BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= rJMFF036O09

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009791518.1|  PREDICTED: endoplasmin homolog                     202   2e-61   Nicotiana sylvestris
dbj|BAL42332.1|  Heat shock protein 90                                  202   2e-61   Nicotiana tabacum [American tobacco]
gb|KHG15193.1|  Endoplasmin                                             207   3e-61   Gossypium arboreum [tree cotton]
ref|XP_007017828.1|  Chaperone protein htpG family protein isoform 1    208   1e-60   
ref|XP_007017829.1|  Chaperone protein htpG family protein isoform 2    208   1e-60   
ref|XP_007017830.1|  Chaperone protein htpG family protein isoform 3    209   1e-60   
dbj|BAL42333.1|  Heat shock protein 90                                  200   2e-60   Nicotiana tabacum [American tobacco]
gb|KJB63502.1|  hypothetical protein B456_010G0030001                   204   2e-60   Gossypium raimondii
ref|XP_009606988.1|  PREDICTED: endoplasmin homolog                     200   2e-60   Nicotiana tomentosiformis
ref|XP_010109992.1|  Endoplasmin-like protein                           203   2e-60   
gb|KJB63501.1|  hypothetical protein B456_010G0030001                   203   2e-60   Gossypium raimondii
gb|KJB63505.1|  hypothetical protein B456_010G0030001                   203   4e-60   Gossypium raimondii
gb|KJB63503.1|  hypothetical protein B456_010G0030001                   203   5e-60   Gossypium raimondii
ref|XP_002510550.1|  endoplasmin, putative                              204   5e-60   Ricinus communis
ref|XP_009791520.1|  PREDICTED: endoplasmin homolog                     198   6e-60   Nicotiana sylvestris
ref|XP_006473673.1|  PREDICTED: endoplasmin homolog                     202   4e-59   Citrus sinensis [apfelsine]
gb|KDO84884.1|  hypothetical protein CISIN_1g003458mg                   201   4e-59   Citrus sinensis [apfelsine]
ref|XP_006435195.1|  hypothetical protein CICLE_v10000296mg             201   4e-59   Citrus clementina [clementine]
gb|KDO84885.1|  hypothetical protein CISIN_1g003458mg                   201   5e-59   Citrus sinensis [apfelsine]
gb|KDP36908.1|  hypothetical protein JCGZ_08199                         200   1e-58   Jatropha curcas
ref|XP_010246858.1|  PREDICTED: endoplasmin homolog                     197   2e-58   Nelumbo nucifera [Indian lotus]
gb|AAF64453.1|AF239931_1  putative heat-shock protein 90                199   3e-58   Euphorbia esula [wolf's milk]
ref|XP_010069812.1|  PREDICTED: endoplasmin homolog                     198   3e-58   Eucalyptus grandis [rose gum]
emb|CAN79404.1|  hypothetical protein VITISV_028074                     193   3e-58   Vitis vinifera
ref|NP_974606.1|  HSP90-like protein GRP94                              196   4e-58   Arabidopsis thaliana [mouse-ear cress]
ref|NP_194150.1|  HSP90-like protein GRP94                              196   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010433803.1|  PREDICTED: endoplasmin homolog                     195   5e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002273785.1|  PREDICTED: endoplasmin homolog                     194   5e-58   Vitis vinifera
dbj|BAB86368.1|  SHEPHERD                                               195   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007225662.1|  hypothetical protein PRUPE_ppa001487mg             207   6e-58   Prunus persica
ref|XP_010539097.1|  PREDICTED: endoplasmin homolog                     197   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_008221245.1|  PREDICTED: endoplasmin homolog                     207   7e-58   Prunus mume [ume]
gb|AAB63606.1|  HSP90 isolog                                            195   7e-58   Arabidopsis thaliana [mouse-ear cress]
gb|EYU38796.1|  hypothetical protein MIMGU_mgv1a001101mg                192   8e-58   Erythranthe guttata [common monkey flower]
ref|XP_010439073.1|  PREDICTED: endoplasmin homolog                     194   9e-58   Camelina sativa [gold-of-pleasure]
ref|XP_006283118.1|  hypothetical protein CARUB_v10004140mg             195   1e-57   Capsella rubella
ref|XP_010448597.1|  PREDICTED: endoplasmin homolog                     194   1e-57   Camelina sativa [gold-of-pleasure]
gb|KJB14397.1|  hypothetical protein B456_002G122800                    201   1e-57   Gossypium raimondii
gb|EYU36792.1|  hypothetical protein MIMGU_mgv1a001447mg                194   1e-57   Erythranthe guttata [common monkey flower]
emb|CDX92620.1|  BnaC07g38780D                                          195   3e-57   
ref|XP_009137776.1|  PREDICTED: endoplasmin homolog                     195   3e-57   Brassica rapa
emb|CDY03477.1|  BnaC01g16050D                                          195   3e-57   
emb|CDY34264.1|  BnaA01g13670D                                          195   3e-57   Brassica napus [oilseed rape]
gb|KHG17445.1|  Endoplasmin                                             198   3e-57   Gossypium arboreum [tree cotton]
ref|XP_003589505.1|  Endoplasmin-like protein                           196   4e-57   Medicago truncatula
emb|CDY10992.1|  BnaA03g46510D                                          193   6e-57   Brassica napus [oilseed rape]
ref|XP_006596543.1|  PREDICTED: endoplasmin homolog isoform X2          196   8e-57   Glycine max [soybeans]
ref|XP_003545030.1|  PREDICTED: endoplasmin homolog isoform X1          196   9e-57   Glycine max [soybeans]
ref|XP_002867677.1|  hypothetical protein ARALYDRAFT_492441             191   1e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_006601356.1|  PREDICTED: endoplasmin homolog isoform X2          195   1e-56   Glycine max [soybeans]
ref|XP_003550428.1|  PREDICTED: endoplasmin homolog isoform X1          195   1e-56   
ref|XP_008387928.1|  PREDICTED: LOW QUALITY PROTEIN: endoplasmin ...    204   1e-56   
ref|XP_009334927.1|  PREDICTED: endoplasmin homolog                     204   1e-56   Pyrus x bretschneideri [bai li]
ref|XP_006342064.1|  PREDICTED: endoplasmin homolog                     191   1e-56   Solanum tuberosum [potatoes]
ref|XP_007160650.1|  hypothetical protein PHAVU_001G005200g             196   1e-56   Phaseolus vulgaris [French bean]
ref|XP_010266798.1|  PREDICTED: endoplasmin homolog                     195   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_006413464.1|  hypothetical protein EUTSA_v10024414mg             191   2e-56   Eutrema salsugineum [saltwater cress]
ref|XP_008377135.1|  PREDICTED: endoplasmin homolog                     202   3e-56   
ref|XP_010691883.1|  PREDICTED: endoplasmin homolog                     188   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004499281.1|  PREDICTED: endoplasmin homolog isoform X1          196   4e-56   Cicer arietinum [garbanzo]
ref|XP_004499283.1|  PREDICTED: endoplasmin homolog isoform X3          196   4e-56   Cicer arietinum [garbanzo]
ref|XP_004291352.1|  PREDICTED: endoplasmin homolog                     202   5e-56   Fragaria vesca subsp. vesca
ref|XP_004152644.1|  PREDICTED: endoplasmin homolog                     194   7e-56   Cucumis sativus [cucumbers]
ref|XP_011074690.1|  PREDICTED: endoplasmin homolog                     193   1e-55   Sesamum indicum [beniseed]
ref|XP_008444821.1|  PREDICTED: endoplasmin homolog                     193   1e-55   Cucumis melo [Oriental melon]
gb|EPS69355.1|  hypothetical protein M569_05408                         186   3e-55   Genlisea aurea
gb|KFK29085.1|  hypothetical protein AALP_AA7G086900                    187   4e-55   Arabis alpina [alpine rockcress]
emb|CDY24830.1|  BnaA08g14800D                                          188   9e-55   Brassica napus [oilseed rape]
ref|XP_008808636.1|  PREDICTED: endoplasmin homolog                     193   1e-54   Phoenix dactylifera
ref|XP_011045067.1|  PREDICTED: endoplasmin homolog                     181   2e-54   Populus euphratica
emb|CDP07384.1|  unnamed protein product                                197   2e-54   Coffea canephora [robusta coffee]
ref|XP_002307732.1|  hypothetical protein POPTR_0005s26260g             181   2e-54   Populus trichocarpa [western balsam poplar]
gb|AIZ68158.1|  heat shock protein 90                                   191   3e-54   Ornithogalum longebracteatum [sea-onion]
gb|ABK92622.1|  unknown                                                 180   3e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006851911.1|  hypothetical protein AMTR_s00041p00161550          190   4e-54   Amborella trichopoda
ref|XP_010935079.1|  PREDICTED: endoplasmin homolog                     190   6e-54   Elaeis guineensis
gb|AAN34791.1|  Grp94                                                   189   8e-54   Xerophyta viscosa
ref|XP_006657350.1|  PREDICTED: endoplasmin homolog                     188   1e-53   Oryza brachyantha
gb|AAL79732.1|AC091774_23  heat shock protein 90                        189   3e-53   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058590.1|  Os06g0716700                                       189   3e-53   
gb|EAZ38293.1|  hypothetical protein OsJ_22671                          189   3e-53   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ02369.1|  hypothetical protein OsI_24473                          189   3e-53   Oryza sativa Indica Group [Indian rice]
ref|XP_008788614.1|  PREDICTED: endoplasmin homolog                     189   4e-53   Phoenix dactylifera
ref|XP_010941296.1|  PREDICTED: endoplasmin homolog                     187   4e-53   Elaeis guineensis
emb|CDY08910.1|  BnaC08g11400D                                          184   5e-53   Brassica napus [oilseed rape]
sp|P35016.1|ENPL_CATRO  RecName: Full=Endoplasmin homolog; AltNam...    192   1e-52   Catharanthus roseus [chatas]
