHGADAYPFT  457
             G TG   T E    +  +G  A PFT
Sbjct  115  SGETGXIYTKEGVKFISEYGIGASPFT  141


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 50/86 (58%), Gaps = 3/86 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +A  + FEV+ +    ++S F+E F+ MPW AIP+GD     L R F++  +P LV IG 
Sbjct  215  RAVGEKFEVVAVYFGSNESVFNESFASMPWFAIPHGDKMCDKLVRYFELTTLPTLVLIGP  274

Query  528  TGRTLTTEARNLVMSHGADA---YPF  460
             G TL     +++  HG++A   +PF
Sbjct  275  DGNTLNNNIADVIEEHGSEAWEGFPF  300



>ref|XP_004147954.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 ref|XP_004159502.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 gb|KGN55925.1| hypothetical protein Csa_3G036510 [Cucumis sativus]
Length=562

 Score =   149 bits (375),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 111/155 (72%), Gaps = 2/155 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVR--GIPMLVAI  535
            K KDD  EVIFIS DRD+SSF   FS+MPWLA+P+ D RK  + R FKV+  G+P L++I
Sbjct  391  KKKDDNLEVIFISCDRDESSFKNMFSRMPWLAVPFDDPRKAWIRRKFKVQVEGMPALISI  450

Query  534  GRTGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellL  355
            G  GRT T +A  L+ ++GA A+PF   R++E++ E E MAK W +++ H LHEEH + L
Sbjct  451  GEDGRTATNDAVELISNYGAKAFPFNAGRIEEMKIEIEVMAKNWVQQVKHILHEEHPISL  510

Query  354  TRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
              R+ Y CDGC + G+ WS+YC +CDFDLHP+CAL
Sbjct  511  VSRRGYVCDGCEKKGRLWSYYCKECDFDLHPRCAL  545


 Score = 85.1 bits (209),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+S+D D+ SF ++FS+MPWLA+P+ D +R+  L  LF+VRG+P L+ + + G+  
Sbjct  76   FEVIFVSADDDEKSFKKYFSEMPWLAVPFSDLERRDHLDSLFEVRGVPQLIILDKNGKLS  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T    + V   GA+ YPFT
Sbjct  136  TDTGVDFVQEFGAEGYPFT  154


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FE++ I+ D+D+  + E   K+PW A+P+ D+R   L R F+V  +P LV IG+
Sbjct  231  KAKGERFEIVLITIDQDEELYKEALRKVPWFALPFRDNRCDKLIRYFEVSTLPTLVIIGQ  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +   N V  HG   YPFT
Sbjct  291  DGKTLYSNVANAVDEHGFLPYPFT  314



>ref|XP_006836608.1| hypothetical protein AMTR_s00131p00112160 [Amborella trichopoda]
 gb|ERM99461.1| hypothetical protein AMTR_s00131p00112160 [Amborella trichopoda]
Length=559

 Score =   147 bits (372),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 106/153 (69%), Gaps = 4/153 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+D  FE++FIS D+D++SF++F   MPWLA+PYGD   G L +LFK+  +P LV +G+
Sbjct  400  KARDPNFEIVFISGDQDEASFNDFLWDMPWLALPYGDMAVGKLLQLFKIASVPTLVVVGK  459

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G  +++ A  L+  HG  +YPFT    ++   E +E  + WP+ MN ++H EH L+ T+
Sbjct  460  DGGLVSSNAIKLLWKHGPRSYPFT----EKRLKEIKEEVRNWPKHMNLSVHSEHPLVFTK  515

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
             + Y CDGCN+GG GW++YC  CD+DLHP+CAL
Sbjct  516  GRWYICDGCNKGGFGWTYYCKKCDYDLHPECAL  548


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 55/78 (71%), Gaps = 1/78 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+S D ++ SF+E+FSKMPWLAIP+ D + +  L + FKV  IP L+ +G+ G+ L
Sbjct  85   FEVVFVSLDSEEKSFEEYFSKMPWLAIPFSDSKTRSKLEKDFKVSSIPHLIIVGKDGKIL  144

Query  513  TTEARNLVMSHGADAYPF  460
            TT   ++  ++G D YPF
Sbjct  145  TTGGVDIASNYGVDGYPF  162


 Score = 82.0 bits (201),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FE++ +SSD    SF++ FS MPW A+P+ D     L+R+F+++G P L+ +G 
Sbjct  240  KENGENFEIVLVSSDLKLESFNKHFSSMPWFALPFQDTALTRLTRIFQIQGFPTLLVVGP  299

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL  +A   +  HG +AYPFT
Sbjct  300  DGKTLKDDAVGAIEEHGVEAYPFT  323



>emb|CBI28541.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   144 bits (364),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD+DQ+SFDEFFS MPWLA+P+GD RK SLSR FKV GIP L+AIG 
Sbjct  390  KTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDKRKASLSRTFKVHGIPSLIAIGP  449

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TGRT+TTEARNLVM HGADAYPFT
Sbjct  450  TGRTVTTEARNLVMIHGADAYPFT  473


 Score = 90.5 bits (223),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 59/84 (70%), Gaps = 1/84 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGR  529
            + +D FE+IF+S D D  SF+ +FSKMPWLAIP+ D D +  L+ LFKV GIP LV +  
Sbjct  70   SSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVMLDE  129

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +G+ L+ +  +++  +G +AYPFT
Sbjct  130  SGKVLSEDGVDIIQEYGVEAYPFT  153


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +AK ++FE++ IS D ++ SF ++F  MPWLA+P+ D     L+R F++  +P LV IG 
Sbjct  230  RAKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDKSCEKLARYFELSALPTLVVIGP  289

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG  AYPFT
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPFT  313



>ref|NP_001130856.1| hypothetical protein [Zea mays]
 gb|ACF79225.1| unknown [Zea mays]
 gb|ACF87677.1| unknown [Zea mays]
 gb|ACN29161.1| unknown [Zea mays]
 tpg|DAA45730.1| TPA: hypothetical protein ZEAMMB73_073655 [Zea mays]
Length=580

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 87/159 (55%), Positives = 111/159 (70%), Gaps = 6/159 (4%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+  FEV+FIS DRDQ SFDE+FS+MPWLA+P+ D+R   L   FK RG P+LV IG 
Sbjct  394  KEKNSDFEVVFISHDRDQRSFDEYFSEMPWLAVPWEDERTAPLKTTFKARGFPILVVIGP  453

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaey--eemaKGWPEKMNhalheehellL  355
             G+T++ +A  L++ HGADA+PFTEERL+EL+ +      A GWP+K+ H LH EHEL+L
Sbjct  454  NGKTVSWDATELLVVHGADAFPFTEERLEELQKKVDEMAKAMGWPKKLKHELHGEHELVL  513

Query  354  TRR--QHYTCDGCNEGGQGWSFYCD--DCDFDLHPKCAL  250
              R    Y CD C + G  W + CD  +CDFDLHPKCAL
Sbjct  514  QYRGTDTYACDRCVQMGSSWVYTCDCEECDFDLHPKCAL  552


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+ +S   ++SSF+E F+KMPWLAIP+GD++  +L+R F    +P LV IG 
Sbjct  231  KEVGEKFEVVAVSIYSEESSFNESFAKMPWLAIPHGDNKCLTLTRYFGFMSLPTLVLIGP  290

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL      +++ HG D    +PF+
Sbjct  291  DGKTLNNNVAEIIIDHGFDVWEGFPFS  317


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 2/81 (2%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAI-GRTGR  520
            +FEVIF   D  + +F+E+F+KMPWLA+P+ D +R+ +L   FKV   P LV +  +TG 
Sbjct  74   SFEVIFAWGDLKEKTFNEYFAKMPWLALPFSDIERREALDIRFKVTDTPHLVILDAKTGE  133

Query  519  TLTTEARNLVMSHGADAYPFT  457
              T +   +V  +G DAYPFT
Sbjct  134  VYTKDGVRIVSEYGVDAYPFT  154



>ref|XP_010023551.1| PREDICTED: probable nucleoredoxin 1 isoform X4 [Eucalyptus grandis]
Length=486

 Score =   140 bits (352),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIF+SSD+DQ++FD +F++MPWLA+P+GD+RK SLSR FKVRGIP L+AIG 
Sbjct  392  KAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDERKKSLSRKFKVRGIPTLIAIGP  451

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TGRTLT +ARNL+M HGADA+PFT
Sbjct  452  TGRTLTNKARNLIMEHGADAHPFT  475


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFIS+D+D+ SF  +FSKMPWLAIP+ D D++  L  LFKVRGIP LV +   G  L
Sbjct  77   LEIIFISADKDEGSFSGYFSKMPWLAIPFSDSDKRNGLDELFKVRGIPHLVILDGNGTVL  136

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   +V  +G + YPFT
Sbjct  137  TDEGDKIVREYGVEGYPFT  155


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK ++FE++ I    D++SF++ F  +PWL++P  D +   L   F++  +P LV IG 
Sbjct  232  KAKGESFEIVQIPLGDDEASFNQTFESLPWLSLPLKDKKCEKLVTYFELLTVPTLVIIGP  291

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+ +     V  HG  AYPFT
Sbjct  292  DGKTMHSNVAETVEEHGVAAYPFT  315



>ref|XP_010023554.1| PREDICTED: probable nucleoredoxin 1 isoform X6 [Eucalyptus grandis]
 gb|KCW59848.1| hypothetical protein EUGRSUZ_H02588 [Eucalyptus grandis]
Length=485

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIF+SSD+DQ++FD +F++MPWLA+P+GD+RK SLSR FKVRGIP L+AIG 
Sbjct  391  KAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDERKKSLSRKFKVRGIPTLIAIGP  450

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TGRTLT +ARNL+M HGADA+PFT
Sbjct  451  TGRTLTNKARNLIMEHGADAHPFT  474


 Score = 90.9 bits (224),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFIS+D+D+ SF  +FSKMPWLAIP+ D D++  L  LFKVRGIP LV +   G  L
Sbjct  76   LEIIFISADKDEGSFSGYFSKMPWLAIPFSDSDKRNGLDELFKVRGIPHLVILDGNGTVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   +V  +G + YPFT
Sbjct  136  TDEGDKIVREYGVEGYPFT  154


 Score = 71.2 bits (173),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK ++FE++ I    D++SF++ F  +PWL++P  D +   L   F++  +P LV IG 
Sbjct  231  KAKGESFEIVQIPLGDDEASFNQTFESLPWLSLPLKDKKCEKLVTYFELLTVPTLVIIGP  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+ +     V  HG  AYPFT
Sbjct  291  DGKTMHSNVAETVEEHGVAAYPFT  314



>ref|XP_010023552.1| PREDICTED: probable nucleoredoxin 1 isoform X5 [Eucalyptus grandis]
Length=485

 Score =   139 bits (351),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIF+SSD+DQ++FD +F++MPWLA+P+GD+RK SLSR FKVRGIP L+AIG 
Sbjct  391  KAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDERKKSLSRKFKVRGIPTLIAIGP  450

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TGRTLT +ARNL+M HGADA+PFT
Sbjct  451  TGRTLTNKARNLIMEHGADAHPFT  474


 Score = 89.7 bits (221),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFIS+D+D+ SF  +FSKMPWLAIP+ D D++ SL  LFKVRGIP LV +  TG  L
Sbjct  76   LEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRGIPHLVILDGTGTVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +V  +G + +PFT
Sbjct  136  TDSGVAIVREYGVEGHPFT  154


 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA+ ++FE++ I  D D++SF++ F  MPWL++P+ D +   L R FK+  +P LV IG+
Sbjct  231  KARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKCEKLVRYFKLSTLPTLVIIGQ  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+       V  HG  AYPFT
Sbjct  291  DGKTVHANVAETVEEHGITAYPFT  314



>emb|CBI28535.3| unnamed protein product [Vitis vinifera]
Length=617

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 77/84 (92%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD  FEVIFISSDRDQ+SFD+FFS+MPWLA+P+GD+RK SLS++FKV+GIP +VAIG 
Sbjct  467  KAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDERKESLSKMFKVQGIPKVVAIGP  526

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TGRT+TT+AR+LV  HGADAYPFT
Sbjct  527  TGRTITTQARDLVADHGADAYPFT  550


 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE+ F+S+D D   F E+FS+MPWLAIP+ D D +  L  LF+V GIP LV IG  G+ L
Sbjct  152  FEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPHLVIIGENGKVL  211

Query  513  TTEARNLVMSHGADAYPFT  457
            T     ++  +G + +PFT
Sbjct  212  TDSGVEIIREYGVEGFPFT  230


 Score = 72.8 bits (177),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KA  ++FE++ IS D D+ SF+E F  MP  A+P+ D+    L+R F++  +P LV IG 
Sbjct  307  KAMGESFEIVLISFDDDEESFNEGFGSMPCFALPFKDESCRKLARYFELSTVPTLVMIGP  366

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  +G  AYPFT
Sbjct  367  DGKTLHSNVVEAIEEYGIQAYPFT  390



>gb|ABK25089.1| unknown [Picea sitchensis]
Length=398

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/153 (44%), Positives = 106/153 (69%), Gaps = 1/153 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + + FEV+FISSD  Q +F++++S MPWLA+P+GD  K  L+R F+V GIP ++ +G 
Sbjct  238  KERGEVFEVVFISSDEHQDAFEDYYSSMPWLALPFGDKTKKDLTRHFRVEGIPTMIVLGP  297

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T +A ++V  HG+ AYPFT+ +L  L+ E E++A+  P+++      EH L+L +
Sbjct  298  NGKTVTDDAISVVSIHGSKAYPFTDAQLIRLQKEIEDLAEKSPKEIQ-YSQHEHPLVLVQ  356

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
               + CDGC+E G  WS+YC +CD+D+H  CAL
Sbjct  357  SDAFNCDGCDEEGSAWSYYCKECDYDIHLTCAL  389


 Score = 79.7 bits (195),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FIS+D D+ SF+++   MPWLA+P+ D+  +  L + F+V  IP LV I + G+ +
Sbjct  83   FEIVFISADVDEKSFEKYHRIMPWLALPFSDENTRQKLEQAFQVNSIPCLVVIDKEGKVV  142

Query  513  TTEARNLVMSHGADAYPFT  457
            TTE   ++  +G +AYPF+
Sbjct  143  TTEGVKIIGDYGVEAYPFS  161



>ref|XP_002968070.1| hypothetical protein SELMODRAFT_440252 [Selaginella moellendorffii]
 gb|EFJ30324.1| hypothetical protein SELMODRAFT_440252 [Selaginella moellendorffii]
Length=596

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 118/193 (61%), Gaps = 10/193 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K K+  FE+IF+SSDRD+ +F  +F+ MPWLA+P+ D + K  LS  F+V GIP LV +G
Sbjct  405  KQKNAEFEIIFVSSDRDEEAFKSYFASMPWLALPFSDRESKSELSSYFEVEGIPTLVILG  464

Query  531  RTGRTLTTEARNLVMSHGADAYPFT----eerlkeleaeyeemaKGWPEKMNhalheehe  364
              G+TLT   R LV ++ A A+PFT    E    +   E   +A   P+++ H+ H EH 
Sbjct  465  PDGKTLTAAGRRLVGAYKAAAFPFTGSHIEALTSKEMEEANAVAAQLPKEITHSSHPEHP  524

Query  363  llLTRRQH---YTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKT  193
            L L    +   Y CD C++ G GW ++C +C FD+HPKCA  + + E  + E Q+     
Sbjct  525  LALVVSAYKGPYGCDVCDQDGTGWVYHCAECSFDIHPKCA--KPEIEKKKAEEQEGGGAK  582

Query  192  KEGWVCDGEVCKK  154
            KEGWVC+G+VCKK
Sbjct  583  KEGWVCEGDVCKK  595


 Score = 96.3 bits (238),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIG  532
            K K + FEV+F+S+D D+ +F+E+  +MPWLAIP+ D + +  L R+F + GIP LV +G
Sbjct  244  KDKGEEFEVVFVSADNDEDAFEEYHKEMPWLAIPFSDSKTRKQLDRIFDIGGIPSLVVLG  303

Query  531  RTGRTLTTEARNLVMSHGADAYPFT  457
            + G+T+ T+A  LV  HG DAYPFT
Sbjct  304  KDGKTVHTDAVQLVSKHGVDAYPFT  328



>ref|XP_002965590.1| hypothetical protein SELMODRAFT_143457 [Selaginella moellendorffii]
 gb|EFJ33010.1| hypothetical protein SELMODRAFT_143457 [Selaginella moellendorffii]
Length=490

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 83/193 (43%), Positives = 121/193 (63%), Gaps = 10/193 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K K+  FE+IF+SSDRD+ +F  +F+ MPWLA+P+ D + K  LS  F+V GIP LV +G
Sbjct  299  KQKNAEFEIIFVSSDRDEGAFKSYFASMPWLALPFSDRESKSELSSYFEVEGIPTLVILG  358

Query  531  RTGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKG----WPEKMNhalheehe  364
              G+TLT   R LV ++ A A+PFT   ++ L+++  E A       P+++ H+ H EH 
Sbjct  359  PDGKTLTAAGRRLVGAYKAAAFPFTGSHIEALKSKEMEEANAVAAQLPKEITHSSHPEHP  418

Query  363  llLTRRQH---YTCDGCNEGGQGWSFYCDDCDFDLHPKCALeekkeepteeesqkddEKT  193
            L L    +   Y CD C++ G GW ++C +C FD+HPKCA  + + E  + E Q+     
Sbjct  419  LALVVSAYKGPYGCDVCDQDGTGWVYHCAECSFDIHPKCA--KPEIEKKKAEEQEGGGAK  476

Query  192  KEGWVCDGEVCKK  154
            KEGWVC+G+VCKK
Sbjct  477  KEGWVCEGDVCKK  489


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 61/85 (72%), Gaps = 1/85 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIG  532
            K K + FEV+F+S+D D+ +F+E+  +MPWLAIP+ D + +  L R+F + GIP LV +G
Sbjct  138  KDKGEEFEVVFVSADNDEDAFEEYHKEMPWLAIPFSDSKTRKQLDRIFDIGGIPSLVVLG  197

Query  531  RTGRTLTTEARNLVMSHGADAYPFT  457
            + G+T+ T+A  LV  HG DAYPFT
Sbjct  198  KDGKTVHTDAVQLVSKHGVDAYPFT  222



>ref|XP_010243058.1| PREDICTED: probable nucleoredoxin 1 [Nelumbo nucifera]
Length=498

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/84 (74%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSDRDQ SFD+F+S MPWLA+PYGD+RK SLSR FK+ GIP ++AIG 
Sbjct  386  KAKDDAFEVIFISSDRDQKSFDDFYSGMPWLALPYGDERKQSLSRWFKIEGIPTVIAIGP  445

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +GRT+T +AR L+M+HGA AYPFT
Sbjct  446  SGRTVTMDARALLMTHGAAAYPFT  469


 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 57/79 (72%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDD-RKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSDRD  SF ++FS+MPWLAIP+ D   +  L  LF+VRGIP LV +  TG+ L
Sbjct  71   FEVVFVSSDRDDDSFGKYFSEMPWLAIPFADSGARQRLKELFQVRGIPNLVVLDGTGKVL  130

Query  513  TTEARNLVMSHGADAYPFT  457
            +  A  +V  +GA+AYPFT
Sbjct  131  SERAVQIVRDYGAEAYPFT  149


 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   +AFEV+ IS   ++ SF + F  MPW A+P+ D     L R F++R +P LV +G 
Sbjct  226  KENGEAFEVVLISLGYEEESFRQDFESMPWFALPFKDKLCEKLIRYFELRALPTLVIVGP  285

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+ +    LV  HG  AYPF+
Sbjct  286  DGKTINSNVAELVEDHGILAYPFS  309



>emb|CDP13168.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKDDAFEVIFISSD +QSSFD+FFS MPWLA+P+GD+RK  L R FK++GIP +VAIG 
Sbjct  391  KAKDDAFEVIFISSDHNQSSFDDFFSGMPWLALPFGDERKALLQRRFKIKGIPAVVAIGP  450