dbj|BAA90487.1|  heat shock protein 90                                  186   2e-52   Oryza sativa [red rice]
ref|XP_004238368.1|  PREDICTED: endoplasmin homolog                     191   3e-52   Solanum lycopersicum
ref|XP_004966467.1|  PREDICTED: endoplasmin homolog                     183   3e-52   Setaria italica
ref|XP_009409971.1|  PREDICTED: endoplasmin homolog                     182   1e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001151475.1|  endoplasmin precursor                              180   2e-51   Zea mays [maize]
gb|AFW75767.1|  endoplasmin                                             180   3e-51   
gb|AFW75769.1|  hypothetical protein ZEAMMB73_790349                    180   5e-51   
ref|XP_003563275.1|  PREDICTED: endoplasmin homolog                     183   5e-51   Brachypodium distachyon [annual false brome]
gb|AFW75768.1|  hypothetical protein ZEAMMB73_790349                    180   5e-51   
ref|XP_009393849.1|  PREDICTED: endoplasmin homolog                     182   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABV82432.1|  Hsp90-like protein                                      184   9e-51   Dactylis glomerata [cocksfoot]
ref|XP_011083591.1|  PREDICTED: endoplasmin homolog                     171   1e-50   
sp|P36183.1|ENPL_HORVU  RecName: Full=Endoplasmin homolog; AltNam...    184   1e-50   Hordeum vulgare [barley]
gb|EMS56078.1|  Endoplasmin-like protein                                183   1e-50   Triticum urartu
ref|XP_002439030.1|  hypothetical protein SORBIDRAFT_10g030240          181   1e-50   
gb|AFW69515.1|  hypothetical protein ZEAMMB73_665489                    181   1e-50   
gb|EMT19498.1|  Endoplasmin-like protein                                182   2e-50   
ref|XP_008643502.1|  PREDICTED: shepherd-like1 isoform X1               181   2e-50   
ref|NP_001146348.1|  shepherd-like1                                     181   2e-50   
dbj|BAJ89816.1|  predicted protein                                      183   4e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK24228.1|  unknown                                                 179   1e-49   Picea sitchensis
gb|ABV21762.1|  GRP94                                                   175   2e-49   Pinus taeda
ref|XP_002969701.1|  hypothetical protein SELMODRAFT_451343             165   3e-45   Selaginella moellendorffii
ref|XP_002981308.1|  hypothetical protein SELMODRAFT_444847             165   3e-45   Selaginella moellendorffii
ref|XP_001770511.1|  predicted protein                                  165   7e-45   
gb|AFK40768.1|  unknown                                                 148   1e-41   Lotus japonicus
gb|ACN26939.1|  unknown                                                 147   1e-40   Zea mays [maize]
gb|KDO84886.1|  hypothetical protein CISIN_1g003458mg                   131   4e-38   Citrus sinensis [apfelsine]
ref|XP_003063917.1|  predicted protein                                  146   4e-36   Micromonas pusilla CCMP1545
gb|KJB14398.1|  hypothetical protein B456_002G122800                    125   4e-35   Gossypium raimondii
ref|XP_002508627.1|  predicted protein                                  141   3e-34   Micromonas commoda
ref|XP_001421809.1|  Heat Shock Protein 90, endoplasmic reticulum       141   3e-34   Ostreococcus lucimarinus CCE9901
emb|CEG00480.1|  Histidine kinase-like ATPase, ATP-binding domain       132   3e-31   Ostreococcus tauri
ref|XP_003083767.1|  heat shock protein 90 (ISS)                        132   3e-31   
ref|XP_006220022.1|  PREDICTED: heat shock protein 90-like              122   2e-30   Vicugna pacos
emb|CAG01829.1|  unnamed protein product                                123   3e-30   Tetraodon nigroviridis
ref|XP_005842771.1|  hypothetical protein CHLNCDRAFT_59468              124   3e-30   Chlorella variabilis
ref|XP_005911315.1|  PREDICTED: heat shock protein HSP 90-alpha-like    121   3e-30   
gb|KHJ75602.1|  Hsp90 protein                                           122   4e-30   Oesophagostomum dentatum [nodule worm]
ref|XP_007512535.1|  predicted protein                                  129   9e-30   Bathycoccus prasinos
ref|XP_001740319.1|  heat shock protein                                 121   9e-30   Entamoeba dispar SAW760
dbj|BAA13431.1|  heat shock protein 90                                  120   1e-29   Homo sapiens [man]
emb|CAU15484.1|  heat shock protein 90                                  127   2e-29   Meloidogyne artiellia
gb|ADD10372.1|  heat shock protein 90                                   126   2e-29   Meloidogyne incognita
ref|XP_005651682.1|  heat shock protein Hsp90                           126   3e-29   Coccomyxa subellipsoidea C-169
gb|AEF33377.1|  heat shock protein 90                                   119   3e-29   Crassostrea ariakensis
ref|XP_001753222.1|  predicted protein                                  118   3e-29   
gb|KHN76289.1|  Heat shock protein HSP 90-alpha                         125   4e-29   Toxocara canis
emb|CDP96098.1|  Protein BM-DAF-21, isoform a                           126   4e-29   
ref|XP_003135662.1|  heat shock protein 90                              125   4e-29   
gb|ACO55133.1|  heat shock protein 90                                   126   4e-29   Litomosoides sigmodontis
emb|CAA06694.1|  heat shock protein 90                                  126   4e-29   Brugia pahangi
sp|O61998.2|HSP90_BRUPA  RecName: Full=Heat shock protein 90            126   4e-29   Brugia pahangi
gb|EJW88125.1|  heat shock protein 90                                   126   4e-29   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_005538149.1|  heat shock protein of Hsp90 family                 125   4e-29   Cyanidioschyzon merolae strain 10D
ref|XP_010928209.1|  PREDICTED: heat shock protein 90-2-like            117   5e-29   
ref|XP_001901767.1|  heat shock protein 90                              125   5e-29   Brugia malayi [agent of lymphatic filariasis]
gb|ACO55135.1|  heat shock protein 90                                   125   5e-29   Toxocara cati [feline roundworm]
dbj|BAF75058.1|  heat shock protein                                     118   5e-29   Prymnesium parvum
ref|XP_008256039.1|  PREDICTED: heat shock protein HSP 90-alpha-like    117   7e-29   Oryctolagus cuniculus [domestic rabbit]
ref|XP_308797.3|  AGAP006961-PA                                         122   9e-29   Anopheles gambiae str. PEST
gb|ACO55134.1|  heat shock protein 90                                   125   9e-29   Ascaris suum
gb|ERG82208.1|  heat shock protein hsp 90-alpha                         125   1e-28   
ref|XP_006678605.1|  hypothetical protein BATDEDRAFT_36900              124   1e-28   Batrachochytrium dendrobatidis JAM81
ref|XP_011398501.1|  Heat shock protein 90-2                            122   1e-28   Auxenochlorella protothecoides
gb|AAG22091.1|AF306643_1  90 kDa heat-shock protein                     117   1e-28   Scyliorhinus torazame
gb|AAO14563.2|AF461150_1  Hsp90                                         125   1e-28   Heterodera glycines
gb|EKF32566.1|  heat shock protein 85, putative                         121   1e-28   Trypanosoma cruzi marinkellei
emb|CAA34748.1|  heat shock-like protein                                120   1e-28   Mus musculus [mouse]
gb|AIU38245.1|  heat shock protein 90                                   124   1e-28   Anisakis physeteris
gb|ABF61871.1|  chaperone                                               117   1e-28   Agave tequilana
gb|AIU38246.1|  heat shock protein 90                                   124   1e-28   Anisakis brevispiculata
gb|ADM83426.1|  heat shock protein 90                                   124   1e-28   Panonychus citri [citrus fruit mite]
gb|AIU38242.1|  heat shock protein 90                                   124   1e-28   Anisakis pegreffii
gb|AIU38243.1|  heat shock protein 90                                   124   1e-28   Anisakis typica
gb|AIU38244.1|  heat shock protein 90                                   124   1e-28   Anisakis paggiae
ref|XP_308799.3|  AGAP006959-PA                                         122   1e-28   Anopheles gambiae str. PEST
emb|CBY17856.1|  unnamed protein product                                118   1e-28   Oikopleura dioica
dbj|BAN64175.1|  hsp90 protein                                          118   2e-28   Babesia bovis
gb|EWM29604.1|  heat shock protein 90                                   124   2e-28   Nannochloropsis gaditana
ref|XP_005855339.1|  molecular chaperone HtpG                           124   2e-28   Nannochloropsis gaditana CCMP526
gb|AEG78394.1|  heat shock protein 90                                   116   2e-28   Epinephelus coioides [estuary cod]
ref|XP_002637777.1|  C. briggsae CBR-DAF-21 protein                     124   2e-28   Caenorhabditis briggsae
gb|ADZ13510.1|  HSP90-1                                                 124   2e-28   Ditylenchus destructor
gb|EGT39214.1|  CBN-DAF-21 protein                                      124   2e-28   Caenorhabditis brenneri
ref|XP_003102316.1|  CRE-DAF-21 protein                                 124   2e-28   Caenorhabditis remanei
gb|EKG06682.1|  heat shock protein 85, putative                         120   2e-28   Trypanosoma cruzi
gb|ACO58580.1|  heat shock protein 90                                   121   2e-28   Apis mellifera [bee]
gb|AGW82181.1|  heat shcok protein 90                                   117   2e-28   Corbicula fluminea [asian clam]
ref|XP_007515443.1|  predicted protein                                  124   2e-28   Bathycoccus prasinos