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             GRT++T+AR L+ +HGADAYPFT
Sbjct  451  NGRTVSTQARQLIQAHGADAYPFT  474


 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 56/79 (71%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+SSDRD+ SF+ +F KMPWLA P+ + + + SL  LFKVRGIP LV +  +GR  
Sbjct  76   FEVVFVSSDRDEESFNAYFKKMPWLAFPFAESETRQSLKELFKVRGIPHLVILDGSGRVS  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   ++  HGAD YP+T
Sbjct  136  TEEGVRIIYDHGADGYPYT  154


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + K +AFE++ +S D D+  F   +  M WLA+P+ D     L R F++  +P LV IG 
Sbjct  231  REKGEAFELVLVSLDDDEQEFKNCYEPMTWLALPFKDKTCDKLVRHFELGTLPTLVVIGP  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     +  HG +AYPFT
Sbjct  291  DGKTLHSNVVESIEEHGDEAYPFT  314



>ref|XP_010913793.1| PREDICTED: probable nucleoredoxin 3 [Elaeis guineensis]
Length=387

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 96/151 (64%), Gaps = 1/151 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            AK+++F++IFIS+DRD+  F     +MPWLAIPY D  +  LSR+F V+GIP LV +G  
Sbjct  233  AKNESFQIIFISTDRDEDEFQSSLEEMPWLAIPYADKTRYDLSRIFDVKGIPRLVLLGAD  292

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ L T+ R ++ S+GA A+PFTE R  E+EA   +  +G P ++  + H+    L   +
Sbjct  293  GKVLGTDGRAMISSYGAKAFPFTESRAAEVEAALRKEGEGLPGEVKDSRHQHILKLDVAK  352

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
              Y CD C   G+ W F CD CDFDLHP CA
Sbjct  353  A-YVCDACRRQGRYWVFSCDRCDFDLHPACA  382


 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/77 (40%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++F+S DRD++SF + F  MPWLA+P+  + +  LS    +  IP L+ +   GRT  
Sbjct  77   LEIVFVSLDRDENSFLDHFKHMPWLAVPFDVNIRKQLSGRLLIEHIPSLIPLAPDGRTKK  136

Query  510  TEARNLVMSHGADAYPF  460
             +A  LV   G DA+PF
Sbjct  137  EDAVQLVEDFGPDAFPF  153



>ref|XP_010023550.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Eucalyptus grandis]
Length=525

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK++AFE+IFISSD+DQ++FD ++++MPWLA+P+GD+RK SL+R FKV GIP L+AIG 
Sbjct  391  KAKNNAFELIFISSDKDQAAFDNYYAQMPWLALPFGDERKKSLNRKFKVDGIPTLIAIGP  450

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TGRTLT EARNL+  HGADAYPFT
Sbjct  451  TGRTLTKEARNLISEHGADAYPFT  474


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFIS+D D+ SF  +FSKMPWLAIP+ D +++ SL  LF+VRGIP LV +  TG  L
Sbjct  76   LEIIFISADEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFEVRGIPHLVFLDGTGTVL  135

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +V  +G + +PFT
Sbjct  136  TDSGVEIVREYGVEGHPFT  154


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FE++ I  D D+ SF++ F  MPWL++P  D +   L R F++  +P LV IG 
Sbjct  231  KAKGERFEIVQIPLDDDEESFNQAFGSMPWLSLPLKDKKCEKLVRYFELSTLPTLVIIGP  290

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     V  HG +AYPFT
Sbjct  291  DGKTLHSNVAETVEEHGVEAYPFT  314



>ref|XP_010023549.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Eucalyptus grandis]
 gb|KCW59849.1| hypothetical protein EUGRSUZ_H02589 [Eucalyptus grandis]
Length=526

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK++AFE+IFISSD+DQ++FD ++++MPWLA+P+GD+RK SL+R FKV GIP L+AIG 
Sbjct  392  KAKNNAFELIFISSDKDQAAFDNYYAQMPWLALPFGDERKKSLNRKFKVDGIPTLIAIGP  451

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TGRTLT EARNL+  HGADAYPFT
Sbjct  452  TGRTLTKEARNLISEHGADAYPFT  475


 Score = 85.9 bits (211),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
             E+IFIS+D D+ SF  +FSKMPWLAIP+ D +++ SL  LF+VRGIP LV +  TG  L
Sbjct  77   LEIIFISADEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFEVRGIPHLVFLDGTGTVL  136

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +V  +G + +PFT
Sbjct  137  TDSGVEIVREYGVEGHPFT  155


 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK + FE++ I  D D+ SF++ F  MPWL++P  D +   L R F++  +P LV IG 
Sbjct  232  KAKGERFEIVQIPLDDDEESFNQAFGSMPWLSLPLKDKKCEKLVRYFELSTLPTLVIIGP  291

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL +     V  HG +AYPFT
Sbjct  292  DGKTLHSNVAETVEEHGVEAYPFT  315



>gb|AAS02080.1| protein disulfide isomerase [Quercus suber]
Length=506

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFE+IFISSDRDQSSFDEFF+ MPWLA+P+GD RK  L+R FK++GIP  VAIG 
Sbjct  388  KEKDNAFEIIFISSDRDQSSFDEFFAGMPWLALPFGDKRKSFLARKFKIQGIPAAVAIGP  447

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +GRT+T EAR L+ +HGADAYPFT
Sbjct  448  SGRTVTKEARQLITAHGADAYPFT  471


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDR+  SF+ + +KMPWLAIP+ D + +  L  LFKVRGIP L+ +  TG+ +
Sbjct  75   FEVVFISSDRNDESFNGYLAKMPWLAIPFSDSETRKRLKELFKVRGIPNLIFLDATGKVV  134

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   ++  +G D YPFT
Sbjct  135  TNQGVRIIGEYGVDGYPFT  153


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + ++FE++ IS D +++ F E F+ MPWLA+P+ D     L+R F +  +P +V IG 
Sbjct  228  KERGESFEIVLISLDDEENDFKEGFNTMPWLAVPFKDKCCEKLARYFDLETLPTVVVIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  288  DGKTLNPNVAELIEEHGIEAYPFT  311



>emb|CAC87937.1| PDI-like protein [Quercus suber]
Length=506

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFE+IFISSDRDQSSFDEFF+ MPWLA+P+GD RK  L+R FK++GIP  VAIG 
Sbjct  388  KEKDNAFEIIFISSDRDQSSFDEFFAGMPWLALPFGDKRKSFLARKFKIQGIPAAVAIGP  447

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +GRT+T EAR L+ +HGADAYPFT
Sbjct  448  SGRTVTKEARQLITAHGADAYPFT  471


 Score = 88.2 bits (217),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDR+  SF+ + +KMPWLAIP+ D + +  L  LFKVRGIP L+ +  TG+ +
Sbjct  75   FEVVFISSDRNDESFNGYLAKMPWLAIPFSDSETRKRLKELFKVRGIPNLIFLDATGKVV  134

Query  513  TTEARNLVMSHGADAYPFT  457
            T +   ++  +G D YPFT
Sbjct  135  TNQGVRIIGEYGVDGYPFT  153


 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + ++FE++ IS D +++ F E F+ MPWLA+P+ D     L+R F +  +P +V IG 
Sbjct  228  KERGESFEIVLISLDDEENDFKEGFNTMPWLAVPFKDKCCEKLARYFDLETLPTVVVIGP  287

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  288  DGKTLNPNVAELIEEHGIEAYPFT  311



>ref|XP_009405027.1| PREDICTED: probable nucleoredoxin 1-1, partial [Musa acuminata 
subsp. malaccensis]
Length=705

 Score =   134 bits (336),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 84/154 (55%), Positives = 106/154 (69%), Gaps = 2/154 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGI-PMLVAIG  532
            K  D AFEV+ IS D+DQ SF+EFFS MPWL++P+GD+RK SL R F+   I P LVAIG
Sbjct  508  KHMDSAFEVVNISMDKDQDSFEEFFSGMPWLSLPFGDERKKSLKRTFQADIIYPSLVAIG  567

Query  531  RTGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLT  352
             TGRT T  A + + +HGADAYPF+EER+KEL+ + +EMAKGWPEK  H  H+  +L  +
Sbjct  568  PTGRTSTRNAMHSLATHGADAYPFSEERIKELDQKIDEMAKGWPEKRKHEQHKHGKLEWS  627

Query  351  -RRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                 Y C  C++ G GW + C  C F LHPKCA
Sbjct  628  CLHGLYMCRDCHKIGSGWCYLCSMCSFGLHPKCA  661


 Score = 78.6 bits (192),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  D AFEVIF+      S   EFF +MPWLA+P  DDR GSL    +   +  LV IG 
Sbjct  355  KRMDSAFEVIFVPMGYMDSGAFEFFFRMPWLAVPVDDDRIGSLENTLEAHYVNTLVVIGP  414

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TG+T+T  A   +  +GADAYPF+
Sbjct  415  TGQTITKNAATSLKMYGADAYPFS  438


 Score = 56.2 bits (134),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 51/89 (57%), Gaps = 5/89 (6%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKV--RGIPMLVAI  535
            K   ++FEV+ +  D D+SS+++  + MPWLAIP+ D+    L R F++    +P ++ I
Sbjct  193  KEAGESFEVVLVPLDDDKSSYEQGLASMPWLAIPFEDEGCEKLVRYFELWPFQLPTVLVI  252

Query  534  GRTGRTLTTEARNLVMSHGA---DAYPFT  457
            G  G+ +      L+  +G    +A+PF+
Sbjct  253  GADGKIMLKNYDRLISKYGVLAWEAFPFS  281


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/86 (30%), Positives = 43/86 (50%), Gaps = 11/86 (13%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD--------DRKGSLSRLFKVRGIPMLVAI  535
            FE++F+S D  + +F+ +FS MPWLA+P+ D        D  GS    +  +   +++  
Sbjct  34   FEIVFVSCDSCEETFNRYFSDMPWLAVPFADSDTRERLHDHFGSFEEYYPAQ---LIIYD  90

Query  534  GRTGRTLTTEARNLVMSHGADAYPFT  457
               G  +  E    V  +G + YPFT
Sbjct  91   ASIGMVVNEEGLRAVAKYGVNGYPFT  116



>ref|XP_010682544.1| PREDICTED: probable nucleoredoxin 1 [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK+ AFE+IF+SSDRDQ SFDE++S MPWLA+P+GD+RK  LSR FKV+GIP LVAIG 
Sbjct  393  KAKESAFEIIFVSSDRDQPSFDEYYSDMPWLALPFGDERKAYLSRKFKVKGIPCLVAIGP  452

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+TTE R L+ +HGADA+PFT
Sbjct  453  EGKTITTETRQLIGAHGADAFPFT  476


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRK-GSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++FISSDRD+ SF  +FSKMPWLAIP  D+    SL   F V GIP LV + + G+  
Sbjct  77   FEIVFISSDRDEESFQGYFSKMPWLAIPLSDNATIKSLKEKFSVMGIPHLVFLDKDGKIS  136

Query  513  TTEARNLVMSHGADAYPFT  457
            T E   +VM H A+AYPFT
Sbjct  137  TDEGVEVVMEHEAEAYPFT  155


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 1/81 (1%)
 Frame = -3

Query  696  DAFEVIFISSDRD-QSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            + FE++ I  D D +  F E  + MPWL++P+ D +   L R F++R IP LV IG  G+
Sbjct  236  ENFEIVLIYLDEDDEGGFKENLADMPWLSLPFKDKKIEKLVRYFELRSIPRLVIIGPDGK  295

Query  519  TLTTEARNLVMSHGADAYPFT  457
            TL  +   L+  HGA AYPF+
Sbjct  296  TLNPDVAELIQEHGAAAYPFS  316



>ref|XP_010937315.1| PREDICTED: probable nucleoredoxin 1-2 [Elaeis guineensis]
Length=519

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFEV+FIS D DQ+SF++FFS MPWLA+P+GD RK SLSRLFK+RGIP LVAIG 
Sbjct  401  KDKDSAFEVVFISDDEDQNSFEDFFSGMPWLALPFGDVRKKSLSRLFKIRGIPSLVAIGP  460

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TG+T+TT+A+ L++ HGADAYPFT
Sbjct  461  TGKTVTTDAKLLLLIHGADAYPFT  484


 Score = 87.0 bits (214),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
             EV+F+S DRD+ SF+ +FSKMPWLAIP+ D + +  L++LFKVRGIP LV +   G  +
Sbjct  83   LEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDQLNKLFKVRGIPHLVILDARGEVV  142

Query  513  TTEARNLVMSHGADAYPFT  457
              E    V  +G+ AYPFT
Sbjct  143  NEEGVEAVRDYGSGAYPFT  161


 Score = 77.4 bits (189),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + ++FEV+ +S D ++SSF E F+ MPWLAIP+ D  +  L R F++   P LV +G 
Sbjct  238  KERGESFEVVLVSLDDEESSFKEGFASMPWLAIPFEDKSRERLVRYFELETAPTLVVLGP  297

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL T    LV  HG +A   +PF+
Sbjct  298  DGKTLHTNIAELVEEHGEEAWEGFPFS  324



>ref|XP_009626674.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana tomentosiformis]
Length=520

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K+   EVIFISSD+DQ+SFD++F+ MPWLA+P+GD+RK SLSRLFKV+GIP LVAIG 
Sbjct  388  KTKNGPLEVIFISSDQDQASFDDYFATMPWLALPFGDERKASLSRLFKVQGIPTLVAIGP  447

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+T+TT ARN++M HGA+A+PFT
Sbjct  448  LGKTITTGARNMIMRHGAEAFPFT  471


 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+++D D  SF E+FSKMPWLA+P+ D + +  L+ LF V+GIP LV +   G+ +
Sbjct  71   FEVVFLTADEDDESFKEYFSKMPWLAVPFSDSETRKRLNELFAVKGIPHLVILDDCGKVV  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +++ HG + YPFT
Sbjct  131  TDNGVEIILEHGVEGYPFT  149


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSD--RDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAI  535
            KA+ + FEV+ I  D   D  SF + F+ MPW ++P  D     L+R F++  +P LV I
Sbjct  226  KAQGENFEVVMIPLDGEDDDESFKKEFASMPWYSLPLKDRTCEKLARYFELSTLPTLVII  285

Query  534  GRTGRTLTTEARNLVMSHGADAYPFT  457
            G  G+TL +     +  HG  AYPFT
Sbjct  286  GTDGKTLHSNVAEAIEEHGILAYPFT  311



>ref|XP_009762378.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana sylvestris]
Length=520

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAK    EVIFISSD+DQ+SFD++F+ MPWLA+P+GD+RK SLSRLFKV+GIP LVAIG 
Sbjct  388  KAKSGPLEVIFISSDQDQASFDDYFATMPWLALPFGDERKASLSRLFKVQGIPTLVAIGP  447

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +G+T+TT AR+++M HGA+A+PFT
Sbjct  448  SGKTITTGARSMIMRHGAEAFPFT  471


 Score = 87.4 bits (215),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 54/79 (68%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+F+++D D  SF E+FSKMPWLA+P+ D + +  L  LF V+GIP LV +  +G+ +
Sbjct  71   FEVVFLTADEDDKSFKEYFSKMPWLAVPFSDSETRKRLDELFAVKGIPHLVILDDSGKVV  130

Query  513  TTEARNLVMSHGADAYPFT  457
            T     +++ HG + YPFT
Sbjct  131  TDNGVEIILEHGVEGYPFT  149


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 48/86 (56%), Gaps = 2/86 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQ--SSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAI  535
            KA+ + FEV+ I  D +    SF + F+ MPW ++P  D     L+R F++  +P LV I
Sbjct  226  KAQGENFEVVMIPLDGEDGDESFKKEFASMPWYSLPLKDRTCEKLARYFELSTLPTLVII  285

Query  534  GRTGRTLTTEARNLVMSHGADAYPFT  457
            G  G+TL +     +  HG  AYPFT
Sbjct  286  GTDGKTLHSNVAEAIEEHGILAYPFT  311



>ref|XP_010937313.1| PREDICTED: probable nucleoredoxin 1-2 [Elaeis guineensis]
Length=519

 Score =   128 bits (322),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD AFEV+FIS D DQ+SF++FFS MPWLA+P+GD RK SL+RLFK+RGIP LVAIG 
Sbjct  401  KDKDSAFEVVFISDDEDQNSFEDFFSGMPWLALPFGDVRKKSLNRLFKIRGIPSLVAIGP  460

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            TG+T+TT+A+ L++ HGADAYPFT
Sbjct  461  TGKTVTTDAKLLLLIHGADAYPFT  484


 Score = 87.4 bits (215),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/80 (50%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRT  517
              EV+F+S DRD+ SF+ +FSKMPWLAIP+ D + +  L++LFKVRGIP LV +   G  
Sbjct  82   GLEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDQLNKLFKVRGIPHLVILDARGEV  141

Query  516  LTTEARNLVMSHGADAYPFT  457
            +  E    V  +G+ AYPFT
Sbjct  142  VNEEGVEAVRDYGSGAYPFT  161


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 52/87 (60%), Gaps = 3/87 (3%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + ++FEV+ +S D ++SSF E F+ MPWLAIP+ D  +  L   F+    P LV +G 
Sbjct  238  KERGESFEVVLVSLDDEESSFKEGFASMPWLAIPFEDKSRERLVHYFEFETPPTLVVLGP  297

Query  528  TGRTLTTEARNLVMSHGADA---YPFT  457
             G+TL T    LV  HG +A   +PF+
Sbjct  298  DGKTLHTNIAELVEEHGEEAWEGFPFS  324



>ref|XP_011014070.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=539

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/106 (64%), Positives = 84/106 (79%), Gaps = 1/106 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            KAKD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD+RK  L R FK+ GIP  VAIG 
Sbjct  387  KAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDERKQILGRKFKIEGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKM  391
            +GRT+T EAR  + ++GADA+PFT E   +   E EE AKGWPEK+
Sbjct  447  SGRTITKEARMHLTAYGADAFPFT-EEHLKQLEELEEKAKGWPEKV  491


 Score = 84.3 bits (207),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/79 (51%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDSGVSTVKEHGVDGYPFN  150


 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            K + FEV+ IS D ++ +F E F  MPWLA+P+ D     L R F++R IP LV IG+ G
Sbjct  229  KRENFEVVLISLDDEEENFKESFETMPWLALPFKDKSCEKLVRYFELRTIPNLVIIGQDG  288

Query  522  RTLTTEARNLVMSHGADAYPFT  457
            +TL      L+  HG +AYPFT
Sbjct  289  KTLNPNVAELIEDHGIEAYPFT  310



>ref|XP_010091604.1| putative nucleoredoxin 1-1 [Morus notabilis]
 gb|EXB44870.1| putative nucleoredoxin 1-1 [Morus notabilis]
Length=558

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/156 (52%), Positives = 111/156 (71%), Gaps = 5/156 (3%)
 Frame = -3

Query  702  KDDAFEVIFISSD-RDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            KD A EVIFI+++  D+ +FDE FS+MPWLA+PY D RK  + R+F++   P ++AI  +
Sbjct  395  KDKALEVIFIAANIEDEWAFDECFSRMPWLALPYRDARKKRIQRIFQLVRCPTIIAIDTS  454

Query  525  GRTLT--TEARNLVMSHGADAYPFTeerlkeleaeyeemaKG-WPEKMNhalheehellL  355
            G+ +T  T   + ++ HGA+AYPFTEER K ++ E ++MAKG WP+K+ H LH EHELLL
Sbjct  455  GQVVTNITSFHHPIIMHGAEAYPFTEERFKYMKKEVDKMAKGSWPQKLKHELHAEHELLL  514

Query  354  TR-RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
             + RQ YTC  C E G  W+F+C  C F+LHPKCAL
Sbjct  515  MKDRQLYTCSACMEFGTRWTFFCKQCKFNLHPKCAL  550


 Score = 60.5 bits (145),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 45/88 (51%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRG---IPMLVA  538
            K K + FEV+F+S D+    F +    MPWL +P+ D+   SL   F  R     P LV 
Sbjct  230  KEKGEKFEVVFLSCDQQIEEFKQGLEIMPWLTLPFKDNMAVSLWHYFDFRSDQHTPQLVI  289

Query  537  IGRTGRTLT-TEARNLVMSHGADAYPFT  457
            IG  G+TL       L+  +G DA PFT
Sbjct  290  IGPDGKTLNKNNVVALIEEYGIDADPFT  317


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 49/82 (60%), Gaps = 5/82 (6%)
 Frame = -3

Query  690  FEVIFISSDR-DQSSFDEFFSKMPWLAIPY--GDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            FEV+F+  +   +  F+++F+KMPWLAIP+   +D K  L + F++R   +++ I   G 
Sbjct  63   FEVVFVCYNAIHEEEFNDYFAKMPWLAIPFPETNDIKQRLRKWFRMRDCGLII-IHSNGE  121

Query  519  TLTTEARNLVMS-HGADAYPFT  457
             LT E  N +    G DAYPFT
Sbjct  122  ILTQETANHMTEWFGEDAYPFT  143



>ref|XP_010648454.1| PREDICTED: probable nucleoredoxin 3 [Vitis vinifera]
Length=399

 Score =   125 bits (315),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 1/150 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            ++  FE+IF+S+DRD   FD   S MPWLAIPY D  +  L R+F ++GIP LV +G  G
Sbjct  235  RNQCFEIIFVSTDRDHQEFDLSLSNMPWLAIPYEDKARQDLCRIFDIKGIPALVLLGSDG  294

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T++T  R ++ S+GA A+PFTE R  E+EA  +E     P ++    HE    L   + 
Sbjct  295  KTISTNGRAIISSYGAMAFPFTESRTTEIEAALKEEGDALPRQVKDLKHEHILKLDMAKA  354

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             Y CD C + G+ W+F CD CD+DLHP C 
Sbjct  355  -YVCDSCKKLGRFWAFSCDVCDYDLHPTCV  383


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IFIS DRD++ F E F  MPWLA+P+  D    LS  + V  IP  + +G  G+++ 
Sbjct  78   IEIIFISFDRDETGFGEHFKSMPWLAVPFNVDLHRRLSDHYHVDHIPSFIPLGLDGKSIE  137

Query  510  TEARNLVMSHGADAYPFT  457
             +A  L+  +GA A+PFT
Sbjct  138  EDAIGLIEDYGASAFPFT  155



>ref|XP_002306954.1| hypothetical protein POPTR_0005s26610g [Populus trichocarpa]
 gb|EEE93950.1| hypothetical protein POPTR_0005s26610g [Populus trichocarpa]
Length=423

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 96/155 (62%), Gaps = 3/155 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  DD FE++F+SSDRDQ+ FD +F+ MPWLA+P+GD    +L++ F V+GIP LV +G 
Sbjct  258  KGNDDDFEIVFVSSDRDQAEFDSYFNSMPWLALPFGDPANKTLAKHFDVKGIPCLVILGP  317

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNha---lheehell  358
             G+T++   RNL+  +  +AYPFTE ++  LE + +E A+  P   NHA           
Sbjct  318  DGKTVSKHGRNLINLYQENAYPFTEAQVDLLEKQMDEEAQSLPRSKNHAGHRHELTLVSE  377

Query  357  LTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             T    + C  C+E G GW++ C +C +++HPKC 
Sbjct  378  GTGGGPFICCDCDEQGSGWAYQCLECGYEVHPKCV  412


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAI-  535
            K+    FE++F+SSD D  +F+ + + MPWL+IP+ D + K +L+  F V  IP LV + 
Sbjct  87   KSNGSNFEIVFVSSDEDLDAFNNYRANMPWLSIPFSDLETKKALNSKFDVEAIPCLVILH  146

Query  534  --GRTGRTLTTEARNLVMSHGADAYPFT  457
                       +   L+   G  A+PFT
Sbjct  147  PKDNKDEATLHDGVELLHRFGVQAFPFT  174



>ref|XP_011003080.1| PREDICTED: probable nucleoredoxin 2 [Populus euphratica]
Length=423

 Score =   124 bits (310),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 96/155 (62%), Gaps = 3/155 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  DD FE++F+SSDRDQ+ FD +F+ MPWLA+P+GD    +L++ F V+GIP LV +G 
Sbjct  258  KGNDDDFEIVFVSSDRDQAEFDSYFNSMPWLALPFGDPANKTLAKHFDVKGIPCLVILGP  317

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNha---lheehell  358
             G+T++   RNL+  +  +AYPFTE ++  LE + +E A+  P   NHA           
Sbjct  318  DGKTVSKHGRNLINLYQENAYPFTEAQVDLLEKQMDEEAQSLPRSKNHAGHRHELTLVSE  377

Query  357  LTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             T    + C  C+E G GW++ C +C +++HPKC 
Sbjct  378  GTGGGPFICCDCDEQGSGWAYQCLECGYEVHPKCV  412


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAI-  535
            K+    FE++F+SSD D  +F+ + + MPWL+IP+ D + K +L+  F V  IP LV + 
Sbjct  87   KSNGSNFEIVFVSSDEDLDAFNNYRANMPWLSIPFSDLETKKALNSKFDVEAIPCLVILH  146

Query  534  --GRTGRTLTTEARNLVMSHGADAYPFT  457
                       +   L+   G  A+PFT
Sbjct  147  PKDNKDEATLHDGVELLHRFGVQAFPFT  174



>gb|KDP33411.1| hypothetical protein JCGZ_06982 [Jatropha curcas]
Length=398

 Score =   123 bits (308),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 91/150 (61%), Gaps = 1/150 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            +D  FE+I +S+DRD   F    S MPWLAIPY D  +  L R+F ++GIP LV IG  G
Sbjct  239  RDGCFEIILVSTDRDLKEFSINLSNMPWLAIPYEDRTRQDLCRIFNIKGIPALVIIGEDG  298

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T+TT+ ++++  +GA A+PFTE R+ E+EA  +      P ++    H+    L   + 
Sbjct  299  KTITTDGKSMISLYGAKAFPFTERRIAEIEAGLKIEGDALPRQLKDVKHQHELKLDMAKA  358

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             Y CD C   G+ W+F CD CD+DLHP CA
Sbjct  359  -YVCDYCKRQGRFWAFSCDACDYDLHPSCA  387


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/84 (33%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            +A+    E++ +S DRD+  F E F  MPWLA+P+  +  G L  ++ V  IP   ++  
Sbjct  76   RAEGKKLEIVLVSFDRDEDGFKEHFKCMPWLAVPFDLELHGQLRDVYGVDRIPSFFSLAS  135

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G ++  +   L+  +GA+A+PFT
Sbjct  136  DGISIEEDLIGLIEDYGAEAFPFT  159



>ref|XP_010263377.1| PREDICTED: probable nucleoredoxin 3 [Nelumbo nucifera]
 ref|XP_010263378.1| PREDICTED: probable nucleoredoxin 3 [Nelumbo nucifera]
Length=387

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 90/151 (60%), Gaps = 1/151 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
             ++   E+IFIS+DRDQ  FD     MPWLAIPYGD  +  L R+F ++GIP LV +G  
Sbjct  234  TQNKNLEIIFISTDRDQEEFDLNIRTMPWLAIPYGDRTRQDLCRIFDIKGIPALVLLGPD  293

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ L T  R L+ S+GA A+PFT+ R+ E+EA   +     P+++  + HE    L   +
Sbjct  294  GKILNTNGRALISSYGAKAFPFTKTRIDEIEAALRKEGDALPKQVKDSKHEHILKLDMAK  353

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
              Y C+ C   G+ W F CD CD+DLHP C 
Sbjct  354  A-YVCNSCKGQGRFWVFSCDKCDYDLHPTCV  383


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IF+S DRD++ F E F  MPWLA+P+    +  L   + V  IP L+ +   G+ + 
Sbjct  78   LEIIFVSFDRDENGFREHFKCMPWLALPFDVSLRRRLCDRYHVDRIPSLIPLCMEGKLVE  137

Query  510  TEARNLVMSHGADAYPFT  457
             +A  L+  +G DA+PF+
Sbjct  138  EDAVELIEDYGIDAFPFS  155



>ref|XP_006855862.1| hypothetical protein AMTR_s00037p00109800 [Amborella trichopoda]
 gb|ERN17329.1| hypothetical protein AMTR_s00037p00109800 [Amborella trichopoda]
Length=424

 Score =   122 bits (307),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 66/154 (43%), Positives = 98/154 (64%), Gaps = 3/154 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  ++ FE++F+S DRD++ F E F  MPWLA+P+GD+R   LSR F ++GIP LV IG 
Sbjct  241  KQNNEDFEIVFVSCDRDEAGFLECFKPMPWLALPFGDERIKGLSRYFNIQGIPALVIIGP  300

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T E RNL+  H   AYPFT++ +  L+ E +E AK +P   +H+ H     L++ 
Sbjct  301  NGKTVTREGRNLINLHMEKAYPFTQDHILFLQKEMDEEAKSFPRSSHHSGHHHMLNLVSA  360

Query  348  RQ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
                  + C  C+E G GW++ C DC +++HPKC
Sbjct  361  ASGGGPFICCECDEQGSGWAYQCIDCGYEVHPKC  394


 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 59/85 (69%), Gaps = 1/85 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIG  532
            K +D  FE++FIS D DQSSFD++ + MPWLAIP+ D + K SL+ +F+V GIP L+ + 
Sbjct  80   KQRDANFEIVFISCDEDQSSFDKYHATMPWLAIPFSDLKTKKSLNDMFQVEGIPCLIILD  139

Query  531  RTGRTLTTEARNLVMSHGADAYPFT  457
            +   T+ TEA  L+  +G  A+PFT
Sbjct  140  QHAHTVQTEAVELIYRYGVWAFPFT  164



>ref|XP_008781716.1| PREDICTED: probable nucleoredoxin 3 [Phoenix dactylifera]
Length=386

 Score =   122 bits (306),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 92/151 (61%), Gaps = 1/151 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            A+ ++F++I+IS+DRD+  F     +M WLAIPY D  +  LSR+F V+GIP LV +G  
Sbjct  232  ARKESFQIIYISTDRDEDEFQASLEEMAWLAIPYADKTRYDLSRIFDVKGIPRLVLLGDD  291

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ L  + R ++ S+GA A+PFTE R  E+EA   +  +G P ++    HE    L   +
Sbjct  292  GKALEADGRAMISSYGAKAFPFTESRAAEVEAALRKEGEGLPGRVKDPRHEHMLKLDVAK  351

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
              Y CD C   G+ W+F CD C+FDLHP C 
Sbjct  352  A-YVCDACRRRGRHWAFSCDRCNFDLHPACV  381


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K + +  E++F+S DRD++SF + F  MPWLA+P+  + +  LSR   +  IP L+ +  
Sbjct  70   KTQGEKLEIVFVSLDRDENSFLDHFKHMPWLAVPFDINIRKRLSRRLLIEHIPSLIPLAS  129

Query  528  TGRTLTTEARNLVMSHGADAYPF  460
             GRT+  +A  LV   G DA+PF
Sbjct  130  DGRTVKEDAVQLVEDFGPDAFPF  152



>emb|CBI20806.3| unnamed protein product [Vitis vinifera]
Length=1126

 Score =   125 bits (314),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 92/150 (61%), Gaps = 1/150 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            ++  FE+IF+S+DRD   FD   S MPWLAIPY D  +  L R+F ++GIP LV +G  G
Sbjct  235  RNQCFEIIFVSTDRDHQEFDLSLSNMPWLAIPYEDKARQDLCRIFDIKGIPALVLLGSDG  294

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T++T  R ++ S+GA A+PFTE R  E+EA  +E     P ++    HE    L   + 
Sbjct  295  KTISTNGRAIISSYGAMAFPFTESRTTEIEAALKEEGDALPRQVKDLKHEHILKLDMAKA  354

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             Y CD C + G+ W+F CD CD+DLHP C 
Sbjct  355  -YVCDSCKKLGRFWAFSCDVCDYDLHPTCV  383


 Score = 72.0 bits (175),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IFIS DRD++ F E F  MPWLA+P+  D    LS  + V  IP  + +G  G+++ 
Sbjct  78   IEIIFISFDRDETGFGEHFKSMPWLAVPFNVDLHRRLSDHYHVDHIPSFIPLGLDGKSIE  137

Query  510  TEARNLVMSHGADAYPFT  457
             +A  L+  +GA A+PFT
Sbjct  138  EDAIGLIEDYGASAFPFT  155



>ref|XP_002314536.2| hypothetical protein POPTR_0010s06970g [Populus trichocarpa]
 gb|EEF00707.2| hypothetical protein POPTR_0010s06970g [Populus trichocarpa]
Length=473

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/83 (67%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSDRDQS+FDEF+S+MPWLA+P+GD+RK  LSR FK++GIP  VAIG 
Sbjct  387  KRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDERKQILSRKFKIQGIPAAVAIGP  446

Query  528  TGRTLTTEARNLVMSHGADAYPF  460
            +GRT+T EAR  + ++GADA+P 
Sbjct  447  SGRTITKEARMHLTAYGADAFPL  469


 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ +S D ++  F E F  MPWLA+P  D     L R F++R IP LV IG+
Sbjct  227  KEKGENFEVVLLSLDDEEEDFKESFETMPWLALPLKDKSCEKLVRYFELRTIPNLVIIGQ  286

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  287  DGKTLNPNVAELIEEHGIEAYPFT  310


 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 49/79 (62%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSD D  SF+ +FS+MPWLAIP+ + + +  L  +FKVRGIP LV     G+  
Sbjct  72   FEVVFISSDGDDESFNTYFSEMPWLAIPFSETETRQRLKEVFKVRGIPRLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
                 + V  HG D YPF 
Sbjct  132  CDNGVSTVKEHGVDGYPFN  150



>ref|XP_011041504.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Populus euphratica]
Length=499

 Score =   122 bits (306),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 70/84 (83%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K KD+AFEVIFISSD DQS+FDEF+S+MPWLA+P+GD RK  LSR FK+ GIP  VAIG 
Sbjct  385  KGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDGRKQILSRKFKIEGIPAAVAIGP  444

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
            +GRT+T EAR  + ++GADA+PFT
Sbjct  445  SGRTITKEARMHLTAYGADAFPFT  468


 Score = 85.5 bits (210),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K + FEV+ IS D D+  F E F  MPWLA+P+ D     L R F++R IP LV IG+
Sbjct  225  KEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICKKLVRYFELRTIPNLVIIGQ  284

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL      L+  HG +AYPFT
Sbjct  285  DGKTLNPNVAELIEEHGVEAYPFT  308


 Score = 83.6 bits (205),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 51/79 (65%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+FISSDRD  SF+ +FS+MPWLAIP+ D + +  L  +F+V GIP LV     G+  
Sbjct  72   FEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDTNGKVS  131

Query  513  TTEARNLVMSHGADAYPFT  457
              +  + VM HG D YPF 
Sbjct  132  CDDGVSTVMEHGVDGYPFN  150



>gb|KEH20030.1| protein disulfide isomerase (PDI)-like protein [Medicago truncatula]
Length=506

 Score =   121 bits (304),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 69/81 (85%), Gaps = 0/81 (0%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            +DA EV+FISSDRDQ SFDEFF++MPW+A+P+GD RK  LSR FKV GIP LVAIG +G+
Sbjct  393  NDALEVVFISSDRDQDSFDEFFAEMPWVALPFGDSRKEFLSRKFKVAGIPKLVAIGPSGQ  452

Query  519  TLTTEARNLVMSHGADAYPFT  457
            T+T EAR+LV  +GADAYPFT
Sbjct  453  TVTKEARDLVGIYGADAYPFT  473


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 53/79 (67%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+++S D+D  +F+ +FSKMPWLAIP+ D   +  L  LF V+GIP L  +  TG+ +
Sbjct  74   FEVVYVSRDKDDETFNNYFSKMPWLAIPFSDSEIRIRLKELFHVKGIPHLALLDDTGKVV  133

Query  513  TTEARNLVMSHGADAYPFT  457
            T +  +++  +G + YPFT
Sbjct  134  TEDGVHIIREYGTEGYPFT  152


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   + FEV+FI  D ++ SF +    +PWL++P  D     L + F++  +P  V IG 
Sbjct  229  KENGENFEVVFIPLDDEEESFKKELESVPWLSLPLKDKTCLKLVKYFELSTLPSFVVIGP  288

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+TL   A + +  HG DAYPFT
Sbjct  289  DGKTLHPNAADAIEDHGIDAYPFT  312



>ref|NP_001053815.2| Os04g0608600 [Oryza sativa Japonica Group]
 dbj|BAF15729.2| Os04g0608600, partial [Oryza sativa Japonica Group]
Length=200

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 83/146 (57%), Gaps = 1/146 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            F+VIFIS DR++  F    S MPW AIPY D     LSR+F ++GIP L+ +G  G+   
Sbjct  48   FQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTVQELSRIFTIKGIPTLLILGPDGKVFK  107

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYTC  331
            T+ R ++  +GA A+PFTE R  ELE   ++     P ++    HE    L   +  Y C
Sbjct  108  TDGRRIISKYGAMAFPFTESRAYELEEVLKKERDSLPHRVRDHRHEHELELDMAKA-YVC  166

Query  330  DGCNEGGQGWSFYCDDCDFDLHPKCA  253
            D C + GQ W F C  C+FDLHP CA
Sbjct  167  DECQQKGQNWVFSCKQCNFDLHPTCA  192



>ref|XP_006382207.1| hypothetical protein POPTR_0006s29370g [Populus trichocarpa]
 gb|ERP60004.1| hypothetical protein POPTR_0006s29370g [Populus trichocarpa]
Length=401

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 91/150 (61%), Gaps = 1/150 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
             D  FE+I +S+DRD   F+   S MPWLAIPY D  +  L R+F ++GIP LV IG+ G
Sbjct  235  NDGCFEIILVSTDRDLKEFNTNLSNMPWLAIPYEDRTRQDLCRIFNIKGIPALVIIGQDG  294

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            + ++T+ + ++  +GA A+PFTE R+ E+EA  +E     P ++    H+    L   + 
Sbjct  295  KIISTDGKAMISLYGAKAFPFTESRITEIEATLKEEGDALPRQVKDIKHQHALKLDMAKA  354

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             Y CD CN  G+ W+F CD CD+DLHP C 
Sbjct  355  -YVCDCCNGQGKFWAFSCDVCDYDLHPACV  383


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++FIS DRD+  F E F  MPWLA+P+  +    LS ++ V  IP  +++G  G ++ 
Sbjct  78   LEIVFISFDRDEDGFKEHFKCMPWLAVPFEVNLHRHLSDIYHVNRIPSCISLGSDGISVE  137

Query  510  TEARNLVMSHGADAYPFT  457
             +   L+   GA+A+PFT
Sbjct  138  EDMIGLIEDFGAEAFPFT  155



>ref|XP_011006661.1| PREDICTED: probable nucleoredoxin 3 [Populus euphratica]
 ref|XP_011006662.1| PREDICTED: probable nucleoredoxin 3 [Populus euphratica]
Length=401

 Score =   120 bits (302),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 91/150 (61%), Gaps = 1/150 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
             D  FE+I +S+DRD   F+   S MPWLAIPY D  +  L R+F ++GIP LV IG+ G
Sbjct  235  NDGCFEIILVSTDRDLKEFNTNLSNMPWLAIPYEDRTRQDLCRIFNIKGIPALVIIGQDG  294

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            + ++T+ + ++  +GA A+PFTE R+ E+EA  +E     P ++    H+    L   + 
Sbjct  295  KIISTDGKAMISLYGAKAFPFTESRITEIEATLKEEGDALPRQVKDIKHQHALKLDMAKA  354

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             Y CD CN  G+ W+F CD CD+DLHP C 
Sbjct  355  -YVCDCCNGQGKFWAFSCDVCDYDLHPACV  383


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++FIS DRD+  F E F  MPWLA+P+  +    LS ++ V  IP  +++G  G ++ 
Sbjct  78   LEIVFISFDRDEDGFKEHFKCMPWLAVPFEVNLHRHLSDIYHVNRIPSCISLGSDGISVE  137