ref|XP_010928210.1|  PREDICTED: heat shock protein 90-2-like            115   3e-28   
ref|XP_952473.1|  heat shock protein 90                                 123   3e-28   Theileria annulata
gb|EPY40503.1|  heat shock protein 83-1                                 119   3e-28   Angomonas deanei
gb|AAA30132.1|  heat shock protein 90                                   123   4e-28   Theileria parva
gb|AAQ63041.1|  heat shock protein HSP 90 alpha                         117   4e-28   Platichthys flesus
ref|XP_009690258.1|  heat shock protein 90                              123   4e-28   Theileria orientalis strain Shintoku
ref|XP_764810.1|  heat shock protein 90                                 123   4e-28   Theileria parva strain Muguga
gb|AAB23704.1|  HSP90                                                   117   4e-28   Mus sp. [mice]
gb|ACR57215.1|  Hsp90                                                   123   4e-28   Heterodera glycines
gb|ESL09761.1|  heat shock protein 85                                   120   4e-28   Trypanosoma rangeli SC58
gb|ADC53691.1|  heat shock protein 90-2                                 117   5e-28   Cryptocoryne ciliata
gb|AAN76524.1|AF384807_1  heat-shock protein 90                         122   5e-28   Cryptococcus gattii VGI
ref|XP_003197339.1|  cytoplasmic chaperone (Hsp90 family); Hsp82p       122   5e-28   Cryptococcus gattii WM276
gb|AAN77149.1|  fiber protein Fb9                                       116   5e-28   Gossypium barbadense [Egyptian cotton]
gb|KIR45891.1|  hsp90-like protein                                      122   5e-28   Cryptococcus gattii CA1280
gb|KIR84754.1|  hsp90-like protein                                      122   5e-28   Cryptococcus gattii VGIV IND107
gb|EYD92886.1|  hsp90 family protein                                    119   5e-28   Escherichia coli 1-176-05_S1_C1
gb|AAK59281.1|AF378703_1  heat shock protein 90 alpha                   120   5e-28   Anas platyrhynchos [duck]
gb|KGB79019.1|  hsp90-like protein                                      122   5e-28   Cryptococcus gattii VGII R265
gb|ACZ13352.1|  HSP90 protein                                           120   6e-28   Bursaphelenchus xylophilus [pine wilt nematode]
gb|KJE05047.1|  hsp90-like protein                                      122   6e-28   Cryptococcus gattii NT-10
ref|XP_002998541.1|  heat shock protein 90                              122   6e-28   Phytophthora infestans T30-4
ref|XP_009534751.1|  hypothetical protein PHYSODRAFT_355817             122   6e-28   Phytophthora sojae
gb|ETK95017.1|  heat shock protein 90-2                                 122   6e-28   Phytophthora parasitica
ref|XP_008915791.1|  heat shock protein 90-2                            122   6e-28   Phytophthora parasitica INRA-310
gb|ACU00686.1|  heat shock protein 90                                   119   6e-28   Bursaphelenchus mucronatus
gb|AFR98377.1|  hsp90-like protein                                      122   7e-28   Cryptococcus neoformans var. grubii H99
gb|AAN76525.1|AF384808_1  heat-shock protein 90                         122   7e-28   Cryptococcus neoformans var. grubii
gb|ETN83529.1|  putative heat shock protein 90                          122   7e-28   Necator americanus
ref|XP_010902983.1|  PREDICTED: heat shock protein HSP 90-alpha 1       122   8e-28   
gb|KIH68348.1|  Hsp90 protein                                           122   8e-28   Ancylostoma duodenale
gb|ADZ97023.1|  heat shock protein 90                                   114   8e-28   Rana sauteri [Kanshirei village frog]
gb|EYC13285.1|  hypothetical protein Y032_0044g1081                     122   8e-28   Ancylostoma ceylanicum
ref|XP_008917763.1|  PREDICTED: heat shock protein HSP 90-alpha         120   8e-28   
gb|ACR57216.1|  Hsp90                                                   122   8e-28   Heterodera glycines
gb|AEG19531.1|  heat shock protein 90                                   120   9e-28   Glaciozyma antarctica
gb|ABO93609.1|  heat shock protein 90                                   119   9e-28   Bursaphelenchus xylophilus [pine wilt nematode]
gb|ACU00668.1|  heat shock protein 90                                   122   9e-28   Haemonchus contortus [red stomach worm]
gb|EXX78198.1|  Hsp90 family chaperone HSC82                            119   9e-28   Rhizophagus irregularis DAOM 197198w
emb|CAC29071.1|  heat shock protein 90                                  117   9e-28   Pelophylax esculentus
gb|ADC53692.1|  heat shock protein 90-1                                 117   1e-27   Cryptocoryne ciliata
dbj|BAH71458.1|  ACYPI002010                                            117   1e-27   Acyrthosiphon pisum
gb|AFZ62631.1|  HSP90-1                                                 122   1e-27   Ditylenchus destructor
ref|NP_506626.1|  Protein DAF-21                                        122   1e-27   Caenorhabditis elegans [roundworm]
ref|XP_002613491.1|  hypothetical protein BRAFLDRAFT_119839             122   1e-27   Branchiostoma floridae
gb|AEV91217.1|  cytosolic heat shock protein 90                         121   1e-27   Microheliella maris
gb|EKG00457.1|  heat shock protein 85, putative                         119   1e-27   Trypanosoma cruzi
emb|CDS02719.1|  Putative Heat shock protein 90-1                       122   1e-27   Lichtheimia ramosa
gb|AAH07989.2|  HSP90AA1 protein                                        119   1e-27   Homo sapiens [man]
ref|XP_008855466.1|  heat shock protein 90, putative                    122   1e-27   Entamoeba nuttalli P19
gb|AGT57167.1|  heat shock protein 90-alpha 3                           122   1e-27   Salmo salar
emb|CDQ81678.1|  unnamed protein product                                122   1e-27   Oncorhynchus mykiss
ref|XP_653162.1|  heat shock protein 90                                 122   1e-27   Entamoeba histolytica HM-1:IMSS
gb|AAN39696.1|  heat shock protein                                      115   1e-27   Choristoneura parallela
emb|CDH60666.1|  heat shock protein 90                                  121   1e-27   Lichtheimia corymbifera JMRC:FSU:9682
dbj|BAD83620.1|  cytosolic-type hsp90                                   121   1e-27   Entamoeba histolytica
ref|XP_653132.1|  heat shock protein 90                                 121   1e-27   Entamoeba histolytica HM-1:IMSS
ref|XP_004254906.1|  heat shock protein 81-1, putative                  122   1e-27   Entamoeba invadens IP1
gb|AIA62362.1|  hsp90                                                   119   1e-27   Bactrocera minax
emb|CBJ23502.1|  heat shock protein 90                                  116   1e-27   Dicentrarchus labrax [European sea bass]
ref|XP_003971591.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    121   2e-27   Takifugu rubripes [tiger puffer]
ref|XP_001735351.1|  heat shock protein 81-1                            121   2e-27   Entamoeba dispar SAW760
gb|AER28024.1|  heat shock protein 83S1                                 121   2e-27   Stratiomys singularior
ref|XP_568451.1|  chaperone                                             121   2e-27   Cryptococcus neoformans var. neoformans JEC21
ref|XP_001649751.1|  AAEL014845-PA                                      120   2e-27   
dbj|BAN65820.1|  hsp90 protein                                          119   2e-27   Babesia bovis
gb|ADO30471.1|  heat shock protein 90                                   119   2e-27   Bactrocera dorsalis [papaya fruit fly]
pdb|3Q6M|A  Chain A, Crystal Structure Of Human Mc-hsp90 In C2221...    119   2e-27   Homo sapiens [man]
gb|AAD52684.1|AF179480_1  90kDa heat-shock protein                      113   2e-27   Toxoplasma gondii
gb|KFB48797.1|  hypothetical protein ZHAS_00016808                      120   2e-27   Anopheles sinensis
gb|AFK31312.1|  heat shock protein 90                                   121   2e-27   Dunaliella salina
emb|CAK22426.1|  heat shock protein 83                                  118   2e-27   Beta vulgaris [beet]
emb|CAY56585.1|  putative heat shock protein 83                         120   2e-27   Bactrocera oleae [olive fly]
gb|EDL18665.1|  mCG14932, isoform CRA_a                                 119   2e-27   Mus musculus [mouse]
ref|XP_007385736.1|  HSP90-domain-containing protein                    121   2e-27   Punctularia strigosozonata HHB-11173 SS5
gb|KFD54842.1|  hypothetical protein M513_04276                         121   2e-27   Trichuris suis
gb|ACY01918.1|  heat shock protein 90                                   121   2e-27   Bursaphelenchus xylophilus [pine wilt nematode]
gb|AAO46140.1|  heat shock protein 90                                   115   2e-27   Streblomastix strix
gb|AAO46141.1|  heat shock protein 90                                   115   2e-27   Streblomastix strix
ref|XP_814893.1|  heat shock protein 85                                 119   2e-27   Trypanosoma cruzi strain CL Brener
gb|EPY32689.1|  heat shock protein 83-1                                 117   2e-27   Strigomonas culicis
gb|EDL97505.1|  rCG27814, isoform CRA_c                                 119   2e-27   Rattus norvegicus [brown rat]
gb|AIL52741.1|  heat shock protein 90                                   121   2e-27   Phenacoccus solenopsis
ref|XP_007863437.1|  HSP90-domain-containing protein                    120   2e-27   Gloeophyllum trabeum ATCC 11539
gb|EJT49886.1|  chaperone                                               120   2e-27   Trichosporon asahii var. asahii CBS 2479
gb|EPY33491.1|  molecular chaperone HtpG                                118   3e-27   Angomonas deanei
ref|XP_003424204.1|  PREDICTED: heat shock protein 83                   120   3e-27   Nasonia vitripennis