Query  510  TEARNLVMSHGADAYPFT  457
             +   L+   GA+A+PFT
Sbjct  138  EDMIGLIEDFGAEAFPFT  155



>ref|XP_010438062.1| PREDICTED: probable nucleoredoxin 3 [Camelina sativa]
 ref|XP_010438063.1| PREDICTED: probable nucleoredoxin 3 [Camelina sativa]
 ref|XP_010438064.1| PREDICTED: probable nucleoredoxin 3 [Camelina sativa]
Length=392

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 91/147 (62%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVI +S+DRD   F+   + MPWLA+PY D R+  L R+F ++ IP LV IG   +T+
Sbjct  239  SFEVILVSTDRDSREFNINMTNMPWLAVPYEDRRRQDLCRIFNIKLIPALVIIGPEEKTV  298

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
            TT AR +V  +G+ ++PFTE R+ EL+   ++    +P K+    HE    L   +  Y 
Sbjct  299  TTNAREMVSLYGSRSFPFTESRIAELKDSLKKEGDSFPRKVKDKKHEHELKLDMAKA-YV  357

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W+F CDDCD+DLHP C 
Sbjct  358  CDFCKKQGRFWAFSCDDCDYDLHPTCV  384


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            +  E+IF+S D D + F E F  MPWLA+P+       L   +++  IP LV +      
Sbjct  77   EELEIIFVSFDHDMTLFYEHFWCMPWLAVPFNLTLLNKLRDKYRISRIPSLVPLYSDDIL  136

Query  516  LTTEARNLVMSHGADAYPFT  457
            +  +   LV  +G +A+PFT
Sbjct  137  VAEDVIGLVEDYGPEAFPFT  156



>ref|XP_002448495.1| hypothetical protein SORBIDRAFT_06g027950 [Sorghum bicolor]
 gb|EES12823.1| hypothetical protein SORBIDRAFT_06g027950 [Sorghum bicolor]
Length=389

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 89/151 (59%), Gaps = 1/151 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            + ++FEVIFIS DR++  F    S MPWLAIPY D  +  L+R+F V+GIP L+ +G  G
Sbjct  233  RPESFEVIFISIDRNKGEFQASMSSMPWLAIPYSDTARQKLTRIFAVKGIPGLLILGLDG  292

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            + L T+ R  + ++GA A+PFTE R+ E++    +     P ++N   H     L   + 
Sbjct  293  KVLKTDGRTAISTYGATAFPFTESRVSEVDEALRKEGDKLPRQVNDPKHRHVLELDMAKA  352

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKCAL  250
             Y CD C + G+ W F C  C+FDLHP C L
Sbjct  353  -YVCDECQKKGRYWVFSCKQCNFDLHPSCVL  382


 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 43/81 (53%), Gaps = 3/81 (4%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT---GR  520
             E+IFIS D D++SF + F  M WLA+P+       L   F +  IP L+ +  T   G 
Sbjct  73   IEIIFISLDHDEASFWDHFKGMSWLALPFDTGLSQKLCAHFGIEHIPALIPLSATPSSGV  132

Query  519  TLTTEARNLVMSHGADAYPFT  457
                +A  LV  +G DAYPF+
Sbjct  133  GFEEDAVRLVDEYGEDAYPFS  153



>ref|XP_003522672.1| PREDICTED: probable nucleoredoxin 3-like [Glycine max]
 gb|KHN10259.1| Putative nucleoredoxin 3 [Glycine soja]
Length=389

 Score =   120 bits (300),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 93/150 (62%), Gaps = 1/150 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            AK D FE++ IS+DRD   F+   S MPWLA+PY D  +  L R+F V+GIP LV IG  
Sbjct  234  AKGDCFEIVLISTDRDLEEFNVNKSTMPWLAVPYEDRTRHDLRRIFDVKGIPALVLIGPD  293

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ ++   + +V S+GA+A+PFTE R+++LEA   +  +  P ++    HE    L   +
Sbjct  294  GKVISVNGKLMVSSYGAEAFPFTESRIRDLEAALRKEGEALPPQVEDVKHEHVLKLDMAK  353

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
              Y CD C + G+ W+F CD CD+DLHP C
Sbjct  354  A-YVCDSCKKQGKFWTFSCDVCDYDLHPSC  382


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IFIS DRD+  F E F  MPWLA+P+  +    L   ++V  IP  V     G T+ 
Sbjct  78   LEIIFISFDRDEDGFKEHFKNMPWLAVPFDLNLHRRLIDRYQVDRIPSFVPSCSDGITIE  137

Query  510  TEARNLVMSHGADAYPFT  457
             +    +  +GADA+PFT
Sbjct  138  EDLIGCIEDYGADAFPFT  155



>ref|XP_003526462.1| PREDICTED: probable nucleoredoxin 3-like isoform X1 [Glycine 
max]
 ref|XP_006581412.1| PREDICTED: probable nucleoredoxin 3-like isoform X2 [Glycine 
max]
Length=389

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 1/149 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            K D FE++ IS+DRD   F+   S MPWLA+PY D  +  L R+F V+GIP LV IG  G
Sbjct  235  KGDCFEIVLISTDRDLEEFNVNKSSMPWLAVPYEDRTRHDLRRIFDVKGIPALVLIGPDG  294

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            + ++   + +V S+GA+A+PFTE R+++LEA   +  +  P+++    HE    L   + 
Sbjct  295  KVISVNGKLMVSSYGAEAFPFTESRIRDLEAALRKEGEALPQQVEDVKHEHVLKLDMAKA  354

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
             Y CD C + G+ W+F CD CD+DLHP C
Sbjct  355  -YVCDSCKKQGKFWTFSCDVCDYDLHPSC  382


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IFIS DRD+  F E F  MPWLA+P+       L   +++  IP  V +   G T+ 
Sbjct  78   LEIIFISFDRDEDGFKEHFKNMPWLAVPFDVSLHRRLIDRYRIDRIPSFVPLCSDGITIE  137

Query  510  TEARNLVMSHGADAYPFT  457
             +    +  +GADA+PFT
Sbjct  138  EDLIGCIEDYGADAFPFT  155



>ref|XP_007017891.1| DC1 domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY15116.1| DC1 domain-containing protein isoform 2 [Theobroma cacao]
Length=385

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            F+++F+S+DRDQSSFD +F  MPWLA+P+GD    SL++ F V+GIP L+ IG  G+T+T
Sbjct  226  FDIVFVSNDRDQSSFDTYFGSMPWLALPFGDPSIKSLAKYFDVQGIPCLIIIGPDGKTVT  285

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
             + RNL+  +  +AYPFT+ +++ LE E EE AK +P+      H          T    
Sbjct  286  KQGRNLINLYQENAYPFTDAKVELLEKEMEEAAKSFPKSEYHAGHRHELTLVSEGTGGGP  345

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  346  FICCDCDEQGSGWAYQCLECGYEVHPKCV  374



>ref|XP_004976749.1| PREDICTED: probable nucleoredoxin 3-like [Setaria italica]
Length=389

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 86/147 (59%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVIFIS DR +  F+E  S  PWLAIPY D  +  L+R+F ++GIP L+ +G  G+ L
Sbjct  236  SFEVIFISIDRSKEEFEESLSATPWLAIPYSDTARQELTRIFAIKGIPALLILGLDGKVL  295

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
             T+ R  + ++GA A+PFTE R+ E+     +     P ++N+  H     L   +  Y 
Sbjct  296  KTDGRTAISTYGATAFPFTESRVSEVNEALRKEGDKLPRRVNNPRHRHELELDMAKA-YV  354

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W F C  C+FDLHP C 
Sbjct  355  CDECQQKGRYWVFSCKPCNFDLHPSCV  381


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 45/81 (56%), Gaps = 3/81 (4%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR---  520
             E+IFIS D D++SF + F  MPWLA+P+    +  L   F +  IP L+ +  T     
Sbjct  73   IEIIFISLDHDETSFLDHFKSMPWLALPFNSSLRRKLCSHFGIEHIPALIPLSVTPSGEL  132

Query  519  TLTTEARNLVMSHGADAYPFT  457
                +A  LV  +GA+AYPF+
Sbjct  133  GFEEDAVKLVEEYGAEAYPFS  153



>ref|XP_006435249.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|ESR48489.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|KDO84956.1| hypothetical protein CISIN_1g013684mg [Citrus sinensis]
 gb|KDO84957.1| hypothetical protein CISIN_1g013684mg [Citrus sinensis]
Length=311

 Score =   118 bits (296),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+F+S+DRDQ+SF+ +F  MPWLA+P+GD     L++ F V+GIP LV IG  G+T+T
Sbjct  152  FEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKELTKYFDVQGIPCLVIIGPEGKTVT  211

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
             + RNL+  +  +AYPFTE +L+ LE + EE AK  P     + H          T    
Sbjct  212  KQGRNLINLYQENAYPFTEAKLEFLEKQMEEEAKNLPRSEFHIGHRHELNLVSEGTGGGP  271

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  272  FICCDCDEQGSGWAYQCLECGYEVHPKCV  300



>gb|KDO67158.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
Length=292

 Score =   118 bits (295),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 1/146 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+ +S+DRD   FD   S MPWLAIPY D  +  L R+F ++GIP LV IG  G+T++
Sbjct  141  FEVVLVSTDRDHKEFDLNHSIMPWLAIPYEDRARQDLCRIFNIKGIPALVLIGPDGKTIS  200

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYTC  331
            T  + ++  +GA A+PFTE R+ E+E   ++     P ++    HE    L   +  Y C
Sbjct  201  TNGKEMISLYGAKAFPFTESRIAEIETALKKEGDALPREVKDVKHEHELKLDMAKA-YVC  259

Query  330  DGCNEGGQGWSFYCDDCDFDLHPKCA  253
            D C   G+ W+F CD C++DLHPKC 
Sbjct  260  DCCKMRGRFWAFSCDVCNYDLHPKCV  285



>ref|XP_007017892.1| DC1 domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15117.1| DC1 domain-containing protein isoform 3 [Theobroma cacao]
Length=427

 Score =   119 bits (299),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            F+++F+S+DRDQSSFD +F  MPWLA+P+GD    SL++ F V+GIP L+ IG  G+T+T
Sbjct  268  FDIVFVSNDRDQSSFDTYFGSMPWLALPFGDPSIKSLAKYFDVQGIPCLIIIGPDGKTVT  327

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
             + RNL+  +  +AYPFT+ +++ LE E EE AK +P+      H          T    
Sbjct  328  KQGRNLINLYQENAYPFTDAKVELLEKEMEEAAKSFPKSEYHAGHRHELTLVSEGTGGGP  387

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  388  FICCDCDEQGSGWAYQCLECGYEVHPKCV  416


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAI-  535
            K+    FE++F+SSD D  +F+ +   MPWL+IP+ D + K +L+R F+V GIP L+ + 
Sbjct  92   KSNGSNFEIVFVSSDEDLDAFNNYRKSMPWLSIPFSDLETKKALNRKFEVEGIPCLIILQ  151

Query  534  ---GRTGRTLTTEARNLVMSHGADAYPFT  457
                + G T   +   L+  +G +A+PFT
Sbjct  152  PEDNKDGATF-YDGVELIYRYGVEAFPFT  179



>ref|XP_007017890.1| DC1 domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15115.1| DC1 domain-containing protein isoform 1 [Theobroma cacao]
Length=428

 Score =   119 bits (299),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            F+++F+S+DRDQSSFD +F  MPWLA+P+GD    SL++ F V+GIP L+ IG  G+T+T
Sbjct  269  FDIVFVSNDRDQSSFDTYFGSMPWLALPFGDPSIKSLAKYFDVQGIPCLIIIGPDGKTVT  328

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
             + RNL+  +  +AYPFT+ +++ LE E EE AK +P+      H          T    
Sbjct  329  KQGRNLINLYQENAYPFTDAKVELLEKEMEEAAKSFPKSEYHAGHRHELTLVSEGTGGGP  388

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  389  FICCDCDEQGSGWAYQCLECGYEVHPKCV  417


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 54/89 (61%), Gaps = 6/89 (7%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAI-  535
            K+    FE++F+SSD D  +F+ +   MPWL+IP+ D + K +L+R F+V GIP L+ + 
Sbjct  93   KSNGSNFEIVFVSSDEDLDAFNNYRKSMPWLSIPFSDLETKKALNRKFEVEGIPCLIILQ  152

Query  534  ---GRTGRTLTTEARNLVMSHGADAYPFT  457
                + G T   +   L+  +G +A+PFT
Sbjct  153  PEDNKDGATF-YDGVELIYRYGVEAFPFT  180



>ref|XP_002510593.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF52780.1| nucleoredoxin, putative [Ricinus communis]
Length=389

 Score =   119 bits (298),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 93/153 (61%), Gaps = 3/153 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            + + FE++F+S+DRDQ  FD +F+ MPWLA+P+GD    +L++ F V+GIP L+ IG  G
Sbjct  226  ESEDFEIVFVSTDRDQEGFDSYFNTMPWLALPFGDPTIKTLTKYFDVQGIPCLIIIGPNG  285

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLT  352
            +T+T   RNL+  +  +AYPFTE +++ LE + EE  K  P     + H          T
Sbjct  286  KTITKNGRNLINLYQENAYPFTEAKVELLEKQMEEEFKSLPRSEYHVGHKHELNLVTEGT  345

Query  351  RRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                Y C  C+E G GW++ C +C +++HPKC 
Sbjct  346  GGGPYICCDCDEQGSGWAYQCLECGYEVHPKCV  378


 Score = 59.7 bits (143),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/89 (36%), Positives = 51/89 (57%), Gaps = 6/89 (7%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K     FEV+F+SSD +  +F+ + + MPWL+IP+ D + K +L R F + G+P LV + 
Sbjct  54   KENGSNFEVVFVSSDENLDAFNNYRALMPWLSIPFSDLETKKALDRKFNIEGVPCLVILQ  113

Query  531  ----RTGRTLTTEARNLVMSHGADAYPFT  457
                +   TL  +  +L+   G  A+PFT
Sbjct  114  PKDDKEEATL-HDGVDLLYRFGVQAFPFT  141



>gb|KHG03676.1| hypothetical protein F383_28340 [Gossypium arboreum]
 gb|KHG17378.1| hypothetical protein F383_21915 [Gossypium arboreum]
Length=390

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 89/151 (59%), Gaps = 1/151 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            ++ D FEV+ +SSDRDQ  FD   S MPWLA+P+ D  +  L R+F ++ IP LV IG  
Sbjct  237  SRGDCFEVVLVSSDRDQKEFDVNISGMPWLALPFEDRTRQDLCRIFNIKAIPALVLIGPD  296

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ ++T  +N++  +GA A+PFT+  ++E+E    +     P ++    H+    L   +
Sbjct  297  GKPISTNGKNIITLYGAKAFPFTQSSIEEIEESLRKEGDSLPTQIQDIKHQHVLKLDMAK  356

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
              Y C+ C   G+ W+F CD CD+DLHP C 
Sbjct  357  S-YVCNYCERQGKFWAFSCDACDYDLHPTCV  386


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++FIS D D+  F+  F  MPWL +P+  +    L   F V  IP LV +   G+++ 
Sbjct  81   LEIVFISLDHDEDGFNAHFETMPWLTVPFDVNLHKKLRERFHVVRIPFLVPLNLDGQSVE  140

Query  510  TEARNLVMSHGADAYPFT  457
             +   L+   G DA+PFT
Sbjct  141  EDLIGLIEDFGEDAFPFT  158



>ref|XP_010266892.1| PREDICTED: probable nucleoredoxin 2 [Nelumbo nucifera]
Length=429

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 99/154 (64%), Gaps = 3/154 (2%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            +K++ FE++F+SSDRD+++FD +F  MPWLA+P+GD    +L+R F V+GIP LV +G  
Sbjct  267  SKEEGFEIVFVSSDRDRAAFDSYFGTMPWLALPFGDPTIKNLTRYFDVQGIPCLVILGPD  326

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+TLT   RNL+  +   AYPFT+ +L+ LE +  E AKG P   +HA H     L++  
Sbjct  327  GKTLTKHGRNLINLYQEKAYPFTKAQLEILEKQRNEEAKGLPVTEHHAGHRHELTLVSEG  386

Query  345  QH---YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                 + C  C+E G GW++ C +C +++H KC 
Sbjct  387  SGGGPFICCECDEQGSGWAYQCIECGYEVHTKCV  420


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG---RT  526
             FEV+F+SSD D  +F  + + MPWLAIP+ D + K +L+R F+V GIP L+ +      
Sbjct  95   GFEVVFVSSDEDSDAFASYRACMPWLAIPFSDLESKKALNRRFQVEGIPCLIILQPDDNE  154

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
              +   E   L+  +G  A+PFT
Sbjct  155  DESTLREGVELIYRYGVRAFPFT  177



>ref|XP_008377128.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=443

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 97/149 (65%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++F+SSDRDQ+SFD +F+ MPWLA+P+GD     L + F V+GIP+LV +G  G+T+T
Sbjct  274  FEIVFVSSDRDQTSFDSYFNTMPWLALPFGDPNIKELVKHFDVKGIPLLVILGPDGKTVT  333

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFT+ +++ LE + +E AK  P  + H  H     L++       
Sbjct  334  QQGRNLINLYKENAYPFTDAKVELLEKKMDEEAKNLPRSVYHGGHRHELNLVSEGNGGGP  393

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  394  FICCACDEQGCGWAYQCLECGYEVHPKCV  422


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K+    FE++++SSD D  +F+++ + MPWLAIP+ D D K +L+R F V  IP LV + 
Sbjct  96   KSSGSNFEIVYVSSDEDSEAFNKYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQ  155

Query  531  ---RTGRTLTTEARNLVMSHGADAYPFT  457
                       +   ++  +G DA+PFT
Sbjct  156  PNDNKEEVTLHDGVEIIYRYGVDAFPFT  183



>ref|XP_010669505.1| PREDICTED: probable nucleoredoxin 3 [Beta vulgaris subsp. vulgaris]
Length=387

 Score =   119 bits (297),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            +  FEVIFIS+DRD   F    S MPW AIPY D  +  L R+F+++GIP L+ IG  G+
Sbjct  236  NQPFEVIFISTDRDHDEFICSLSTMPWPAIPYEDKTRQDLKRIFEIKGIPTLILIGPDGK  295

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
             ++T  R L+  +GA A+PFTE R+  +EA   +  + +P K+    H     L   +  
Sbjct  296  IISTSGRALISLYGAMAFPFTEPRIAGIEATLRKEGERFPRKVQDPKHIHELKLDMAKA-  354

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            Y CD C + G+ W+F CD CD+DLHP+C 
Sbjct  355  YVCDACRKQGRFWTFSCDVCDYDLHPRCV  383


 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K   +  E+IFISSD D+ ++ E    MPWLA+P+  +    L+ LF +  IP L+ +  
Sbjct  72   KTNGEKLEIIFISSDGDEKTYKEHLETMPWLAVPFNLNLYRRLAHLFNIDHIPALIPLNC  131

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+ +  +A  LV  +GADA+PFT
Sbjct  132  NGKNVEDDAVTLVEDYGADAFPFT  155



>gb|AAV50008.1| protein disulfide isomerase [Malus domestica]
Length=162

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++ +SSDRDQ+SFD +F+ MPWLA+P+GD     L + F V+GIP LV +G  G+T+T
Sbjct  10   FEIVLVSSDRDQTSFDSYFNTMPWLALPFGDPNIKELVKHFDVKGIPCLVILGPDGKTVT  69

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFT+ +L+ LE + +E AK  P  + H  H     L++       
Sbjct  70   QQGRNLINLYKENAYPFTDAKLELLEKKMDEEAKNLPRSVYHGGHRHELNLVSEGNGGGP  129

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C E G GW++ C +C +++HPKC 
Sbjct  130  FICCDCEEQGCGWAYQCLECGYEVHPKCV  158



>ref|XP_010447596.1| PREDICTED: probable nucleoredoxin 3 [Camelina sativa]
 ref|XP_010447597.1| PREDICTED: probable nucleoredoxin 3 [Camelina sativa]
Length=392

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 90/147 (61%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVI IS+DRD   F+   + MPWLAIPY D  +  L R+F ++ IP LV IG   +T+
Sbjct  239  SFEVILISTDRDSREFNINMTNMPWLAIPYEDRTRQDLCRIFNIKLIPALVIIGPEEKTV  298

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
            TT AR +V  +G+ ++PFTE R+ EL+   ++    +P+K+    HE    L   +  Y 
Sbjct  299  TTNAREMVSLYGSRSFPFTESRILELKDSLKKEGDSFPKKVKDKKHEHELKLDMAKA-YV  357

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C E G+ W+F CD CD+DLHP C 
Sbjct  358  CDFCKEQGRFWAFSCDACDYDLHPTCV  384


 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 42/80 (53%), Gaps = 0/80 (0%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            +  E+IF+S D D + F E F  MPWLA+P+       L   +++  IP LV +      
Sbjct  77   EELEIIFVSFDHDMTLFYEHFWCMPWLAVPFNLSVLNKLRDKYRISRIPSLVPLYSDDIL  136

Query  516  LTTEARNLVMSHGADAYPFT  457
            +  +   LV  +G +A+PFT
Sbjct  137  VAEDVIGLVEDYGPEAFPFT  156



>ref|XP_006435250.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 ref|XP_006473711.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Citrus sinensis]
 gb|ESR48490.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|KDO84953.1| hypothetical protein CISIN_1g013684mg [Citrus sinensis]
Length=428

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+F+S+DRDQ+SF+ +F  MPWLA+P+GD     L++ F V+GIP LV IG  G+T+T
Sbjct  269  FEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKELTKYFDVQGIPCLVIIGPEGKTVT  328

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
             + RNL+  +  +AYPFTE +L+ LE + EE AK  P     + H          T    
Sbjct  329  KQGRNLINLYQENAYPFTEAKLEFLEKQMEEEAKNLPRSEFHIGHRHELNLVSEGTGGGP  388

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  389  FICCDCDEQGSGWAYQCLECGYEVHPKCV  417


 Score = 64.7 bits (156),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG----RT  526
            FEV+F+SSD D ++F+ + + MPWLA+PY D + K +L+R F + GIP LV +     + 
Sbjct  97   FEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKFDIEGIPCLVVLQPYDDKD  156

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
              TL  +   L+  +G  A+PFT
Sbjct  157  DATL-HDGVELIYKYGIRAFPFT  178



>gb|KDO84955.1| hypothetical protein CISIN_1g013684mg [Citrus sinensis]
Length=399

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+F+S+DRDQ+SF+ +F  MPWLA+P+GD     L++ F V+GIP LV IG  G+T+T
Sbjct  240  FEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKELTKYFDVQGIPCLVIIGPEGKTVT  299

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
             + RNL+  +  +AYPFTE +L+ LE + EE AK  P     + H          T    
Sbjct  300  KQGRNLINLYQENAYPFTEAKLEFLEKQMEEEAKNLPRSEFHIGHRHELNLVSEGTGGGP  359

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  360  FICCDCDEQGSGWAYQCLECGYEVHPKCV  388


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG----RT  526
            FEV+F+SSD D ++F+ + + MPWLA+PY D + K +L+R F + GIP LV +     + 
Sbjct  68   FEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKFDIEGIPCLVVLQPYDDKD  127

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
              TL  +   L+  +G  A+PFT
Sbjct  128  DATL-HDGVELIYKYGIRAFPFT  149



>gb|KDO67150.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
 gb|KDO67151.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
Length=351

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 89/149 (60%), Gaps = 1/149 (1%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            +  FEV+ +S+DRD   FD   S MPWLAIPY D  +  L R+F ++GIP LV IG  G+
Sbjct  197  NHCFEVVLVSTDRDHKEFDLNHSIMPWLAIPYEDRARQDLCRIFNIKGIPALVLIGPDGK  256

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
            T++T  + ++  +GA A+PFTE R+ E+E   ++     P ++    HE    L   +  
Sbjct  257  TISTNGKEMISLYGAKAFPFTESRIAEIETALKKEGDALPREVKDVKHEHELKLDMAKA-  315

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            Y CD C   G+ W+F CD C++DLHPKC 
Sbjct  316  YVCDCCKMRGRFWAFSCDVCNYDLHPKCV  344



>ref|XP_006435252.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 ref|XP_006473710.1| PREDICTED: probable nucleoredoxin 2-like isoform X1 [Citrus sinensis]
 gb|ESR48492.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|KDO84954.1| hypothetical protein CISIN_1g013684mg [Citrus sinensis]
Length=438

 Score =   118 bits (296),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+F+S+DRDQ+SF+ +F  MPWLA+P+GD     L++ F V+GIP LV IG  G+T+T
Sbjct  279  FEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKELTKYFDVQGIPCLVIIGPEGKTVT  338

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
             + RNL+  +  +AYPFTE +L+ LE + EE AK  P     + H          T    
Sbjct  339  KQGRNLINLYQENAYPFTEAKLEFLEKQMEEEAKNLPRSEFHIGHRHELNLVSEGTGGGP  398

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  399  FICCDCDEQGSGWAYQCLECGYEVHPKCV  427


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 6/83 (7%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG----RT  526
            FEV+F+SSD D ++F+ + + MPWLA+PY D + K +L+R F + GIP LV +     + 
Sbjct  107  FEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKFDIEGIPCLVVLQPYDDKD  166

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
              TL  +   L+  +G  A+PFT
Sbjct  167  DATL-HDGVELIYKYGIRAFPFT  188



>gb|KDO67148.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
 gb|KDO67149.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
Length=358

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 1/146 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+ +S+DRD   FD   S MPWLAIPY D  +  L R+F ++GIP LV IG  G+T++
Sbjct  207  FEVVLVSTDRDHKEFDLNHSIMPWLAIPYEDRARQDLCRIFNIKGIPALVLIGPDGKTIS  266

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYTC  331
            T  + ++  +GA A+PFTE R+ E+E   ++     P ++    HE    L   +  Y C
Sbjct  267  TNGKEMISLYGAKAFPFTESRIAEIETALKKEGDALPREVKDVKHEHELKLDMAKA-YVC  325

Query  330  DGCNEGGQGWSFYCDDCDFDLHPKCA  253
            D C   G+ W+F CD C++DLHPKC 
Sbjct  326  DCCKMRGRFWAFSCDVCNYDLHPKCV  351



>emb|CAA16527.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79842.1| predicted protein [Arabidopsis thaliana]
Length=204

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVI IS+DRD   F+   + MPWLAIPY D  +  L R+F V+ IP LV IG   +T+
Sbjct  51   SFEVILISTDRDSREFNINMTNMPWLAIPYEDRTRQDLCRIFNVKLIPALVIIGPEEKTV  110

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
            TT AR +V  +G+ ++PFTE R+ EL+A  ++     P K+    HE    L   +  Y 
Sbjct  111  TTNAREMVSLYGSRSFPFTESRIVELKACLKKEGDSLPRKVKDNKHEHELKLDMAKA-YV  169

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W+F C+ CD+DLHP C 
Sbjct  170  CDFCKKQGRFWAFSCNACDYDLHPTCV  196



>ref|XP_006483643.1| PREDICTED: probable nucleoredoxin 3-like isoform X1 [Citrus sinensis]
 ref|XP_006483644.1| PREDICTED: probable nucleoredoxin 3-like isoform X2 [Citrus sinensis]
 ref|XP_006483645.1| PREDICTED: probable nucleoredoxin 3-like isoform X3 [Citrus sinensis]
Length=390

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 1/146 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+ +S+DRD   FD   S MPWLAIPY D  +  L R+F ++GIP LV IG  G+T++
Sbjct  239  FEVVLVSTDRDHKEFDLNHSIMPWLAIPYEDRARQDLCRIFNIKGIPALVLIGPDGKTIS  298

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYTC  331
            T  + ++  +GA A+PFTE R+ E+E   ++     P ++    HE    L   +  Y C
Sbjct  299  TNGKEMISLYGAKAFPFTESRIAEIETALKKEGDALPREVKDVKHEHELKLDMAKA-YVC  357

Query  330  DGCNEGGQGWSFYCDDCDFDLHPKCA  253
            D C   G+ W+F CD C++DLHPKC 
Sbjct  358  DCCKMRGRFWAFSCDVCNYDLHPKCV  383


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + +    EVIFIS D D++ F+E F  MPWLA+P+ +     L   ++V  IP L+ +  
Sbjct  72   RTRGTELEVIFISFDHDENGFEEHFKCMPWLAVPFDETLHKKLRIRYRVDRIPSLIPLAS  131

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G  +  +   L+  +GADAYPFT
Sbjct  132  DGTLIEEDLIGLIEDYGADAYPFT  155



>gb|KDO67152.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
 gb|KDO67153.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
 gb|KDO67154.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
 gb|KDO67155.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
 gb|KDO67156.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
 gb|KDO67157.1| hypothetical protein CISIN_1g016384mg [Citrus sinensis]
Length=390

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/146 (42%), Positives = 88/146 (60%), Gaps = 1/146 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEV+ +S+DRD   FD   S MPWLAIPY D  +  L R+F ++GIP LV IG  G+T++
Sbjct  239  FEVVLVSTDRDHKEFDLNHSIMPWLAIPYEDRARQDLCRIFNIKGIPALVLIGPDGKTIS  298

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYTC  331
            T  + ++  +GA A+PFTE R+ E+E   ++     P ++    HE    L   +  Y C
Sbjct  299  TNGKEMISLYGAKAFPFTESRIAEIETALKKEGDALPREVKDVKHEHELKLDMAKA-YVC  357

Query  330  DGCNEGGQGWSFYCDDCDFDLHPKCA  253
            D C   G+ W+F CD C++DLHPKC 
Sbjct  358  DCCKMRGRFWAFSCDVCNYDLHPKCV  383


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + +    EVIFIS D D++ F+E F  MPWLA+P+ +     L   ++V  IP L+ +  
Sbjct  72   RTRGTELEVIFISFDHDENGFEEHFKCMPWLAVPFDETLHKKLRIRYRVDRIPSLIPLAS  131

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G  +  +   L+  +GADAYPFT
Sbjct  132  DGTLIEEDLIGLIEDYGADAYPFT  155



>gb|KHN18231.1| Putative nucleoredoxin 3 [Glycine soja]
Length=659

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 93/149 (62%), Gaps = 1/149 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            K D FE++ IS+DRD   F+   S MPWLA+PY D  +  L R+F V+GIP LV IG  G
Sbjct  505  KGDCFEIVLISTDRDLEEFNVNKSSMPWLAVPYEDRTRHDLRRIFDVKGIPALVLIGPDG  564

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            + ++   + +V S+GA+A+PFTE R+++LEA   +  +  P+++    HE    L   + 
Sbjct  565  KVISVNGKLMVSSYGAEAFPFTESRIRDLEAALRKEGEALPQQVEDVKHEHVLKLDMAKA  624

Query  342  HYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
             Y CD C + G+ W+F CD CD+DLHP C
Sbjct  625  -YVCDSCKKQGKFWTFSCDVCDYDLHPSC  652


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 43/78 (55%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IFIS DRD+  F E F  MPWLA+P+       L   +++  IP  V +   G T+ 
Sbjct  348  LEIIFISFDRDEDGFKEHFKNMPWLAVPFDVSLHRRLIDRYRIDRIPSFVPLCSDGITIE  407

Query  510  TEARNLVMSHGADAYPFT  457
             +    +  +GADA+PFT
Sbjct  408  EDLIGCIEDYGADAFPFT  425



>ref|XP_007011460.1| Kinase C-like zinc finger protein [Theobroma cacao]
 gb|EOY29079.1| Kinase C-like zinc finger protein [Theobroma cacao]
Length=388

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/146 (41%), Positives = 86/146 (59%), Gaps = 1/146 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FEVI +S+DRDQ  FD   S MPWLA+P+ D  +  L R+F ++ IP LV IG  G+T++
Sbjct  240  FEVILVSTDRDQKEFDLNISGMPWLALPFEDRTRHDLCRIFNIKAIPALVLIGPDGKTIS  299

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYTC  331
            T  + ++  +GA A+PFT+  + E+E   ++     P ++    HE    L   R  Y C
Sbjct  300  TNGKTILSLYGAKAFPFTQSSIAEIETTLKKEGDALPHQIQDTRHEHVLKLDMARA-YVC  358

Query  330  DGCNEGGQGWSFYCDDCDFDLHPKCA  253
            D C   G+ W+F CD CD+DLHP C 
Sbjct  359  DYCKRPGRFWAFSCDVCDYDLHPTCV  384


 Score = 70.9 bits (172),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K++ +  E++FIS D D+  F+E F  MPWL +P+  + +  L   F V  IP L+ +  
Sbjct  73   KSRGEGLEIVFISFDHDEDGFNEHFKSMPWLTVPFNANLQNKLRERFNVVRIPSLLPLNS  132

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G+++  +   LV  +G DA+PFT
Sbjct  133  DGQSMEEDLIGLVEDYGEDAFPFT  156



>ref|XP_004291281.1| PREDICTED: probable nucleoredoxin 3 [Fragaria vesca subsp. vesca]
 ref|XP_011459020.1| PREDICTED: probable nucleoredoxin 3 [Fragaria vesca subsp. vesca]
 ref|XP_011459021.1| PREDICTED: probable nucleoredoxin 3 [Fragaria vesca subsp. vesca]
Length=380

 Score =   117 bits (294),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 92/151 (61%), Gaps = 1/151 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            + D+ FE+IF+S+DRD   F+     MPWLAIPY D  +  L R+F ++ IP LV IG  
Sbjct  224  SNDELFEIIFVSTDRDLKEFELNICTMPWLAIPYNDKTRQDLCRIFNIKEIPALVLIGPD  283

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ ++T+ R L+  +GA A+PFTE R+KELEA   +  +  P ++    H+    L   +
Sbjct  284  GKAVSTKGRALISLYGAKAFPFTELRIKELEAALGKEGEALPPQVKDIKHDHMLKLDMAK  343

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
              Y CD C + G+ W+F CD CD+DLHP C 
Sbjct  344  A-YVCDFCKKQGRFWAFSCDVCDYDLHPTCV  373


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IF+S D D+  F+  F  MPWLA+P+  +    LS ++ V  IP LV +     ++ 
Sbjct  68   LEIIFVSFDHDEDKFNAHFKCMPWLAVPFDVNLHKRLSDIYHVDRIPSLVPLSSDRISIE  127

Query  510  TEARNLVMSHGADAYPFT  457
             +    +  +GA+A+PFT
Sbjct  128  EDLIGFIEDYGAEAFPFT  145



>ref|XP_009620045.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620046.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Nicotiana tomentosiformis]
Length=442

 Score =   117 bits (294),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/152 (41%), Positives = 99/152 (65%), Gaps = 3/152 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            +D+ FE++F+SSDRDQ  F  +F  MPWLA+PY D    +L++ F +RGIP LV +G  G
Sbjct  282  EDEDFEIVFVSSDRDQVQFLTYFETMPWLAVPYDDPTIKNLAKYFDIRGIPSLVVLGPDG  341

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR--  349
            +T+T + R+L+  +  +AYPFT+ R+  LE + +E+AKG P+  +H+ H     L+    
Sbjct  342  KTVTKQGRSLINLYKENAYPFTKTRVGILEKQMDEVAKGLPKTEHHSGHRHELTLVPEGH  401

Query  348  -RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
             R  + C  C+E G GW++ C +C +++HPKC
Sbjct  402  GRGAFICCDCDEQGYGWAYQCLECGYEVHPKC  433


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 4/82 (5%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGR--  520
            FE++F+SSD D  +F+ + S MPWLAIP+ D + + +L+R F V GIP L+ +       
Sbjct  116  FEIVFVSSDEDSDAFNTYKSSMPWLAIPFSDLETRRALTRKFDVEGIPCLIILQPNSNKD  175

Query  519  -TLTTEARNLVMSHGADAYPFT  457
              + ++   LV  +G  A+PFT
Sbjct  176  AAVISDGVELVYRYGVQAFPFT  197



>ref|XP_007137135.1| hypothetical protein PHAVU_009G102600g [Phaseolus vulgaris]
 gb|ESW09129.1| hypothetical protein PHAVU_009G102600g [Phaseolus vulgaris]
Length=387

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 93/150 (62%), Gaps = 1/150 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            AK D FE++ IS+DRD   F+   + MPWLA+PY D  +  L R+F ++GIP LV IG  
Sbjct  234  AKGDCFEIVLISTDRDLVEFNINKNSMPWLAVPYEDRTRHDLRRIFDIKGIPALVLIGPD  293

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ ++   + +V S+GA+A+PFTE R++ELEA   +  +  P++     HE    L   +
Sbjct  294  GKVISGNGKFMVSSYGAEAFPFTESRIRELEAALRKEGEALPQQAEDVKHEHVLKLDMAK  353

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
              Y CD C + G+ W+F CD CD+DLHP C
Sbjct  354  A-YVCDSCRKQGKFWAFSCDVCDYDLHPSC  382


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E+IFIS DRD+  F E F  M WLA+P+  +    L   ++V  IP  V +     T+ 
Sbjct  78   LEIIFISFDRDEDGFKEHFKSMTWLAVPFDVNLHRRLIDRYRVDRIPSFVPLCSDAITVK  137

Query  510  TEARNLVMSHGADAYPFT  457
             +    +  +GADA+PFT
Sbjct  138  EDLIGCIEDYGADAFPFT  155



>ref|XP_007221797.1| hypothetical protein PRUPE_ppa006064mg [Prunus persica]
 gb|EMJ22996.1| hypothetical protein PRUPE_ppa006064mg [Prunus persica]
Length=429

 Score =   117 bits (293),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++F+SSDRDQ+SFD +F  MPWLA+P+GD     L + F V+GIP LV +G  G+T+T
Sbjct  269  FEIVFVSSDRDQASFDSYFDTMPWLALPFGDPNIKQLVKHFDVKGIPCLVILGPDGKTVT  328

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFTE +L+ LE + +E AK  P  + H  H     L++       
Sbjct  329  KQGRNLINLYQENAYPFTEAKLELLEKKMDEEAKSLPRSVYHGGHRHELNLVSEGNGGGP  388

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  389  FICCDCDEQGSGWAYQCLECGYEVHPKCV  417


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 52/88 (59%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K+    FE++++SSD D  +F+ + + MPWLAIP+ D D K +L+R F + GIP LV + 
Sbjct  90   KSSGSNFEIVYVSSDEDADAFNIYHACMPWLAIPFSDLDTKKALNRRFDIEGIPSLVILH  149

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
                      R+   L+  +G +A+PFT
Sbjct  150  PNDNKDEATLRDGVELIYRYGVEAFPFT  177



>gb|KDP36878.1| hypothetical protein JCGZ_08169 [Jatropha curcas]
Length=418

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 96/156 (62%), Gaps = 4/156 (3%)
 Frame = -3

Query  708  KAKDDA-FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIG  532
            K KDD  FE++++S+DRDQ  F+ +FS MPWLA+P+GD    SL++ F+V+GIP L+ +G
Sbjct  251  KQKDDEDFEIVYVSTDRDQQGFESYFSIMPWLALPFGDPTIKSLAKHFEVQGIPCLIILG  310

Query  531  RTGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehel  361
              G+T+T   RNL+  +   AYPFTE R++ LE + EE AK  P     + H        
Sbjct  311  PDGKTITRHGRNLINLYQEKAYPFTEARVELLEKQMEEEAKNLPRSEYHIGHKHELNLVS  370

Query  360  lLTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
              T    + C  C+E G GW++ C +C +++HPKC 
Sbjct  371  EGTGGGPFICCDCDEQGSGWAYQCLECGYEVHPKCV  406


 Score = 58.9 bits (141),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/82 (35%), Positives = 46/82 (56%), Gaps = 4/82 (5%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG---RTG  523
            FEV+F+SSD D  +F+++ + MPWL+IP+ D + K +L   F + GIP L+ +       
Sbjct  88   FEVVFVSSDEDLEAFNKYRASMPWLSIPFPDLETKKALDHKFNIEGIPCLIILQPHDYKD  147