dbj|BAN65595.1|  hsp90 protein                                          118   3e-27   Babesia bovis
gb|AAM93928.1|  heat-shock protein 90                                   115   3e-27   Griffithsia japonica
gb|KFB48798.1|  heat shock protein 82                                   120   3e-27   Anopheles sinensis
ref|XP_007488498.1|  PREDICTED: heat shock protein HSP 90-alpha-like    119   3e-27   
ref|XP_308800.3|  AGAP006958-PA                                         120   3e-27   Anopheles gambiae str. PEST
gb|AER28022.1|  heat shock protein 83P1                                 120   3e-27   Oxycera pardalina
gb|KFM78806.1|  Heat shock protein 83                                   120   3e-27   Stegodyphus mimosarum
ref|NP_001274755.1|  heat shock protein 83-like                         120   3e-27   Ceratitis capitata [medfly]
gb|KDE07091.1|  heat shock protein 90-1                                 120   3e-27   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_003396897.1|  PREDICTED: heat shock protein 83-like              120   3e-27   Bombus terrestris [large earth bumblebee]
ref|XP_006619000.1|  PREDICTED: heat shock protein HSP 90-alpha-like    120   3e-27   Apis dorsata [rock honeybee]
gb|EMD43140.1|  Heat shock family 85 kDa protein                        120   3e-27   Entamoeba histolytica KU27
ref|XP_004645488.1|  PREDICTED: heat shock protein HSP 90-alpha         120   3e-27   Octodon degus
ref|NP_001153536.1|  heat shock protein 90                              120   3e-27   Apis mellifera [bee]
gb|EDL97503.1|  rCG27814, isoform CRA_a                                 119   3e-27   Rattus norvegicus [brown rat]
gb|AAC25497.1|  Hsp89-alpha-delta-N                                     119   3e-27   Homo sapiens [man]
gb|AAB05638.1|  heat shock protein 82                                   120   3e-27   
gb|ACO57617.1|  heat shock protein 90                                   120   3e-27   
ref|XP_005805662.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   3e-27   
ref|XP_006632301.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   3e-27   
gb|AAH00987.1|  HSP90AA1 protein                                        119   3e-27   
ref|XP_010736427.1|  PREDICTED: heat shock protein HSP 90-alpha i...    120   3e-27   
ref|XP_006632300.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   4e-27   
ref|XP_005843734.1|  hypothetical protein CHLNCDRAFT_140066             119   4e-27   
ref|XP_007577310.1|  PREDICTED: heat shock protein HSP 90-alpha 1       120   4e-27   
sp|P06660.1|HSP85_TRYCR  RecName: Full=Heat shock-like 85 kDa pro...    120   4e-27   
gb|AEH27540.1|  cytosolic heat shock protein 90-alpha                   120   4e-27   
ref|XP_006632299.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   4e-27   
gb|ADM88040.1|  heat shock protein 90                                   120   4e-27   
gb|AAB49983.1|  heat shock protein hsp90                                120   4e-27   
ref|XP_005805663.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   4e-27   
gb|AAF31705.1|AF221856_1  heat-shock protein 80                         117   4e-27   
dbj|BAE48212.1|  heat shock protein 90 beta                             117   4e-27   
ref|XP_811791.1|  heat shock protein 85                                 120   4e-27   
ref|XP_804480.1|  heat shock protein 85                                 120   4e-27   
gb|AEI59388.1|  heat shock protein 90                                   120   4e-27   
gb|AGT57168.1|  heat shock protein 90-alpha 4                           120   4e-27   
tpg|DAA40367.1|  TPA: putative heat shock protein 90 family protein     117   4e-27   
gb|EKF32565.1|  heat shock protein 85, putative                         120   4e-27   
emb|CDQ59969.1|  unnamed protein product                                120   4e-27   
gb|ESA08764.1|  hypothetical protein GLOINDRAFT_348967                  120   4e-27   
ref|XP_011182023.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    120   4e-27   
gb|ETN67039.1|  heat shock protein                                      120   4e-27   
dbj|BAF92789.1|  cytosolic heat shock protein 90 alpha                  120   4e-27   
gb|ADZ05533.1|  heat shock protein 90                                   120   4e-27   
gb|KFP61130.1|  Heat shock protein HSP 90-alpha                         119   4e-27   
gb|AIT39270.1|  heat shock protein 90                                   120   4e-27   
gb|ESL05552.1|  molecular chaperone HtpG                                119   4e-27   
dbj|BAE39398.1|  unnamed protein product                                119   4e-27   
ref|XP_011203601.1|  PREDICTED: heat shock protein 83                   120   4e-27   
gb|ESL11989.1|  molecular chaperone HtpG                                119   4e-27   
ref|XP_008297037.1|  PREDICTED: heat shock protein HSP 90-alpha 1       120   4e-27   
emb|CAK95235.1|  84kDa heat shock protein                               120   4e-27   
gb|AGU42458.1|  heat shock protein 90                                   120   4e-27   
ref|XP_004542148.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   4e-27   
gb|ADJ00017.1|  heat shock protein 90                                   117   4e-27   
sp|Q90474.3|H90A1_DANRE  RecName: Full=Heat shock protein HSP 90-...    120   4e-27   
ref|XP_009702297.1|  PREDICTED: heat shock protein HSP 90-alpha         119   4e-27   
ref|XP_010788727.1|  PREDICTED: heat shock protein HSP 90-alpha 1       120   4e-27   
gb|AAH23006.2|  HSP90AA1 protein                                        119   5e-27   
gb|AFM73650.1|  heat shock protein 90                                   116   5e-27   
gb|ABR15463.1|  Hsp90A                                                  120   5e-27   
ref|XP_003440693.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    120   5e-27   
gb|AGE89833.1|  heat shock protein 90                                   120   5e-27   
gb|ABO21406.1|  heat shock protein 90 alpha                             120   5e-27   
gb|AAH75757.1|  Hsp90a.1 protein                                        120   5e-27   
gb|EPQ17302.1|  Heat shock protein HSP 90-beta                          114   5e-27   
gb|AIC63037.1|  HSP90AA1                                                119   5e-27   
ref|XP_011345590.1|  PREDICTED: heat shock protein 83                   120   5e-27   
pdb|3HJC|A  Chain A, Crystal Structure Of The Carboxy-Terminal Do...    117   5e-27   
gb|EDL18667.1|  mCG14932, isoform CRA_c                                 119   5e-27   
gb|ACX94847.1|  heat shock protein 90                                   120   5e-27   
ref|XP_008551765.1|  PREDICTED: heat shock protein 83                   120   5e-27   
gb|ACF75907.1|  heat shock protein 90                                   120   5e-27   
ref|XP_005623992.1|  PREDICTED: heat shock protein HSP 90-alpha         119   5e-27   
gb|EPY87751.1|  heat shock protein HSP 90-alpha                         119   5e-27   
emb|CDW54307.1|  heat shock protein 90                                  120   5e-27   
gb|AGN32883.1|  heat shock protein 85                                   120   6e-27   
gb|AAH49951.1|  Hsp90ab1 protein                                        117   6e-27   
ref|XP_008216018.1|  PREDICTED: heat shock protein 83-like              119   6e-27   
gb|ESS64949.1|  heat shock protein 85                                   120   6e-27   
gb|KGG50896.1|  molecular chaperone HtpG                                120   6e-27   
ref|XP_008627985.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    119   6e-27   
ref|XP_001649752.1|  AAEL014843-PA                                      120   6e-27   
gb|EMS66149.1|  Heat shock protein 83                                   119   6e-27   
ref|XP_002021279.1|  GL24896                                            117   6e-27   
dbj|BAF83423.1|  unnamed protein product                                117   6e-27   
dbj|BAE87688.1|  unnamed protein product                                117   6e-27   
ref|XP_004434323.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   6e-27   
gb|EMP32875.1|  Heat shock protein HSP 90-alpha                         120   6e-27   
gb|EEC84770.1|  hypothetical protein OsI_31800                          115   6e-27   
gb|ERE73866.1|  heat shock protein HSP 90-alpha                         119   6e-27   
ref|XP_002825167.2|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    120   6e-27   
gb|ADK26462.1|  heat shock protein 90                                   119   6e-27   
ref|XP_002968038.1|  hypothetical protein SELMODRAFT_88538              120   6e-27   
ref|NP_001278186.1|  heat shock protein HSP 90-alpha 1-like             120   6e-27   
ref|XP_001655641.1|  AAEL011708-PA                                      120   6e-27   
dbj|BAB15121.1|  unnamed protein product                                117   6e-27   
ref|XP_009953880.1|  PREDICTED: heat shock protein HSP 90-alpha i...    120   6e-27   
ref|XP_009075831.1|  PREDICTED: heat shock protein HSP 90-alpha         120   6e-27   
ref|XP_003745496.1|  PREDICTED: heat shock protein 83-like isoform 1    119   6e-27   
ref|XP_010152348.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   6e-27   
ref|XP_005243018.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   6e-27   
ref|XP_011369249.1|  PREDICTED: heat shock protein HSP 90-alpha         118   6e-27   
gb|EMT27103.1|  Heat shock protein 83                                   119   6e-27   
gb|ADF31778.1|  heat shock protein 90                                   119   6e-27   
ref|XP_008823821.1|  PREDICTED: heat shock protein HSP 90-alpha         120   7e-27   
gb|AAH44888.1|  Hsp90ab1 protein                                        117   7e-27   
ref|NP_001274200.1|  heat shock protein 90kDa alpha (cytosolic), ...    119   7e-27   
ref|XP_009972463.1|  PREDICTED: heat shock protein HSP 90-alpha i...    120   7e-27   
gb|KGL98099.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_008498249.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
gb|KFZ48776.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
gb|KFU89878.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_009953881.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_004665641.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_009326272.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_005047661.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
emb|CAA33259.1|  unnamed protein product                                119   7e-27   
gb|KFQ77344.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
gb|AIU47031.1|  heat shock protein                                      119   7e-27   
dbj|BAB20777.1|  heat shock protein 90 alpha                            119   7e-27   
gb|KFQ56441.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
gb|KFP47363.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_005020783.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_009817830.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|EOB00416.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_004434322.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_010351937.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    119   7e-27   
ref|XP_009279122.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_008152985.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_006766684.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_005243017.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_010020311.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|KFQ82066.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_007062955.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_005285846.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_004796737.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|NP_999138.1|  heat shock protein HSP 90-alpha                       119   7e-27   
ref|XP_005978577.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_008936282.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    119   7e-27   
ref|XP_010213538.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|KFP83054.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_009557440.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_009996302.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|KFQ27573.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_010934628.1|  PREDICTED: heat shock protein 83-like              119   7e-27   
gb|ADF31772.1|  heat shock protein 90                                   119   7e-27   
ref|XP_010393468.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_007121737.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|ADF31775.1|  heat shock protein 90                                   119   7e-27   
ref|XP_002992602.1|  hypothetical protein SELMODRAFT_448838             120   7e-27   
ref|XP_007178906.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_004376774.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
dbj|BAK63243.1|  heat shock protein HSP 90-alpha                        119   7e-27   
ref|XP_001512830.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_003276213.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_009508855.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|ETE58959.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
ref|XP_010292573.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_010173602.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_005506148.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|NP_005339.3|  heat shock protein HSP 90-alpha isoform 2             119   7e-27   
ref|XP_005341051.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_004262456.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|NP_001182596.1|  heat shock protein 90kDa alpha (cytosolic), ...    119   7e-27   
ref|XP_005562292.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_005341052.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
gb|KFP45671.1|  Heat shock protein HSP 90-alpha                         119   7e-27   
gb|ADF31756.1|  heat shock protein 90                                   119   7e-27   
ref|XP_009465435.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|ADC79631.1|  heat shock protein 90                                   119   7e-27   
ref|XP_006018082.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
gb|AER28025.1|  heat shock protein 83S2                                 119   7e-27   
ref|XP_003756589.1|  PREDICTED: heat shock protein HSP 90-alpha-like    119   7e-27   
ref|XP_004698853.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_006100595.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|NP_034610.1|  heat shock protein HSP 90-alpha                       119   7e-27   
ref|XP_009889390.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|XP_002200608.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|ADF31754.1|  heat shock protein 90                                   119   7e-27   
ref|XP_009903372.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
ref|NP_001103255.1|  heat shock protein HSP 90-alpha                    119   7e-27   
dbj|BAI23210.1|  heat shock protein 90kDa alpha (cytosolic), clas...    119   7e-27   
ref|XP_005978578.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   7e-27   
ref|XP_007455688.1|  PREDICTED: heat shock protein HSP 90-alpha         119   7e-27   
gb|AFN89572.1|  HSP90                                                   119   8e-27   
ref|XP_008957357.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    119   8e-27   
ref|XP_007518398.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
dbj|BAE39243.1|  unnamed protein product                                119   8e-27   
gb|KFQ20287.1|  Heat shock protein HSP 90-alpha                         119   8e-27   
ref|XP_008498248.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_010192177.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_004910342.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|NP_001012688.1|  heat shock protein HSP 90-alpha                    119   8e-27   
ref|XP_009580794.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_008577108.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
gb|ACY06264.1|  HSP90alpha                                              119   8e-27   
ref|XP_006175722.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
dbj|BAE27553.1|  unnamed protein product                                119   8e-27   
ref|NP_001157427.1|  heat shock protein HSP 90-alpha                    119   8e-27   
tpg|DAA61993.1|  TPA: putative heat shock protein 90 family protein     117   8e-27   
ref|XP_009099985.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
dbj|BAI23206.1|  heat shock protein 90kDa alpha (cytosolic), clas...    119   8e-27   
ref|XP_006100596.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_006160081.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_008981783.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    119   8e-27   
ref|XP_003463143.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_004083818.1|  PREDICTED: heat shock protein HSP 90-alpha 1...    119   8e-27   
ref|XP_010198259.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_010132756.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_007437399.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_005506149.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|NP_786937.1|  heat shock protein HSP 90-alpha                       119   8e-27   
ref|XP_009673798.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_001367371.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_005149613.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_003224109.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_010545291.1|  PREDICTED: heat shock protein 90-2-like            119   8e-27   
ref|XP_010605523.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_008062271.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|XP_005483287.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_005417949.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
gb|AAW49252.2|  heat shock protein 90                                   119   8e-27   
ref|XP_005410794.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_004910343.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
dbj|BAH83702.1|  heat shock 90 protein                                  114   8e-27   
ref|XP_010126476.1|  PREDICTED: LOW QUALITY PROTEIN: heat shock p...    119   8e-27   
gb|EFX63256.1|  hypothetical protein DAPPUDRAFT_307965                  112   8e-27   
gb|ELU10916.1|  hypothetical protein CAPTEDRAFT_159573                  119   8e-27   
ref|XP_006120052.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
gb|ADN87332.1|  heat shock protein 90                                   119   8e-27   
ref|XP_010849644.1|  PREDICTED: heat shock protein HSP 90-alpha         119   8e-27   
ref|NP_001092042.1|  heat shock protein HSP 90-alpha                    119   8e-27   
ref|XP_005417950.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
ref|XP_005483288.1|  PREDICTED: heat shock protein HSP 90-alpha i...    119   8e-27   
gb|AGH32328.1|  heat shock protein 90                                   119   8e-27   