Query  522  RTLTTEARNLVMSHGADAYPFT  457
                 +   L+   G  A+PFT
Sbjct  148  EATLHDGVELLYRFGVQAFPFT  169



>ref|XP_008221212.1| PREDICTED: probable nucleoredoxin 2 [Prunus mume]
Length=427

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 95/149 (64%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++F+SSDRDQ+SFD +F  MPWLA+P+GD     L + F V+GIP LV +G  G+T+T
Sbjct  269  FEIVFVSSDRDQASFDSYFVTMPWLALPFGDPNIKQLVKHFDVKGIPCLVILGPDGKTVT  328

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFTE +L+ LE + +E AK  P  + H  H     L++       
Sbjct  329  KQGRNLINLYQENAYPFTEAKLELLEKKMDEEAKSLPRSVYHGGHRHELNLVSEGNGGGP  388

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  389  FICCDCDEQGSGWAYQCLECGYEVHPKCV  417


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K+    FE++++SSD D  +F+ +   MPWLAIP+ D D K +L+R F + GIP LV + 
Sbjct  90   KSSGSNFEIVYVSSDEDADAFNIYHGCMPWLAIPFSDLDTKKALNRRFDIEGIPSLVILH  149

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
                      R+   L+  +G +A+PFT
Sbjct  150  PNDNKDEATLRDGAELIYRYGVEAFPFT  177



>ref|XP_004136369.1| PREDICTED: probable nucleoredoxin 2-like [Cucumis sativus]
 gb|KGN60060.1| hypothetical protein Csa_3G874380 [Cucumis sativus]
Length=410

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 94/153 (61%), Gaps = 3/153 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            +D+ FE++F+SSDRD+ SF  +F  MPWL +PYGD     L++ F V+GIP L+ +   G
Sbjct  248  EDEDFEIVFVSSDRDEDSFHSYFGSMPWLGLPYGDPMIKELAKHFDVQGIPCLIILAPNG  307

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T+T + RNL+  +  +AYPFTE RL+EL  E  E AK  P  + H  H     L++   
Sbjct  308  KTITKQGRNLINLYRENAYPFTEARLEELVKEMGEEAKKLPTSVRHVGHRHELNLVSEGN  367

Query  342  ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                + C  CNE G GW++ C +C F++HPKC 
Sbjct  368  GGGPFICCECNEQGSGWAYQCLECGFEVHPKCV  400


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG-RTGRT  517
            FEV+++SSD D  +F+E+ + MPW AIP+ D + K +L+R F + GIP L+ +  R  + 
Sbjct  82   FEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESKD  141

Query  516  LTT---EARNLVMSHGADAYPFT  457
             T    E   +V  +G DA+PFT
Sbjct  142  ETATLHEGVEVVYRYGVDAFPFT  164



>ref|XP_004167003.1| PREDICTED: probable nucleoredoxin 2-like [Cucumis sativus]
Length=410

 Score =   117 bits (292),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 94/153 (61%), Gaps = 3/153 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            +D+ FE++F+SSDRD+ SF  +F  MPWL +PYGD     L++ F V+GIP L+ +   G
Sbjct  248  EDEDFEIVFVSSDRDEDSFHSYFGSMPWLGLPYGDPMIKELAKHFDVQGIPCLIILAPNG  307

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T+T + RNL+  +  +AYPFTE RL+EL  E  E AK  P  + H  H     L++   
Sbjct  308  KTITKQGRNLINLYRENAYPFTEARLEELVKEMGEEAKKLPTSVRHVGHRHELNLVSEGN  367

Query  342  ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                + C  CNE G GW++ C +C F++HPKC 
Sbjct  368  GGGPFICCECNEQGSGWAYQCLECGFEVHPKCV  400


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG-RTGRT  517
            FEV+++SSD D  +F+E+ + MPW AIP+ D + K +L+R F + GIP L+ +  R  + 
Sbjct  82   FEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESKD  141

Query  516  LTT---EARNLVMSHGADAYPFT  457
             T    E   +V  +G DA+PFT
Sbjct  142  ETATLHEGVEVVYRYGVDAFPFT  164



>ref|XP_009417224.1| PREDICTED: probable nucleoredoxin 2 isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=326

 Score =   115 bits (289),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 96/155 (62%), Gaps = 3/155 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + + + FEV+F+S DRD++ F ++FS MPWLA+PYG++   +L+R F ++ IPMLV IG 
Sbjct  161  QERGEEFEVVFVSMDRDEAGFLQYFSGMPWLALPYGEESSKALARYFDIQEIPMLVIIGP  220

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T   RNL+  H   AYPFTE  ++ L+ + +E A+ +P    H  H     L++ 
Sbjct  221  DGKTVTKGGRNLINLHMEMAYPFTEAHIRLLQEKMDEEAQRYPTSFKHDGHRHVLNLVSE  280

Query  348  RQ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            +     Y C  C+E G GW++ C  C +++H KC 
Sbjct  281  KSGGGPYICCACDEQGLGWAYQCLACGYEIHLKCG  315


 Score = 80.9 bits (198),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRT  526
            ++  FE++F+SSD +QSSF++F+S MPW A+P+ D + K SLS  F++ GIP L+ +   
Sbjct  3    QELPFEIVFVSSDENQSSFEQFYSSMPWPAVPFSDINSKRSLSHKFQIEGIPALIILKPG  62

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
            G  + TE   ++  +G  A+PFT
Sbjct  63   GGLIQTEGVEILYRYGLQAFPFT  85



>gb|EYU22494.1| hypothetical protein MIMGU_mgv1a005241mg [Erythranthe guttata]
Length=492

 Score =   117 bits (293),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             EVIFISSD DQ +F+++FS+MPWLA+P+GD RK SLS  FKV GIP LVA+G TG+T++
Sbjct  399  LEVIFISSDIDQKAFEDYFSEMPWLALPFGDKRKESLSSWFKVEGIPTLVALGPTGKTVS  458

Query  510  TEARNLVMSHGADAYPFT  457
            T+AR L+M+HGA+AYPFT
Sbjct  459  TDARGLIMAHGAEAYPFT  476


 Score = 88.6 bits (218),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 58/85 (68%), Gaps = 1/85 (1%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            +A+ + FE++F+S D D  SFD +FSKMPWLAIP+ D D +  L+ LF V  IP LV + 
Sbjct  72   RAQSNNFEIVFVSRDADDESFDAYFSKMPWLAIPFSDSDTREKLNELFGVSEIPHLVILY  131

Query  531  RTGRTLTTEARNLVMSHGADAYPFT  457
              G+ LT+E   +++ +G+D YPFT
Sbjct  132  EDGKILTSEGVRVIVENGSDGYPFT  156


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = -3

Query  696  DAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRT  517
            ++FE++ +  D D+ SF E F K+PWL++P  D     L+R F++  IP +V I   G+T
Sbjct  237  ESFEIVMVPLDEDEDSFSEEFEKLPWLSLPINDKCCLKLARYFELGAIPTVVIISPNGKT  296

Query  516  LTTEARNLVMSHGADAYPFT  457
            L +     +  HG  AYPFT
Sbjct  297  LQSNVVEAIEEHGVKAYPFT  316



>gb|KJB18918.1| hypothetical protein B456_003G074700 [Gossypium raimondii]
Length=390

 Score =   116 bits (291),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 57/151 (38%), Positives = 88/151 (58%), Gaps = 1/151 (1%)
 Frame = -3

Query  705  AKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRT  526
            ++ D FEV+ +SSDRDQ  FD   S MPWLA+P+ D  +  L R+F ++ IP LV IG  
Sbjct  237  SRGDCFEVVLVSSDRDQKEFDVNISSMPWLALPFEDRTRQDLCRIFNIKVIPALVLIGPD  296

Query  525  GRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRR  346
            G+ ++T  + ++  +GA A+PFT+  ++E+E    +     P ++    H+    L   +
Sbjct  297  GKPISTNGKKIITLYGAKAFPFTQSSIEEIEESLRKEGDSLPRQIQDIKHQHVLKLDMAK  356

Query  345  QHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
              Y C+ C   G+ W+F CD CD+DLHP C 
Sbjct  357  A-YVCNYCERQGKFWAFSCDACDYDLHPTCV  386


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 41/78 (53%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++FIS D D+  F+  F  MPWL +P+  +    L   F V  IP LV +    +++ 
Sbjct  81   LEIVFISLDHDEDGFNAHFETMPWLTVPFDVNLHKKLRERFHVVRIPSLVPLNLDVQSVE  140

Query  510  TEARNLVMSHGADAYPFT  457
             +   L+   G DA+PFT
Sbjct  141  EDLIGLIEDFGEDAFPFT  158



>gb|AFW59396.1| hypothetical protein ZEAMMB73_974140 [Zea mays]
Length=432

 Score =   116 bits (291),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 84/147 (57%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVIF+S DR +  F    S MPWLAIPY D  +  L+R+F V+GIP L+ +G  G+ L
Sbjct  279  SFEVIFVSIDRSKGEFQASMSSMPWLAIPYSDAARKKLTRIFAVKGIPGLLILGLDGKVL  338

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
             T+ R  + ++GA A+PFTE R+ E+    +      P ++N   H     L   +  Y 
Sbjct  339  KTDGRTAISTYGAAAFPFTESRVSEVGEALKREGDKLPRRVNDPRHRHMLELDMAKA-YV  397

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W F C  C+FDLHP C 
Sbjct  398  CDECQQKGRYWVFSCKQCNFDLHPSCV  424


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 9/92 (10%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPY---GDDRKGSLSRLFKVRGIPMLV-  541
            ++   + E+IF+S DRD++SF + F  MPWLA+P+   G  R+   +R F V  IP L+ 
Sbjct  106  RSAGKSVEIIFVSLDRDEASFRDHFQGMPWLAVPFDAAGLLRQKLCAR-FAVERIPALIP  164

Query  540  ----AIGRTGRTLTTEARNLVMSHGADAYPFT  457
                A   +G     +A  LV  +G DAYPF+
Sbjct  165  LSASATPSSGLGSGEDAVRLVGEYGVDAYPFS  196



>ref|XP_009417223.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=337

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 96/155 (62%), Gaps = 3/155 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + + + FEV+F+S DRD++ F ++FS MPWLA+PYG++   +L+R F ++ IPMLV IG 
Sbjct  172  QERGEEFEVVFVSMDRDEAGFLQYFSGMPWLALPYGEESSKALARYFDIQEIPMLVIIGP  231

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T   RNL+  H   AYPFTE  ++ L+ + +E A+ +P    H  H     L++ 
Sbjct  232  DGKTVTKGGRNLINLHMEMAYPFTEAHIRLLQEKMDEEAQRYPTSFKHDGHRHVLNLVSE  291

Query  348  RQH---YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            +     Y C  C+E G GW++ C  C +++H KC 
Sbjct  292  KSGGGPYICCACDEQGLGWAYQCLACGYEIHLKCG  326


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/66 (39%), Positives = 41/66 (62%), Gaps = 1/66 (2%)
 Frame = -3

Query  651  SFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTLTTEARNLVMSHGA  475
            S ++F+S MPW A+P+ D + K SLS  F++ GIP L+ +   G  + TE   ++  +G 
Sbjct  31   SGNKFYSSMPWPAVPFSDINSKRSLSHKFQIEGIPALIILKPGGGLIQTEGVEILYRYGL  90

Query  474  DAYPFT  457
             A+PFT
Sbjct  91   QAFPFT  96



>ref|XP_008663577.1| PREDICTED: probable nucleoredoxin 3 [Zea mays]
Length=499

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 84/147 (57%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVIF+S DR +  F    S MPWLAIPY D  +  L+R+F V+GIP L+ +G  G+ L
Sbjct  346  SFEVIFVSIDRSKGEFQASMSSMPWLAIPYSDAARKKLTRIFAVKGIPGLLILGLDGKVL  405

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
             T+ R  + ++GA A+PFTE R+ E+    +      P ++N   H     L   +  Y 
Sbjct  406  KTDGRTAISTYGAAAFPFTESRVSEVGEALKREGDKLPRRVNDPRHRHMLELDMAKA-YV  464

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W F C  C+FDLHP C 
Sbjct  465  CDECQQKGRYWVFSCKQCNFDLHPSCV  491


 Score = 58.5 bits (140),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 52/92 (57%), Gaps = 9/92 (10%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPY---GDDRKGSLSRLFKVRGIPMLV-  541
            ++   + E+IF+S DRD++SF + F  MPWLA+P+   G  R+   +R F V  IP L+ 
Sbjct  173  RSAGKSVEIIFVSLDRDEASFRDHFQGMPWLAVPFDAAGLLRQKLCAR-FAVERIPALIP  231

Query  540  ----AIGRTGRTLTTEARNLVMSHGADAYPFT  457
                A   +G     +A  LV  +G DAYPF+
Sbjct  232  LSASATPSSGLGSGEDAVRLVGEYGVDAYPFS  263



>ref|XP_010256393.1| PREDICTED: uncharacterized protein LOC104596799 [Nelumbo nucifera]
Length=1312

 Score =   119 bits (298),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/84 (67%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = -3

Query  708   KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
             K KDD FEVI+IS D D +SF EFFS MPWLA+PYGDDR+  LSR FK+ GIP +VAIG+
Sbjct  1220  KHKDDEFEVIYISYDTDLASFKEFFSGMPWLALPYGDDREKLLSRKFKIEGIPTVVAIGQ  1279

Query  528   TGRTLTTEARNLVMSHGADAYPFT  457
             TGRT+T  A + +M HGA+AYPFT
Sbjct  1280  TGRTITKNAWDHLMVHGANAYPFT  1303


 Score = 77.8 bits (190),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 48/79 (61%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDD-RKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEVIF+SSD+D  SF + FSKMPW A+P+ D   +  L  +FKV  IP LV + + GR  
Sbjct  906  FEVIFVSSDKDNESFIQHFSKMPWFAVPFSDAMTRDRLHEVFKVNNIPSLVILDKKGRVS  965

Query  513  TTEARNLVMSHGADAYPFT  457
            +     +V  HG   YPFT
Sbjct  966  SYNGAWIVRVHGVQGYPFT  984


 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708   KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
             K K ++FEVI+IS    Q S++  F  MPWLA P+ D     L    ++  +P LV +G 
Sbjct  1060  KNKGESFEVIWISLGNSQESYENGFRNMPWLAFPFEDKSYKKLYPYLELTTLPTLVVLGP  1119

Query  528   TGRTLTTEARNLVMSHGADAYPFT  457
              G TL + A +LV  + A AYPF+
Sbjct  1120  NGETLNSNAVDLVREYAALAYPFS  1143



>ref|XP_009798867.1| PREDICTED: probable nucleoredoxin 2 [Nicotiana sylvestris]
Length=442

 Score =   116 bits (290),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/153 (43%), Positives = 98/153 (64%), Gaps = 5/153 (3%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            +D+ FE++F+SSDRDQ  F  +F  MPWLA+PY D    +L++ F +RGIP LV +G  G
Sbjct  281  EDEDFEIVFVSSDRDQVQFVTYFETMPWLAVPYDDPTIKNLAKYFDIRGIPSLVVLGPDG  340

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T+T + R+L+  +  +AYPFT+ R+  LE + +E+AKG P K  H     HEL L    
Sbjct  341  KTVTKQGRSLINLYKGNAYPFTKTRVGILEKQMDEVAKGLP-KTEHHSGHRHELTLVPEG  399

Query  342  H----YTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
            H    + C  C+E G GW++ C +C +++HPKC
Sbjct  400  HGGGAFICCDCDEQGYGWAYQCLECGYEVHPKC  432


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 4/85 (5%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTG  523
            D  FEV+F+SSD D  +F+ + S MPWLAIP+ D D + +L++ F V GIP L+ +    
Sbjct  112  DPGFEVVFVSSDEDLDAFNTYKSSMPWLAIPFSDLDARRALTQKFDVEGIPTLIILQPNS  171

Query  522  R---TLTTEARNLVMSHGADAYPFT  457
                 + ++   LV  +G  A+PFT
Sbjct  172  NKDAAVISDGVELVYRYGVQAFPFT  196



>ref|XP_009417222.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 96/154 (62%), Gaps = 3/154 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + + + FEV+F+S DRD++ F ++FS MPWLA+PYG++   +L+R F ++ IPMLV IG 
Sbjct  232  QERGEEFEVVFVSMDRDEAGFLQYFSGMPWLALPYGEESSKALARYFDIQEIPMLVIIGP  291

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T   RNL+  H   AYPFTE  ++ L+ + +E A+ +P    H  H     L++ 
Sbjct  292  DGKTVTKGGRNLINLHMEMAYPFTEAHIRLLQEKMDEEAQRYPTSFKHDGHRHVLNLVSE  351

Query  348  RQ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
            +     Y C  C+E G GW++ C  C +++H KC
Sbjct  352  KSGGGPYICCACDEQGLGWAYQCLACGYEIHLKC  385


 Score = 80.9 bits (198),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 56/83 (67%), Gaps = 1/83 (1%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRT  526
            ++  FE++F+SSD +QSSF++F+S MPW A+P+ D + K SLS  F++ GIP L+ +   
Sbjct  74   QELPFEIVFVSSDENQSSFEQFYSSMPWPAVPFSDINSKRSLSHKFQIEGIPALIILKPG  133

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
            G  + TE   ++  +G  A+PFT
Sbjct  134  GGLIQTEGVEILYRYGLQAFPFT  156



>ref|XP_006386162.1| hypothetical protein POPTR_0002s01870g [Populus trichocarpa]
 gb|ERP63959.1| hypothetical protein POPTR_0002s01870g [Populus trichocarpa]
Length=427

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/155 (39%), Positives = 93/155 (60%), Gaps = 3/155 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  +D FE++F+SSDRDQ++FD +F+ MPWL +P+GD     L++ F V+GIP LV +G 
Sbjct  262  KGNEDDFEIVFVSSDRDQAAFDSYFNSMPWLTLPFGDPANKILAKHFDVKGIPCLVILGP  321

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehell  358
             G+T+T   RNL+  +  +AYPFTE ++  LE + +E AK  P+      H         
Sbjct  322  DGKTVTKHGRNLINLYKENAYPFTEAQVDLLEKQIDEEAKSLPKSKYHAGHRHELGLVSE  381

Query  357  LTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             T    + C  C+E G GW++ C +C +++H KC 
Sbjct  382  GTGGGPFICCDCDEQGSGWAYLCLECGYEVHTKCV  416


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K+K   FE++FISSD D  +F+ + + MPWL+IP+ D + K +L+  F++  IP LV + 
Sbjct  91   KSKGSNFEIVFISSDEDLDAFNNYRANMPWLSIPFSDLETKRALNSKFEIEAIPFLVILQ  150

Query  531  ---RTGRTLTTEARNLVMSHGADAYPFT  457
                       +   L+   G  A+PFT
Sbjct  151  PEDNKYEATIHDGVELLNRFGVQAFPFT  178



>ref|XP_009334668.1| PREDICTED: probable nucleoredoxin 2 [Pyrus x bretschneideri]
 ref|XP_009334675.1| PREDICTED: probable nucleoredoxin 2 [Pyrus x bretschneideri]
Length=432

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 96/149 (64%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++F+SSDRDQ+SFD +F+ MPW+A+P+GD     L + F V+GIP LV +G  G+T+T
Sbjct  273  FEIVFVSSDRDQTSFDSYFNTMPWVALPFGDPNIKELVKHFDVKGIPCLVILGPDGKTVT  332

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFT+ +L+ LE + +E AK  P  + H  H     L++       
Sbjct  333  QQGRNLINLYKENAYPFTDAKLELLEKKMDEEAKNLPRSVYHGGHRHELNLVSEGNGGGP  392

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  393  FICCDCDEQGCGWAYQCLECGYEVHPKCV  421


 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 47/82 (57%), Gaps = 4/82 (5%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG---RTG  523
            FE++++SSD D  +F+ + + MPWLAIP+ D D K +L+R F V  IP LV +       
Sbjct  101  FEIVYVSSDEDSDAFNIYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKD  160