>ref|XP_009791518.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   202 bits (515),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  733  DESVKQTAQLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  777


 Score = 61.2 bits (147),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALASDNVD+VKISNRLADTP
Sbjct  636  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTP  673



>dbj|BAL42332.1| Heat shock protein 90 [Nicotiana tabacum]
Length=811

 Score =   202 bits (515),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  733  DESVKQTAQLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  777


 Score = 61.2 bits (147),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALASDNVD+VKISNRLADTP
Sbjct  636  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTP  673



>gb|KHG15193.1| Endoplasmin [Gossypium arboreum]
Length=718

 Score =   207 bits (528),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERVVKD E
Sbjct  586  PCVVVTSKYGWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVVKDSE  645

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNISP
Sbjct  646  DEGVKQTAQLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNISP  690


 Score = 55.5 bits (132),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -2

Query  749  QKPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            +K K  +   K+LTKWWK ALASDNVDEVKISNRL +TP
Sbjct  548  EKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTP  586



>ref|XP_007017828.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
 gb|EOY15053.1| Chaperone protein htpG family protein isoform 1 [Theobroma cacao]
Length=840

 Score =   208 bits (530),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  689  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  748

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGF++PDPKDFASRIY+SVKSSLNISP
Sbjct  749  DEGVKQTAQLIYQTALMESGFSLPDPKDFASRIYSSVKSSLNISP  793


 Score = 52.8 bits (125),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGAL S+NVD+VKI+NRL +TP
Sbjct  652  KNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTP  689



>ref|XP_007017829.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
 gb|EOY15054.1| Chaperone protein htpG family protein isoform 2 [Theobroma cacao]
Length=824

 Score =   208 bits (530),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  673  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGF++PDPKDFASRIY+SVKSSLNISP
Sbjct  733  DEGVKQTAQLIYQTALMESGFSLPDPKDFASRIYSSVKSSLNISP  777


 Score = 52.8 bits (125),  Expect(2) = 1e-60, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGAL S+NVD+VKI+NRL +TP
Sbjct  636  KNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTP  673



>ref|XP_007017830.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY15055.1| Chaperone protein htpG family protein isoform 3, partial [Theobroma 
cacao]
Length=712

 Score =   209 bits (533),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  594  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  653

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGF++PDPKDFASRIY+SVKSSLNISP
Sbjct  654  DEGVKQTAQLIYQTALMESGFSLPDPKDFASRIYSSVKSSLNISP  698


 Score = 51.6 bits (122),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGAL S+NVD+VKI+NRL +TP
Sbjct  557  KNKELKESFKELTKWWKGALTSENVDDVKITNRLDNTP  594



>dbj|BAL42333.1| Heat shock protein 90 [Nicotiana tabacum]
Length=812

 Score =   200 bits (508),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPE
Sbjct  674  PCVVVTSKYGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPE  733

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  734  DESVKQTAQLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  778


 Score = 61.2 bits (147),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALASDNVD+VKISNRLADTP
Sbjct  637  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTP  674



>gb|KJB63502.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=781

 Score =   204 bits (518),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD E
Sbjct  649  PCVVVTSKYGWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSE  708

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  709  DEGVKQTAQLIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  753


 Score = 57.0 bits (136),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  758  LRIQKPKN*--RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            L+I K KN   +   K+LTKWWK ALASDNVDEVKISNRL +TP
Sbjct  606  LKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTP  649



>ref|XP_009606988.1| PREDICTED: endoplasmin homolog [Nicotiana tomentosiformis]
Length=812

 Score =   200 bits (508),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV+KDPE
Sbjct  674  PCVVVTSKYGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVIKDPE  733

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  734  DESVKQTAQLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  778


 Score = 60.8 bits (146),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALASDNVD+VKISNRLADTP
Sbjct  637  KAKELKESFKELTKWWKGALASDNVDDVKISNRLADTP  674



>ref|XP_010109992.1| Endoplasmin-like protein [Morus notabilis]
 gb|EXC25010.1| Endoplasmin-like protein [Morus notabilis]
Length=1004

 Score =   203 bits (517),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  669  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  728

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+T+QLIY+TALMESGF + DPKDFA+RIY+SVKSSLNI+P
Sbjct  729  DESVKQTSQLIYQTALMESGFMLTDPKDFANRIYSSVKSSLNINP  773


 Score = 57.4 bits (137),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK ALASDNVD+VK+SNRL DTP
Sbjct  632  KAKELKESFKDLTKWWKSALASDNVDDVKVSNRLDDTP  669



>gb|KJB63501.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=823

 Score =   203 bits (517),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD E
Sbjct  691  PCVVVTSKYGWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSE  750

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  751  DEGVKQTAQLIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  795


 Score = 56.6 bits (135),  Expect(2) = 2e-60, Method: Composition-based stats.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  758  LRIQKPKN*--RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            L+I K KN   +   K+LTKWWK ALASDNVDEVKISNRL +TP
Sbjct  648  LKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTP  691



>gb|KJB63505.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=500

 Score =   203 bits (517),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD E
Sbjct  368  PCVVVTSKYGWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSE  427

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  428  DEGVKQTAQLIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  472


 Score = 55.8 bits (133),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  758  LRIQKPKN*--RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            L+I K KN   +   K+LTKWWK ALASDNVDEVKISNRL +TP
Sbjct  325  LKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTP  368



>gb|KJB63503.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
 gb|KJB63504.1| hypothetical protein B456_010G0030001, partial [Gossypium raimondii]
Length=540

 Score =   203 bits (516),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSD+SKQAYMRGKR+LEINPRHPIIKELRERV KD E
Sbjct  408  PCVVVTSKYGWSANMERIMQSQTLSDSSKQAYMRGKRILEINPRHPIIKELRERVAKDSE  467

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGFN+P+PKDFASRIY+SVKSSLNISP
Sbjct  468  DEGVKQTAQLIYQTALMESGFNLPEPKDFASRIYSSVKSSLNISP  512


 Score = 55.8 bits (133),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 30/44 (68%), Positives = 34/44 (77%), Gaps = 2/44 (5%)
 Frame = -2

Query  758  LRIQKPKN*--RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            L+I K KN   +   K+LTKWWK ALASDNVDEVKISNRL +TP
Sbjct  365  LKIGKEKNKELKESFKELTKWWKNALASDNVDEVKISNRLDNTP  408



>ref|XP_002510550.1| endoplasmin, putative [Ricinus communis]
 gb|EEF52737.1| endoplasmin, putative [Ricinus communis]
Length=816

 Score =   204 bits (520),  Expect(2) = 5e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIM SQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  672  PCVVVTSKYGWSANMERIMSSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  731

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D+S KETAQLIY+TALMESGF + DPKDFASRIYNSVKSSL+ISP
Sbjct  732  DDSVKETAQLIYQTALMESGFMLNDPKDFASRIYNSVKSSLDISP  776


 Score = 54.7 bits (130),  Expect(2) = 5e-60, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VKISNRL +TP
Sbjct  635  KDKELKESFKELTKWWKGALASENVDDVKISNRLDNTP  672



>ref|XP_009791520.1| PREDICTED: endoplasmin homolog [Nicotiana sylvestris]
Length=811

 Score =   198 bits (504),  Expect(2) = 6e-60, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR+RV KDPE
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDRVAKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES ++TAQL+Y+TAL+ESGF + DPKDFASRIY+SVKSSLN+SP
Sbjct  733  DESVEQTAQLMYQTALLESGFLLNDPKDFASRIYSSVKSSLNVSP  777


 Score = 60.5 bits (145),  Expect(2) = 6e-60, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALASDN+D+VKISNRLADTP
Sbjct  636  KAKELKESFKELTKWWKGALASDNIDDVKISNRLADTP  673



>ref|XP_006473673.1| PREDICTED: endoplasmin homolog [Citrus sinensis]
Length=822

 Score =   202 bits (513),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  679  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  738

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D   ++TAQLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  739  DAGVQQTAQLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  783


 Score = 54.3 bits (129),  Expect(2) = 4e-59, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VK+SNRL +TP
Sbjct  642  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTP  679



>gb|KDO84884.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=818

 Score =   201 bits (512),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  675  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  734

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D   ++TAQLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  735  DAGVQQTAQLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  779


 Score = 54.3 bits (129),  Expect(2) = 4e-59, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VK+SNRL +TP
Sbjct  638  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTP  675



>ref|XP_006435195.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
 gb|ESR48435.1| hypothetical protein CICLE_v10000296mg [Citrus clementina]
Length=820

 Score =   201 bits (512),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  677  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  736

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D   ++TAQLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  737  DAGVQQTAQLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  781


 Score = 54.3 bits (129),  Expect(2) = 4e-59, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VK+SNRL +TP
Sbjct  640  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTP  677



>gb|KDO84885.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=679

 Score =   201 bits (512),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  536  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  595

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D   ++TAQLIY+TALMESGF++ DPKDFASRIY++VKSSLNISP
Sbjct  596  DAGVQQTAQLIYQTALMESGFSLNDPKDFASRIYSTVKSSLNISP  640


 Score = 54.3 bits (129),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VK+SNRL +TP
Sbjct  499  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTP  536



>gb|KDP36908.1| hypothetical protein JCGZ_08199 [Jatropha curcas]
Length=821

 Score =   200 bits (509),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTL+DA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLTDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D S K+TA LIY+TALMESGF + DPKDFASRIY+SVKSSLNISP
Sbjct  733  DASVKQTAHLIYQTALMESGFMLSDPKDFASRIYSSVKSSLNISP  777


 Score = 53.9 bits (128),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VK+SNRL +TP
Sbjct  636  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTP  673



>ref|XP_010246858.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=821

 Score =   197 bits (500),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQ YMRGKRVLEINPRHPIIKELRERVV DPE
Sbjct  668  PCVVVTSKYGWSANMERIMQSQTLSDASKQGYMRGKRVLEINPRHPIIKELRERVVNDPE  727

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TA+L+Y+TALMESGF + DPKDFASRIY+SVK+SL ISP
Sbjct  728  DESVKQTARLMYQTALMESGFMLNDPKDFASRIYDSVKASLKISP  772


 Score = 57.0 bits (136),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LTKWWKG+L S+NVD+VKISNRLADTP
Sbjct  631  KDKDLKESFKELTKWWKGSLTSENVDDVKISNRLADTP  668



>gb|AAF64453.1|AF239931_1 putative heat-shock protein 90 [Euphorbia esula]
Length=317

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NMERIMQ+QTLSDA KQAYM+GKRVLEINPRHPIIKELRERVVKDPE
Sbjct  173  PCVVVTSKYGWSSNMERIMQAQTLSDAKKQAYMKGKRVLEINPRHPIIKELRERVVKDPE  232

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE+ K+TA LIY+TALMESGF + DPKDFASRIY+SVKSSLNISP
Sbjct  233  DENVKQTAHLIYQTALMESGFMLSDPKDFASRIYSSVKSSLNISP  277


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG+LAS+NVD+VKISNRL +TP
Sbjct  136  KDKELKESFKELTKWWKGSLASENVDDVKISNRLDNTP  173



>ref|XP_010069812.1| PREDICTED: endoplasmin homolog [Eucalyptus grandis]
 gb|KCW58281.1| hypothetical protein EUGRSUZ_H00972 [Eucalyptus grandis]
Length=822

 Score =   198 bits (504),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDA+KQ YMRGKRVLEINPRHPIIKELRERVVK+PE
Sbjct  677  PCVVVTSKYGWSANMERIMQSQTLSDANKQGYMRGKRVLEINPRHPIIKELRERVVKNPE  736

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K TAQL+Y+TALMESGF + DPKDFASRI++SVKS LNISP
Sbjct  737  DESVKNTAQLMYQTALMESGFTLSDPKDFASRIHDSVKSGLNISP  781


 Score = 55.1 bits (131),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LTKWWK ALASDNVD+VKISNRL +TP
Sbjct  640  KDKDLKESYKELTKWWKSALASDNVDDVKISNRLDNTP  677



>emb|CAN79404.1| hypothetical protein VITISV_028074 [Vitis vinifera]
Length=1084

 Score =   193 bits (491),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634   PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
             PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD E
Sbjct  935   PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSE  994

Query  454   DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             DE  K+TAQL+Y+TALMESGF + DPK FAS IY+SVKSSLNISP
Sbjct  995   DEGVKKTAQLMYQTALMESGFLLSDPKHFASNIYDSVKSSLNISP  1039


 Score = 59.7 bits (143),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   KDLTKWWK ALAS+NVD+VKISNRLADTP
Sbjct  898  KDKDLKESFKDLTKWWKSALASENVDDVKISNRLADTP  935



>ref|NP_974606.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 gb|AEE84862.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   196 bits (497),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  730  DESVKETAQLMYQTALIESGFILTDPKDFAARIYNSVKSGLNISP  774


 Score = 57.0 bits (136),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>ref|NP_194150.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
 sp|Q9STX5.1|ENPL_ARATH RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; AltName: Full=HSP90-like 
protein 7; AltName: Full=Protein SHEPHERD; Flags: 
Precursor [Arabidopsis thaliana]
 emb|CAB45054.1| HSP90-like protein [Arabidopsis thaliana]
 emb|CAB79329.1| HSP90-like protein [Arabidopsis thaliana]
 gb|AAK63999.1| AT4g24190/T22A6_20 [Arabidopsis thaliana]
 dbj|BAB86369.1| SHEPHERD [Arabidopsis thaliana]
 gb|AAO42773.1| At4g24190/T22A6_20 [Arabidopsis thaliana]
 gb|AEE84861.1| HSP90-like protein GRP94 [Arabidopsis thaliana]
Length=823

 Score =   196 bits (497),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  730  DESVKETAQLMYQTALIESGFILTDPKDFAARIYNSVKSGLNISP  774


 Score = 57.0 bits (136),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>ref|XP_010433803.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   195 bits (496),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  730  DESVKETAQLMYQTALIESGFILNDPKDFAARIYNSVKSGLNISP  774


 Score = 57.0 bits (136),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>ref|XP_002273785.1| PREDICTED: endoplasmin homolog [Vitis vinifera]
 emb|CBI19885.3| unnamed protein product [Vitis vinifera]
Length=818

 Score =   194 bits (492),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERVVKD E
Sbjct  669  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELQERVVKDSE  728

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQL+Y+TALMESGF + DPK FAS IY+SVKSSLNISP
Sbjct  729  DEGVKKTAQLMYQTALMESGFLLSDPKHFASNIYDSVKSSLNISP  773


 Score = 58.9 bits (141),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   KDLTKWWK ALAS+NVD+VKISNRLADTP
Sbjct  632  KDKDLKESFKDLTKWWKSALASENVDDVKISNRLADTP  669



>dbj|BAB86368.1| SHEPHERD [Arabidopsis thaliana]
Length=823

 Score =   195 bits (496),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  730  DESVKETAQLMYQTALIESGFLLTDPKDFAARIYNSVKSGLNISP  774


 Score = 57.0 bits (136),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>ref|XP_007225662.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
 gb|EMJ26861.1| hypothetical protein PRUPE_ppa001487mg [Prunus persica]
Length=815

 Score =   207 bits (528),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            KL+      PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKR+LEINPRHPIIKEL
Sbjct  665  KLSNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRILEINPRHPIIKEL  724

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVVK+ EDES K+TAQLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  725  RERVVKNAEDESVKQTAQLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  778


 Score = 57.8 bits (138),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK ALASDNVD+VK+SNRLADTP
Sbjct  637  KDKEVKESYKELTKWWKSALASDNVDDVKLSNRLADTP  674



>ref|XP_010539097.1| PREDICTED: endoplasmin homolog [Tarenaya hassleriana]
Length=830

 Score =   197 bits (502),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL+ERV  DPE
Sbjct  675  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELKERVASDPE  734

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            +ES KETA+L+Y+TAL+ESGF + DPKDFASRIYNSVK+SLNISP
Sbjct  735  EESAKETAKLMYQTALLESGFILQDPKDFASRIYNSVKTSLNISP  779


 Score = 54.3 bits (129),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK +LA++NVD+VKISNRLADTP
Sbjct  638  KDKELKESFKELTKWWKESLATENVDDVKISNRLADTP  675



>ref|XP_008221245.1| PREDICTED: endoplasmin homolog [Prunus mume]
Length=815

 Score =   207 bits (527),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            KL+      PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKR+LEINPRHPIIKEL
Sbjct  665  KLSNRLADTPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRILEINPRHPIIKEL  724

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVVK+ EDES K+TAQLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  725  RERVVKNAEDESVKQTAQLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  778


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK ALASDNVD+VK+SNRLADTP
Sbjct  637  KDKEVKESYKELTKWWKSALASDNVDDVKLSNRLADTP  674



>gb|AAB63606.1| HSP90 isolog [Arabidopsis thaliana]
Length=335

 Score =   195 bits (496),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPE
Sbjct  182  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPE  241

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  242  DESVKETAQLMYQTALIESGFILTDPKDFAARIYNSVKSGLNISP  286


 Score = 56.6 bits (135),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  145  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  182



>gb|EYU38796.1| hypothetical protein MIMGU_mgv1a001101mg [Erythranthe guttata]
Length=889

 Score =   192 bits (488),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYM+GKRVLEINPRHPIIKELRERV+KDPE
Sbjct  743  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMKGKRVLEINPRHPIIKELRERVLKDPE  802

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TALMESGF + DPK FAS+IY+SVK+SL ISP
Sbjct  803  DESIKQTAQLVYQTALMESGFVLTDPKSFASQIYSSVKNSLEISP  847


 Score = 59.7 bits (143),  Expect(2) = 8e-58, Method: Composition-based stats.
 Identities = 29/38 (76%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K LTKWWKGALASDNVD+VKISNRLADTP
Sbjct  706  KDKELKESFKGLTKWWKGALASDNVDDVKISNRLADTP  743