Query  522  RTLTTEARNLVMSHGADAYPFT  457
                 +   ++  +G  A+PFT
Sbjct  161  EATLHDGVEIIYRYGVVAFPFT  182



>ref|XP_008806406.1| PREDICTED: probable nucleoredoxin 2 [Phoenix dactylifera]
Length=413

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/154 (39%), Positives = 99/154 (64%), Gaps = 3/154 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K++ FE++F+S D+D++ + + +S+MPWLA+PY D+   +L+R F ++GIP L+ IG 
Sbjct  232  KEKNEEFEIVFVSMDKDEAGYLQCYSEMPWLALPYNDESSRALARYFDLQGIPALIIIGP  291

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T E RNL+  H   A+PFTE +++ L+ + +E AKG+P   +H  H     L++ 
Sbjct  292  DGKTVTKEGRNLINLHLEMAFPFTEAQIRLLQEKLDEEAKGYPSTFHHVGHRHILNLVSE  351

Query  348  RQH---YTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
             +    Y C  C E G GW++ C  C +++H KC
Sbjct  352  NRGGGPYICCECEEQGLGWAYQCLGCGYEIHLKC  385


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDR-KGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FEV+++SSD D +SF+ F S M W AIP+ D + + SL++ F++ GIP L+ +   G  +
Sbjct  78   FEVVYVSSDEDHASFERFHSLMLWPAIPFSDLKSRRSLTQRFQIEGIPSLIILNSKGELI  137

Query  513  TTEARNLVMSHGADAYPFT  457
             T+   LV  +   A+PFT
Sbjct  138  RTDGVELVNRYECRAFPFT  156



>ref|XP_002867308.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43567.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=392

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVI +S+DRD   F+   + MPWLAIPY D  +  L R+F ++ IP LV IG   +T+
Sbjct  239  SFEVILVSTDRDSREFNINMTNMPWLAIPYEDRTRQDLCRIFSIKLIPALVIIGPEEKTV  298

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
            TT AR +V  +G+ ++PFTE R+ EL+A  ++     P K+    HE    L   +  Y 
Sbjct  299  TTNAREMVSLYGSRSFPFTESRIVELKACLKKEGDSLPRKVKDKKHEHELKLDMAKA-YV  357

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W+F CD CD+DLHP C 
Sbjct  358  CDFCKKQGRFWAFSCDACDYDLHPTCV  384


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/84 (31%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + + +  E+IF+S D D + F E F  MPWLA+P+  +    L   +++  IP LV +  
Sbjct  73   QTRGEELEIIFVSFDHDMTLFYEHFWCMPWLAVPFNLNLLNKLRDKYRISRIPSLVPLYS  132

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
               ++  +   L+  +G +A+PFT
Sbjct  133  DEISVAEDVIGLIEDYGPEAFPFT  156



>ref|XP_011083440.1| PREDICTED: probable nucleoredoxin 2 [Sesamum indicum]
Length=432

 Score =   115 bits (287),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 97/149 (65%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++F+SSD DQ+SF  +F  MPWLA+PYGD    +L++ F +RGIP LV +G  G+T+T
Sbjct  277  FEIVFVSSDHDQTSFLSYFQTMPWLALPYGDPNIKALTKHFDIRGIPSLVILGPDGKTVT  336

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFTE R++ LE + +E AK  P+   H+ H     L+++      
Sbjct  337  KQGRNLLNLYQENAYPFTEARVEFLERQADEAAKNLPKSEFHSGHGHRLTLVSQGNGGGP  396

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C +C +++HPKC 
Sbjct  397  FICCDCDEQGSGWAYQCIECGYEVHPKCV  425


 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 56/88 (64%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K  D  FE++F+SSD D ++FD++ S MPWLA+P+ D + K +LSR F V GIP L+ + 
Sbjct  100  KNSDPGFEIVFVSSDEDVNAFDDYRSSMPWLAVPFSDLELKRALSRRFDVEGIPCLIILQ  159

Query  531  RT---GRTLTTEARNLVMSHGADAYPFT  457
                 G ++  +  +L+  +G  AYPFT
Sbjct  160  PNNCKGDSIVIDGVDLIYRYGVQAYPFT  187



>ref|XP_008357428.1| PREDICTED: probable nucleoredoxin 3 [Malus domestica]
 ref|XP_008357429.1| PREDICTED: probable nucleoredoxin 3 [Malus domestica]
Length=379

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 63/149 (42%), Positives = 88/149 (59%), Gaps = 1/149 (1%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            D  FE+I +S+DRD   F+   S MPWLAIPY D  +  L R+F ++ IP LV IG  G+
Sbjct  228  DQDFEIILVSTDRDLKEFELNTSSMPWLAIPYQDKTRQDLCRIFDIKVIPALVLIGPNGK  287

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
             ++T  + +V  HGA A+PFTE R+ ELEAE  +  +  P ++    H+    L   +  
Sbjct  288  AISTNGKAMVSLHGAKAFPFTEARITELEAELRKEGEALPPQVKDLKHKHLLKLEMAKA-  346

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            Y CD C + G+ W+F C  CD+DLHP C 
Sbjct  347  YVCDYCQKQGRFWAFSCGVCDYDLHPNCV  375


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/78 (38%), Positives = 49/78 (63%), Gaps = 0/78 (0%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE+IFIS D ++  F+E F  MPWLA+P+  +    LS ++ +  IP L+++   G ++ 
Sbjct  70   FEIIFISFDPNEEKFNEHFKCMPWLAVPFDANLHKRLSDMYXIDRIPSLISLSSDGLSIE  129

Query  510  TEARNLVMSHGADAYPFT  457
             +   L+  +GADA+PFT
Sbjct  130  EDLVGLIEDYGADAFPFT  147



>ref|XP_002285895.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Vitis vinifera]
Length=425

 Score =   114 bits (286),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 93/151 (62%), Gaps = 3/151 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FE++F+SSDRDQ SFD +F  MPWLA+P+GD    +L++ F V+GIP LV +G  G+
Sbjct  263  EEDFEIVFVSSDRDQPSFDSYFGTMPWLAVPFGDPTIKTLTKYFDVQGIPCLVILGPDGK  322

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTR  349
            T+T + R L+  +  +AYPFTE +L+ LE + +E AK  P       H          T 
Sbjct  323  TVTKQGRYLINLYQENAYPFTEAKLELLEKQMDEEAKSLPRSEYHAGHRHELTLVSEGTG  382

Query  348  RQHYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
               + C  C+E G GW++ C +C +++HPKC
Sbjct  383  GGPFICCDCDEQGLGWAYQCLECGYEVHPKC  413


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG---RT  526
             FE++F+SSD D  +FD F + MPWLA+P+ D + K +L+R F + GIP LV +      
Sbjct  95   GFEIVFVSSDEDSDAFDNFRACMPWLAVPFSDLETKKALNRKFDIEGIPCLVILQPNDNK  154

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
                  +   L+  +G +A+PFT
Sbjct  155  DEATLHDGVELIYRYGVNAFPFT  177



>ref|XP_010664141.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Vitis vinifera]
Length=391

 Score =   114 bits (286),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
             ++ FE++F+SSDRDQ SFD +F  MPWLA+P+GD    +L++ F V+GIP LV +G  G
Sbjct  228  NEEDFEIVFVSSDRDQPSFDSYFGTMPWLAVPFGDPTIKTLTKYFDVQGIPCLVILGPDG  287

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLT  352
            +T+T + R L+  +  +AYPFTE +L+ LE + +E AK  P       H          T
Sbjct  288  KTVTKQGRYLINLYQENAYPFTEAKLELLEKQMDEEAKSLPRSEYHAGHRHELTLVSEGT  347

Query  351  RRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
                + C  C+E G GW++ C +C +++HPKC
Sbjct  348  GGGPFICCDCDEQGLGWAYQCLECGYEVHPKC  379


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 49/83 (59%), Gaps = 4/83 (5%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG---RT  526
             FE++F+SSD D  +FD F + MPWLA+P+ D + K +L+R F + GIP LV +      
Sbjct  61   GFEIVFVSSDEDSDAFDNFRACMPWLAVPFSDLETKKALNRKFDIEGIPCLVILQPNDNK  120

Query  525  GRTLTTEARNLVMSHGADAYPFT  457
                  +   L+  +G +A+PFT
Sbjct  121  DEATLHDGVELIYRYGVNAFPFT  143



>ref|XP_008350516.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=389

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++ +SSDRDQ+SFD +F+ MPWLA+P+GD     L + F V+GIP LV +G  G+T+T
Sbjct  228  FEIVLVSSDRDQTSFDSYFNTMPWLALPFGDPNIKELVKHFDVKGIPCLVILGPDGKTVT  287

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFT+ +L+ LE + +E AK  P  + H  H     L++       
Sbjct  288  QQGRNLINLYKENAYPFTDAKLELLEKKMDEEAKNLPRSVYHGGHRHELNLVSEGNGGGP  347

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C E G GW++ C +C +++HPKC 
Sbjct  348  FICCDCEEQGCGWAYQCLECGYEVHPKCV  376


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 4/82 (5%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG---RTG  523
            FE++++SSD D  +F+ + + MPWLAIP+ D D K +L+R F V  IP LV +       
Sbjct  56   FEIVYVSSDEDSXAFNXYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKD  115

Query  522  RTLTTEARNLVMSHGADAYPFT  457
                 +   ++  +G +A+PFT
Sbjct  116  EATLHDGVEIIYRYGVEAFPFT  137



>ref|NP_567869.1| putative nucleoredoxin 3 [Arabidopsis thaliana]
 ref|NP_974651.1| putative nucleoredoxin 3 [Arabidopsis thaliana]
 sp|Q8VZQ0.1|NRX3_ARATH RecName: Full=Probable nucleoredoxin 3; Short=AtNrx3 [Arabidopsis 
thaliana]
 gb|AAL36301.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20287.1| putative receptor kinase [Arabidopsis thaliana]
 gb|AEE85880.1| putative nucleoredoxin 3 [Arabidopsis thaliana]
 gb|AEE85881.1| putative nucleoredoxin 3 [Arabidopsis thaliana]
Length=392

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVI IS+DRD   F+   + MPWLAIPY D  +  L R+F V+ IP LV IG   +T+
Sbjct  239  SFEVILISTDRDSREFNINMTNMPWLAIPYEDRTRQDLCRIFNVKLIPALVIIGPEEKTV  298

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
            TT AR +V  +G+ ++PFTE R+ EL+A  ++     P K+    HE    L   +  Y 
Sbjct  299  TTNAREMVSLYGSRSFPFTESRIVELKACLKKEGDSLPRKVKDNKHEHELKLDMAKA-YV  357

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W+F C+ CD+DLHP C 
Sbjct  358  CDFCKKQGRFWAFSCNACDYDLHPTCV  384


 Score = 57.4 bits (137),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 46/84 (55%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + + +  E+IF+S D D +SF E F  MPWLA+P+       L   + +  IP LV +  
Sbjct  73   QNRGEELEIIFVSFDHDMTSFYEHFWCMPWLAVPFNLSLLNKLRDKYGISRIPSLVPLYS  132

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
               ++  +   L+  +G++A+PFT
Sbjct  133  DEISVAEDVIGLIEDYGSEAFPFT  156



>ref|XP_010525856.1| PREDICTED: probable nucleoredoxin 3 isoform X3 [Tarenaya hassleriana]
Length=396

 Score =   114 bits (285),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 1/148 (1%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEVI +S+DRD   FD+  S MPWLAIPY D     L R+F ++ IP LV IG  G+
Sbjct  241  ENCFEVILVSTDRDPVEFDKNMSSMPWLAIPYEDRTCQDLVRIFNIKLIPSLVIIGPEGK  300

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
            TL   AR ++  +GA +YPFT+ R+ E+EA  ++  +  P  +    HE    L   +  
Sbjct  301  TLNANARAMISLYGARSYPFTDSRIAEIEACLKKEGEALPRCVKDKKHEHDLNLDMAKA-  359

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
            Y CD C + G  W+F CD CD+DLHP C
Sbjct  360  YVCDFCKKQGSFWAFSCDACDYDLHPTC  387


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++FIS D D++ + E F  MPWLA+P+       L   +K+  IP LV +      + 
Sbjct  82   LEIVFISFDHDETLYYEHFWCMPWLAVPFSASLSKKLKDNYKIVSIPSLVPLSPDRFFVD  141

Query  510  TEAR-NLVMSHGADAYPFT  457
             +    L+  +G++AYPFT
Sbjct  142  DDDVIGLIEDYGSEAYPFT  160



>ref|XP_008466458.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Cucumis melo]
 ref|XP_008466459.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Cucumis melo]
Length=412

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 95/153 (62%), Gaps = 3/153 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            +D+ FE++F+SSDRD+ SF  +F  MPWLA+P+GD     L++ F V+GIP L+ +   G
Sbjct  248  EDEDFEIVFVSSDRDEDSFHSYFGSMPWLALPFGDPMIRELAKHFDVQGIPCLIILAPNG  307

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T+T + RNL+  +  +AYPFTE RL+EL  E  E AK  P  + H  H     L++   
Sbjct  308  KTITKQGRNLINLYRENAYPFTEARLEELIKEMGEEAKKLPTSVRHVGHRHELNLVSEGN  367

Query  342  ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                + C  C+E G GW++ C +C F++HPKC 
Sbjct  368  GGGPFICCECDEQGSGWAYQCLECGFEVHPKCV  400


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 52/83 (63%), Gaps = 5/83 (6%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG-RTGRT  517
            FEV+++SSD D  +F+E+ + MPW AIP+ D + K +L+R F + GIP L+ +  R  + 
Sbjct  82   FEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESKD  141

Query  516  LT---TEARNLVMSHGADAYPFT  457
             T    E   +V  +G DA+PFT
Sbjct  142  ETGTLNEGVEVVYRYGVDAFPFT  164



>ref|XP_010525854.1| PREDICTED: probable nucleoredoxin 3 isoform X1 [Tarenaya hassleriana]
Length=430

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 1/148 (1%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEVI +S+DRD   FD+  S MPWLAIPY D     L R+F ++ IP LV IG  G+
Sbjct  275  ENCFEVILVSTDRDPVEFDKNMSSMPWLAIPYEDRTCQDLVRIFNIKLIPSLVIIGPEGK  334

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
            TL   AR ++  +GA +YPFT+ R+ E+EA  ++  +  P  +    HE    L   +  
Sbjct  335  TLNANARAMISLYGARSYPFTDSRIAEIEACLKKEGEALPRCVKDKKHEHDLNLDMAKA-  393

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
            Y CD C + G  W+F CD CD+DLHP C
Sbjct  394  YVCDFCKKQGSFWAFSCDACDYDLHPTC  421


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++FIS D D++ + E F  MPWLA+P+       L   +K+  IP LV +      + 
Sbjct  116  LEIVFISFDHDETLYYEHFWCMPWLAVPFSASLSKKLKDNYKIVSIPSLVPLSPDRFFVD  175

Query  510  TEAR-NLVMSHGADAYPFT  457
             +    L+  +G++AYPFT
Sbjct  176  DDDVIGLIEDYGSEAYPFT  194



>ref|XP_008387909.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=436

 Score =   114 bits (286),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 94/149 (63%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++ +SSDRDQ+SFD +F+ MPWLA+P+GD     L + F V+GIP LV +G  G+T+T
Sbjct  275  FEIVLVSSDRDQTSFDSYFNTMPWLALPFGDPNIKELVKHFDVKGIPCLVILGPDGKTVT  334

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ---H  340
             + RNL+  +  +AYPFT+ +L+ LE + +E AK  P  + H  H     L++       
Sbjct  335  QQGRNLINLYKENAYPFTDAKLELLEKKMDEEAKNLPRSVYHGGHRHELNLVSEGNGGGP  394

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C E G GW++ C +C +++HPKC 
Sbjct  395  FICCDCEEQGCGWAYQCLECGYEVHPKCV  423


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/82 (37%), Positives = 48/82 (59%), Gaps = 4/82 (5%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG---RTG  523
            FE++++SSD D  +F+ + + MPWLAIP+ D D K +L+R F V  IP LV +       
Sbjct  103  FEIVYVSSDEDSDAFNIYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKD  162

Query  522  RTLTTEARNLVMSHGADAYPFT  457
                 +   ++  +G +A+PFT
Sbjct  163  EATLHDGVEIIYRYGVEAFPFT  184



>ref|XP_010525855.1| PREDICTED: probable nucleoredoxin 3 isoform X2 [Tarenaya hassleriana]
Length=417

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 1/148 (1%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEVI +S+DRD   FD+  S MPWLAIPY D     L R+F ++ IP LV IG  G+
Sbjct  262  ENCFEVILVSTDRDPVEFDKNMSSMPWLAIPYEDRTCQDLVRIFNIKLIPSLVIIGPEGK  321

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQH  340
            TL   AR ++  +GA +YPFT+ R+ E+EA  ++  +  P  +    HE    L   +  
Sbjct  322  TLNANARAMISLYGARSYPFTDSRIAEIEACLKKEGEALPRCVKDKKHEHDLNLDMAKA-  380

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
            Y CD C + G  W+F CD CD+DLHP C
Sbjct  381  YVCDFCKKQGSFWAFSCDACDYDLHPTC  408


 Score = 54.3 bits (129),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 43/79 (54%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
             E++FIS D D++ + E F  MPWLA+P+       L   +K+  IP LV +      + 
Sbjct  103  LEIVFISFDHDETLYYEHFWCMPWLAVPFSASLSKKLKDNYKIVSIPSLVPLSPDRFFVD  162

Query  510  TEAR-NLVMSHGADAYPFT  457
             +    L+  +G++AYPFT
Sbjct  163  DDDVIGLIEDYGSEAYPFT  181



>ref|XP_010692758.1| PREDICTED: probable nucleoredoxin 2 [Beta vulgaris subsp. vulgaris]
 ref|XP_010692759.1| PREDICTED: probable nucleoredoxin 2 [Beta vulgaris subsp. vulgaris]
Length=416

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 97/153 (63%), Gaps = 3/153 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            + D FE++F+SSDRD++SF  +F +MPWLA+P+ D     L++ F VR IP LV +G  G
Sbjct  256  EQDDFEIVFVSSDRDEASFHSYFQRMPWLALPFRDRTIKDLAKHFDVREIPCLVILGPDG  315

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T+T + R L+  +  +AYPFTE RL+ LE + +E AK  P+   H  H+    L++ R 
Sbjct  316  KTVTKQGRYLINLYQENAYPFTEARLEFLEKQMDEEAKSLPKSAYHERHQHELNLVSERT  375

Query  342  ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                + C  C+E G GW++ C DC F++HPKC 
Sbjct  376  GGGPFICCDCDEQGSGWAYQCLDCGFEVHPKCV  408


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 31/90 (34%), Positives = 54/90 (60%), Gaps = 6/90 (7%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAI-  535
            +++   FE+I +SSD D  +F+ + + MPWL++PY D + K +L++ F V  +P LV + 
Sbjct  83   RSQGSDFEIILVSSDEDIGAFNSYRASMPWLSVPYSDLETKKALNQTFDVEAMPYLVFLH  142

Query  534  --GRTGRTLTT--EARNLVMSHGADAYPFT  457
                +G   TT  +   L+  +G +A+PFT
Sbjct  143  PSNYSGNDDTTMHDGVELIYRYGIEAFPFT  172



>ref|XP_009127152.1| PREDICTED: probable nucleoredoxin 3 [Brassica rapa]
 ref|XP_009127161.1| PREDICTED: probable nucleoredoxin 3 [Brassica rapa]
 emb|CDY28251.1| BnaA01g05980D [Brassica napus]
Length=390

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVI +S+DRD   F+   + MPWLAIPY D  +  L R+F ++ IP LV IG   +T+
Sbjct  239  SFEVILVSTDRDAREFNINMTNMPWLAIPYEDRTRQDLCRIFNIKLIPALVIIGPEEKTV  298

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
             T AR +V  +G+ +YPFTE R+ ELEA  ++    +P K+    HE    L   +  Y 
Sbjct  299  CTNAREMVSLYGSRSYPFTESRVAELEACLKKEGDSFPRKVKDKKHEHELKLDMAKG-YV  357

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W+F CD CD+DLHP C 
Sbjct  358  CDFCKKQGKFWAFSCDACDYDLHPTCV  384


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + + +  E+IF+S D D + F E F  MPWLA+P+    +  L+  ++V  IP LV +  
Sbjct  73   QKRGEELEIIFVSFDHDMTLFYEHFWSMPWLAVPFSLSLRNKLTDKYRVARIPSLVPLYP  132

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
               ++  +   L+  +G +A+PFT
Sbjct  133  DEISVADDVIGLIEDYGPEAFPFT  156



>ref|XP_003527520.1| PREDICTED: probable nucleoredoxin 2-like isoform 1 [Glycine max]
Length=411

 Score =   114 bits (285),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 3/152 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEV+ ISSDRDQ+SFD ++S MPWLA+P+GD    +L R + V+GIP LV IG  G+
Sbjct  250  EEDFEVVLISSDRDQASFDSYYSTMPWLALPFGDPEIKNLVRHYNVQGIPWLVIIGPDGK  309

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ-  343
            T+T   R+L+  +  +AYPFT  +++ELE + EE AKG P  + H  H     L++    
Sbjct  310  TITVHGRSLINLYQENAYPFTNAKVEELEKQLEEEAKGLPALVYHEGHRHDLNLVSDGNG  369

Query  342  --HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
               + C  C+E G  W++ C  C +++HPKC 
Sbjct  370  GGPFICCVCDEQGSSWAYQCLQCGYEVHPKCV  401


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K++    E++++SSD +  +F+ F+  MPWLAIP+ D + K SL+R + V  +P L+ + 
Sbjct  75   KSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDVEAVPCLILLQ  134

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
               R      R+   L+  +G  AYPF+
Sbjct  135  PDDRKEHVTVRDGVELIYRYGIQAYPFS  162



>gb|KHN45956.1| Putative nucleoredoxin 2 [Glycine soja]
Length=419

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEV+ ISSDRDQ+SFD ++S MPWLA+P+GD    +L R + V+GIP LV IG  G+
Sbjct  251  EEDFEVVLISSDRDQASFDSYYSTMPWLALPFGDPEIKNLVRHYNVQGIPWLVIIGPDGK  310

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ-  343
            T+T   R+L+  +  +AYPFT+ +++ELE + EE AKG P  + H  H     L++    
Sbjct  311  TITVHGRSLINLYQENAYPFTKAKVEELEKQLEEEAKGLPALVYHQGHRHDLNLVSDGNG  370

Query  342  --HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
               + C  C+E G  W++ C  C +++HPKC 
Sbjct  371  GGPFICCVCDEQGSSWAYQCLQCGYEVHPKCV  402


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K++   FE++++SSD D ++F+ F+  MPW+AIP+ D + K SL+R F V  +P L+ + 
Sbjct  76   KSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAVPCLILLQ  135

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
               R      R+   L+  +G  AYPF+
Sbjct  136  PDDRKEHATVRDGVELIYRYGIQAYPFS  163



>ref|NP_001276271.1| probable nucleoredoxin 2-like [Glycine max]
 gb|ACU20924.1| unknown [Glycine max]
Length=423

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEV+ ISSDRDQ+SFD ++S MPWLA+P+GD    +L R + V+GIP LV IG  G+
Sbjct  255  EEDFEVVLISSDRDQASFDSYYSTMPWLALPFGDPEIKNLVRHYNVQGIPWLVIIGPDGK  314

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ-  343
            T+T   R+L+  +  +AYPFT+ +++ELE + EE AKG P  + H  H     L++    
Sbjct  315  TITVHGRSLINLYQENAYPFTKAKVEELEKQLEEEAKGLPALVYHQGHRHDLNLVSDGNG  374

Query  342  --HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
               + C  C+E G  W++ C  C +++HPKC 
Sbjct  375  GGPFICCVCDEQGSSWAYQCLQCGYEVHPKCV  406


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K++   FE++++SSD D ++F+ F+  MPW+AIP+ D + K SL+R F V  +P L+ + 
Sbjct  80   KSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAVPCLILLQ  139

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
               R      R+   L+  +G  AYPF+
Sbjct  140  PDDRKEHATVRDGIELIYRYGIQAYPFS  167



>gb|KHN09060.1| Putative nucleoredoxin 2 [Glycine soja]
Length=411

 Score =   114 bits (284),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 3/152 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEV+ ISSDRDQ+SFD ++S MPWLA+P+GD    +L R + V+GIP LV IG  G+
Sbjct  250  EEDFEVVLISSDRDQASFDSYYSTMPWLALPFGDPEIKNLVRHYNVQGIPWLVIIGPDGK  309

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ-  343
            T+T   R+L+  +  +AYPFT  +++ELE + EE AKG P  + H  H     L++    
Sbjct  310  TITVHGRSLINLYQENAYPFTNAKVEELEKQLEEEAKGLPALVYHEGHRHDLNLVSDGNG  369

Query  342  --HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
               + C  C+E G  W++ C  C +++HPKC 
Sbjct  370  GGPFICCICDEQGSSWAYQCLQCGYEVHPKCV  401


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K++    E++++SSD +  +F+ F+  MPWLAIP+ D + K SL+R + V  +P L+ + 
Sbjct  75   KSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDVEAVPCLILLQ  134

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
               R      R+   L+  +G  AYPF+
Sbjct  135  PDDRKEHVTVRDGVELIYRYGIQAYPFS  162



>ref|XP_006342078.1| PREDICTED: probable nucleoredoxin 2-like [Solanum tuberosum]
Length=440

 Score =   114 bits (285),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 96/153 (63%), Gaps = 3/153 (2%)
 Frame = -3

Query  702  KDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTG  523
            +D+ FE++F+SSD +Q  F  +F  MPWLAIP+ D    +L++ F +RGIP LV +G  G
Sbjct  279  EDEDFEIVFVSSDHNQVDFTTYFETMPWLAIPFDDPTINALAKYFDIRGIPSLVILGPDG  338

Query  522  RTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ  343
            +T+T + R+L+  +  +AYPFT+ R+  LE +  E+AKG P+  NH+ H     L+    
Sbjct  339  KTVTKQGRSLINLYKENAYPFTKTRVGILEKQMNEIAKGLPKTENHSGHRHELTLVPEGH  398

Query  342  ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
                + C  C+E G GW++ C +C +++HPKC 
Sbjct  399  GGGAFICCDCDEQGYGWAYQCLECGYEVHPKCV  431


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+SSD + ++F+ + S MPW AIP+ D +++ +L++ F V GIP ++ +      L
Sbjct  112  FEIVFVSSDENLNAFNTYRSSMPWFAIPFSDLEKRRALTQKFDVEGIPCMIILQPNDDKL  171

Query  513  TT----EARNLVMSHGADAYPFT  457
             T    +   LV  +G  A+PFT
Sbjct  172  DTAVIKDGVELVYRYGVQAFPFT  194



>ref|XP_003527521.1| PREDICTED: probable nucleoredoxin 2-like isoform 2 [Glycine max]
Length=434

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 96/152 (63%), Gaps = 3/152 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEV+ ISSDRDQ+SFD ++S MPWLA+P+GD    +L R + V+GIP LV IG  G+
Sbjct  273  EEDFEVVLISSDRDQASFDSYYSTMPWLALPFGDPEIKNLVRHYNVQGIPWLVIIGPDGK  332

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ-  343
            T+T   R+L+  +  +AYPFT  +++ELE + EE AKG P  + H  H     L++    
Sbjct  333  TITVHGRSLINLYQENAYPFTNAKVEELEKQLEEEAKGLPALVYHEGHRHDLNLVSDGNG  392

Query  342  --HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
               + C  C+E G  W++ C  C +++HPKC 
Sbjct  393  GGPFICCVCDEQGSSWAYQCLQCGYEVHPKCV  424


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/88 (34%), Positives = 51/88 (58%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K++    E++++SSD +  +F+ F+  MPWLAIP+ D + K SL+R + V  +P L+ + 
Sbjct  75   KSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDVEAVPCLILLQ  134

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
               R      R+   L+  +G  AYPF+
Sbjct  135  PDDRKEHVTVRDGVELIYRYGIQAYPFS  162



>ref|XP_006577959.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Glycine 
max]
Length=446

 Score =   114 bits (285),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 97/152 (64%), Gaps = 3/152 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            ++ FEV+ ISSDRDQ+SFD ++S MPWLA+P+GD    +L R + V+GIP LV IG  G+
Sbjct  278  EEDFEVVLISSDRDQASFDSYYSTMPWLALPFGDPEIKNLVRHYNVQGIPWLVIIGPDGK  337

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ-  343
            T+T   R+L+  +  +AYPFT+ +++ELE + EE AKG P  + H  H     L++    
Sbjct  338  TITVHGRSLINLYQENAYPFTKAKVEELEKQLEEEAKGLPALVYHQGHRHDLNLVSDGNG  397

Query  342  --HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
               + C  C+E G  W++ C  C +++HPKC 
Sbjct  398  GGPFICCVCDEQGSSWAYQCLQCGYEVHPKCV  429


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K++   FE++++SSD D ++F+ F+  MPW+AIP+ D + K SL+R F V  +P L+ + 
Sbjct  80   KSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAVPCLILLQ  139

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
               R      R+   L+  +G  AYPF+
Sbjct  140  PDDRKEHATVRDGVELIYRYGIQAYPFS  167



>emb|CDX68729.1| BnaC01g07240D [Brassica napus]
Length=389

 Score =   114 bits (284),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            +FEVI +S+DRD   F+   + MPWLAIPY D  +  L R+F ++ IP LV IG   +T+
Sbjct  239  SFEVILVSTDRDSREFNINMTNMPWLAIPYEDRTRQDLCRIFNIKLIPALVIIGPEEKTV  298

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
             T AR +V  +G+ +YPFTE R+ ELEA  ++    +P K+    H+    L   +  Y 
Sbjct  299  CTNAREMVSLYGSRSYPFTESRIVELEACLKKEGDSFPRKVKDKKHDHELKLDMAKG-YV  357

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C + G+ W+F CD CD+DLHP C 
Sbjct  358  CDFCKKQGKFWAFSCDACDYDLHPTCV  384


 Score = 59.3 bits (142),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/84 (32%), Positives = 47/84 (56%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            + + +  E+IF+S D D + F E F  MPWLA+P+    +  L+  ++V  IP LV +  
Sbjct  73   QKRGEEIEIIFVSFDHDMTLFYEHFWSMPWLAVPFSLSLRNKLTDKYRVARIPSLVPLYP  132

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
               ++  +   L+  +G +A+PFT
Sbjct  133  DEISVADDVIGLIEDYGPEAFPFT  156



>ref|XP_010061105.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Eucalyptus grandis]
Length=426

 Score =   113 bits (283),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 92/149 (62%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++++SSDRD++SFD +F+ +PWLA+P+GD +  +L+R F V+ IP LV +G  G+T+T
Sbjct  267  FEIVYVSSDRDRASFDSYFALIPWLALPFGDPKIRTLARHFDVQDIPCLVVLGPDGKTVT  326

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
               R+L+  +   AYPFTE RL+ L  + +E AKG P       H          T    
Sbjct  327  KHGRSLINLYQEQAYPFTEARLESLHRQMDEEAKGLPRSELHAGHHHELTLVSDSTGGGP  386

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C DC +++HPKC 
Sbjct  387  FICCDCDEQGAGWAYLCVDCGYEVHPKCV  415


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K     FEV+F+S+D D S+F+ + S MPWLAIP+ D + K +LSR F V GIP LV + 
Sbjct  89   KTNQSKFEVVFVSADEDLSAFNSYHSSMPWLAIPFSDLESKKALSRRFDVEGIPCLVILQ  148

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
              G       RN   L+  +G +A+PFT
Sbjct  149  PDGNKEEEILRNGVELIHRYGVEAFPFT  176



>ref|XP_010112126.1| putative nucleoredoxin 3 [Morus notabilis]
 gb|EXC32751.1| putative nucleoredoxin 3 [Morus notabilis]
Length=645

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 89/147 (61%), Gaps = 1/147 (1%)
 Frame = -3

Query  693  AFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            + E+I +S+DRD   F+   SKMPW AIPY D  +  L R+F V+ IP LV IG  G+++
Sbjct  496  SLEIILVSTDRDVKEFELNISKMPWHAIPYEDKTRQDLCRIFDVKEIPALVLIGADGKSV  555

Query  513  TTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQHYT  334
            TT  + +V  +GA A+PFTE R++ELEA   +  +  P ++    HE    L   +  Y 
Sbjct  556  TTNGKAMVSLYGAKAFPFTESRIRELEAALIKEGEALPAQVKDVKHEHVLKLDMAKA-YV  614

Query  333  CDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            CD C E G+ W+F CD CD+DLHP C 
Sbjct  615  CDCCKEQGRFWAFSCDVCDYDLHPTCV  641


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 48/84 (57%), Gaps = 0/84 (0%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K +  E+IF+S D D   F E F +MPWLA+P+  +    LS  + V  IP L+ +  
Sbjct  329  KLKGEELEIIFVSFDHDDYKFKEHFKRMPWLAVPFDANLHRQLSNTYCVDRIPTLIPLSS  388

Query  528  TGRTLTTEARNLVMSHGADAYPFT  457
             G ++  +   L+  +GA+AYPFT
Sbjct  389  DGISIEEDLIGLIEEYGAEAYPFT  412



>gb|KCW68002.1| hypothetical protein EUGRSUZ_F01693 [Eucalyptus grandis]
Length=489

 Score =   113 bits (283),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 92/149 (62%), Gaps = 3/149 (2%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGRTLT  511
            FE++++SSDRD++SFD +F+ +PWLA+P+GD +  +L+R F V+ IP LV +G  G+T+T
Sbjct  330  FEIVYVSSDRDRASFDSYFALIPWLALPFGDPKIRTLARHFDVQDIPCLVVLGPDGKTVT  389

Query  510  TEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehellLTRRQH  340
               R+L+  +   AYPFTE RL+ L  + +E AKG P       H          T    
Sbjct  390  KHGRSLINLYQEQAYPFTEARLESLHRQMDEEAKGLPRSELHAGHHHELTLVSDSTGGGP  449

Query  339  YTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
            + C  C+E G GW++ C DC +++HPKC 
Sbjct  450  FICCDCDEQGAGWAYLCVDCGYEVHPKCV  478


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 53/88 (60%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K     FEV+F+S+D D S+F+ + S MPWLAIP+ D + K +LSR F V GIP LV + 
Sbjct  152  KTNQSKFEVVFVSADEDLSAFNSYHSSMPWLAIPFSDLESKKALSRRFDVEGIPCLVILQ  211

Query  531  RTGRTLTTEARN---LVMSHGADAYPFT  457
              G       RN   L+  +G +A+PFT
Sbjct  212  PDGNKEEEILRNGVELIHRYGVEAFPFT  239



>ref|XP_004238384.1| PREDICTED: probable nucleoredoxin 2 [Solanum lycopersicum]
Length=440

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 96/152 (63%), Gaps = 3/152 (2%)
 Frame = -3

Query  699  DDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGRTGR  520
            D+ FE++F+SSD +Q  F  +F  MPWLAIP+ D    +L++ F +RGIP LV +G  G+
Sbjct  280  DEDFEIVFVSSDHNQVDFTTYFETMPWLAIPFDDPTIKALAKYFDIRGIPSLVILGPDGK  339

Query  519  TLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTRRQ-  343
            T+T + R+L+  +  +AYPFT+ R+  LE + +E+AKG P+  NH+ H     L+     
Sbjct  340  TVTKQGRSLINLYKENAYPFTKTRIDILEKQMDEIAKGLPKTENHSGHRHELTLVPEGHG  399

Query  342  --HYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
               + C  C+E G GW++ C +C +++HPKC 
Sbjct  400  GGAFICCDCDEQGYGWAYQCLECGYEVHPKCV  431


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 51/83 (61%), Gaps = 5/83 (6%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+SSD D ++F+ + S MPWLAIP+ D + + +L++ F V GIP L+ +      L
Sbjct  112  FEIVFVSSDEDLNAFNTYRSSMPWLAIPFSDLETRRALTQKFDVEGIPCLIVLLPNDDKL  171

Query  513  TT----EARNLVMSHGADAYPFT  457
             T    +   LV  +G  A+PFT
Sbjct  172  DTAVIKDGVELVYRYGVQAFPFT  194



>ref|XP_011034968.1| PREDICTED: probable nucleoredoxin 2 [Populus euphratica]
Length=458

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 59/155 (38%), Positives = 93/155 (60%), Gaps = 3/155 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K  +D FE++F+SSDRDQ++FD +F+ MPWL +P+GD     L++ F V+GIP LV +G 
Sbjct  293  KGNEDDFEIVFVSSDRDQAAFDSYFNSMPWLTLPFGDPASKILAKHFDVKGIPCLVILGP  352

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEK---MNhalheehell  358
             G+T+T   R+L+  +  +AYPFTE ++  L+ + +E AK  P+      H         
Sbjct  353  DGKTVTKHGRSLINLYKENAYPFTEVQVDLLQKQIDEEAKSLPKSKYHAGHRHELGLVSE  412

Query  357  LTRRQHYTCDGCNEGGQGWSFYCDDCDFDLHPKCA  253
             T    + C  C+E G GW++ C +C +++H KC 
Sbjct  413  GTGGGPFICCDCDEQGSGWAYLCLECGYEVHTKCV  447


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 49/88 (56%), Gaps = 4/88 (5%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIG  532
            K+K   FE++FISSD D  +F+ + + MPWL+IP+ D + K +L+  F+V  IP LV + 
Sbjct  122  KSKGSNFEIVFISSDEDLDAFNNYRANMPWLSIPFSDLETKRALNSKFEVEAIPFLVILQ  181

Query  531  ---RTGRTLTTEARNLVMSHGADAYPFT  457
                       +   L+   G  A+PFT
Sbjct  182  PEDNKYEATIHDGVELLSRFGVQAFPFT  209



>ref|XP_010923905.1| PREDICTED: probable nucleoredoxin 2 [Elaeis guineensis]
Length=390

 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 61/154 (40%), Positives = 97/154 (63%), Gaps = 3/154 (2%)
 Frame = -3

Query  708  KAKDDAFEVIFISSDRDQSSFDEFFSKMPWLAIPYGDDRKGSLSRLFKVRGIPMLVAIGR  529
            K K++ FE++F+S DRD++ + + +S+MPWLA+PY  +   +L+R F V+GIP L+ IG 
Sbjct  226  KEKNEEFEIVFVSMDRDEAGYLQCYSEMPWLALPYDSESSKALARYFDVQGIPALIIIGP  285

Query  528  TGRTLTTEARNLVMSHGADAYPFTeerlkeleaeyeemaKGWPEKMNhalheehellLTR  349
             G+T+T E RNL+  H   A+PFTE +++ L+   +E AK +P  ++HA H     L++ 
Sbjct  286  DGKTVTREGRNLINLHLEMAFPFTEAQIRLLQERMDEEAKCYPSTLHHAAHRHILNLVSE  345

Query  348  RQ---HYTCDGCNEGGQGWSFYCDDCDFDLHPKC  256
                  Y C  C E G GW++ C  C +++H KC
Sbjct  346  NTGGGPYLCCECGEQGLGWAYQCLGCGYEIHLKC  379


 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = -3

Query  690  FEVIFISSDRDQSSFDEFFSKMPWLAIPYGD-DRKGSLSRLFKVRGIPMLVAIGRTGRTL  514
            FE++F+SSD D +SF+ F S MPW AIP+ D   + SL++ F++ GIP L+ I   G  +
Sbjct  72   FEIVFVSSDEDHASFERFHSLMPWPAIPFSDLQSRRSLTQRFQIEGIPSLIIINSKGELI  131

Query  513  TTEARNLVMSHGADAYPFT  457
             T+   L+  +   A+PFT
Sbjct  132  RTDGVELINRYECRAFPFT  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1219970116365