>ref|XP_010439073.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   194 bits (494),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL+ISP
Sbjct  730  DESVKETAQLMYQTALIESGFILNDPKDFAARIYNSVKSSLSISP  774


 Score = 57.0 bits (136),  Expect(2) = 9e-58, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>ref|XP_006283118.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
 gb|EOA16016.1| hypothetical protein CARUB_v10004140mg [Capsella rubella]
Length=823

 Score =   195 bits (495),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKS LNISP
Sbjct  730  DESVKETAQLMYQTALIESGFLLNDPKDFAARIYNSVKSGLNISP  774


 Score = 56.6 bits (135),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>ref|XP_010448597.1| PREDICTED: endoplasmin homolog [Camelina sativa]
Length=823

 Score =   194 bits (494),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL+ISP
Sbjct  730  DESVKETAQLMYQTALIESGFILNDPKDFAARIYNSVKSSLSISP  774


 Score = 57.0 bits (136),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KAKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>gb|KJB14397.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=809

 Score =   201 bits (510),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 2/144 (1%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMER+MQ+QTL+DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPE
Sbjct  668  PCVVVTSKFGWSANMERLMQAQTLTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPE  727

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPdavveeddeveeeae  275
            DE  K+TAQLIY+TALMESGF + DPKDFASRIY+SVKSSLNISPDA +EE+D+VEE   
Sbjct  728  DEGVKQTAQLIYQTALMESGFILSDPKDFASRIYSSVKSSLNISPDATIEEEDDVEETET  787

Query  274  tsskeaeSNPENAEDGADGIKDEL  203
                +A  +  +AE  + G+KDEL
Sbjct  788  EPETKAGKDGADAE--SSGLKDEL  809


 Score = 50.4 bits (119),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K +  ++  K+LTKWWKG L +++VDEVKISNRL +TP
Sbjct  631  KSRELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTP  668



>gb|EYU36792.1| hypothetical protein MIMGU_mgv1a001447mg [Erythranthe guttata]
Length=818

 Score =   194 bits (492),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGW++NMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RVVKD E
Sbjct  673  PCVVVTSKYGWTSNMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRDRVVKDSE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQLIY+TALMESGF + DP+DFASRIY+SVK+SL ISP
Sbjct  733  DESVKQTAQLIYQTALMESGFMLSDPQDFASRIYSSVKNSLKISP  777


 Score = 57.0 bits (136),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS NVD+VKISNRLAD+P
Sbjct  636  KDKELKESFKELTKWWKGALASHNVDDVKISNRLADSP  673



>emb|CDX92620.1| BnaC07g38780D [Brassica napus]
Length=792

 Score =   195 bits (496),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPE
Sbjct  639  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPE  698

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  699  DESVKETAQLMYQTALIESGFVLNDPKDFAGRIYNSVKSSLKISP  743


 Score = 54.7 bits (130),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+LTKWWK +LAS+NVD+VKISNRLADTP
Sbjct  611  KELTKWWKESLASENVDDVKISNRLADTP  639



>ref|XP_009137776.1| PREDICTED: endoplasmin homolog [Brassica rapa]
Length=822

 Score =   195 bits (495),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  730  DESVKETAQLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774


 Score = 54.7 bits (130),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK +LAS+NVD+VKISNRLADTP
Sbjct  633  KVKELKEAFKELTKWWKESLASENVDDVKISNRLADTP  670



>emb|CDY03477.1| BnaC01g16050D [Brassica napus]
Length=822

 Score =   195 bits (496),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  730  DESVKETAQLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774


 Score = 54.7 bits (130),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+LTKWWK +LAS+NVD+VKISNRLADTP
Sbjct  642  KELTKWWKESLASENVDDVKISNRLADTP  670



>emb|CDY34264.1| BnaA01g13670D [Brassica napus]
Length=822

 Score =   195 bits (495),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  730  DESVKETAQLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774


 Score = 54.7 bits (130),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+LTKWWK +LAS+NVD+VKISNRLADTP
Sbjct  642  KELTKWWKESLASENVDDVKISNRLADTP  670



>gb|KHG17445.1| Endoplasmin [Gossypium arboreum]
Length=812

 Score =   198 bits (503),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMER+MQ+QTL+DASKQAYMRG+R+LEINPRHPIIKELRERVVKDPE
Sbjct  671  PCVVVTSKFGWSANMERLMQAQTLTDASKQAYMRGRRILEINPRHPIIKELRERVVKDPE  730

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQLIY+TALMESGF + DPKDFASRIY+SVKSSLNI P
Sbjct  731  DEGVKQTAQLIYQTALMESGFILTDPKDFASRIYSSVKSSLNIGP  775


 Score = 51.6 bits (122),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  ++  K+LTKWWKG L +++VDEVKISNRL +TP
Sbjct  634  KSKELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTP  671



>ref|XP_003589505.1| Endoplasmin-like protein [Medicago truncatula]
 gb|AES59756.1| heat shock protein 81-2 [Medicago truncatula]
Length=818

 Score =   196 bits (497),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA KQAYMRGKRVLEINPRHPIIKELRERVVK+PE
Sbjct  673  PCVVVTSKFGWSANMERIMQSQTLSDAKKQAYMRGKRVLEINPRHPIIKELRERVVKNPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  733  DESVKQTAQLMYQTALFESGFLLNDPKDFASRIYDSVKTSLDISP  777


 Score = 53.5 bits (127),  Expect(2) = 4e-57, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK +LA+DNVD+VKISNRL +TP
Sbjct  636  KDKELKESFKDLTKWWKNSLANDNVDDVKISNRLDNTP  673



>emb|CDY10992.1| BnaA03g46510D [Brassica napus]
Length=871

 Score =   193 bits (491),  Expect(2) = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVV SK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL+ERV  DPE
Sbjct  666  PCVVVASKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKERVASDPE  725

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  726  DESVKETAQLMYQTALIESGFVLNDPKDFAGRIYNSVKSSLKISP  770


 Score = 55.5 bits (132),  Expect(2) = 6e-57, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK +LAS+NVD+VKISNRLADTP
Sbjct  629  KVKELKEAFKELTKWWKESLASENVDDVKISNRLADTP  666



>ref|XP_006596543.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=815

 Score =   196 bits (498),  Expect(2) = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PE
Sbjct  672  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPE  731

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K TAQL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  732  DEGVKHTAQLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  776


 Score = 52.4 bits (124),  Expect(2) = 8e-57, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK AL+ DNVD+VKISNRL +TP
Sbjct  635  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTP  672



>ref|XP_003545030.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN39421.1| Endoplasmin like [Glycine soja]
Length=816

 Score =   196 bits (498),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PE
Sbjct  673  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K TAQL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  733  DEGVKHTAQLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  777


 Score = 52.4 bits (124),  Expect(2) = 9e-57, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK AL+ DNVD+VKISNRL +TP
Sbjct  636  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTP  673



>ref|XP_002867677.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43936.1| hypothetical protein ARALYDRAFT_492441 [Arabidopsis lyrata subsp. 
lyrata]
Length=823

 Score =   191 bits (485),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 98/104 (94%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  DPE
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL IS
Sbjct  730  DESVKETAQLMYQTALIESGFLLNDPKDFAARIYNSVKSSLKIS  773


 Score = 57.0 bits (136),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKG LAS+NVD+VKISNRLADTP
Sbjct  633  KDKELKEAFKELTKWWKGNLASENVDDVKISNRLADTP  670



>ref|XP_006601356.1| PREDICTED: endoplasmin homolog isoform X2 [Glycine max]
Length=813

 Score =   195 bits (496),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PE
Sbjct  672  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPE  731

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K TAQL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  732  DEGVKHTAQLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  776


 Score = 52.4 bits (124),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK AL+ DNVD+VKISNRL +TP
Sbjct  635  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTP  672



>ref|XP_003550428.1| PREDICTED: endoplasmin homolog isoform X1 [Glycine max]
 gb|KHN12637.1| Endoplasmin like [Glycine soja]
Length=814

 Score =   195 bits (496),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLE+NPRHPIIKELRERVVK+PE
Sbjct  673  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEVNPRHPIIKELRERVVKNPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K TAQL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP
Sbjct  733  DEGVKHTAQLMYQTALFESGFLLDDPKDFASRIYDSVKTSLDISP  777


 Score = 52.4 bits (124),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK AL+ DNVD+VKISNRL +TP
Sbjct  636  KDKELKESFKDLTKWWKTALSKDNVDDVKISNRLDNTP  673



>ref|XP_008387928.1| PREDICTED: LOW QUALITY PROTEIN: endoplasmin homolog [Malus domestica]
Length=818

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            KL+      PCVVVTSKYGWSANMERIMQSQTLSDA+KQ YMRGKR+LEINPRHPI+KEL
Sbjct  664  KLSNRLADTPCVVVTSKYGWSANMERIMQSQTLSDANKQGYMRGKRILEINPRHPIVKEL  723

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVVK+ EDES K+TAQLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  724  RERVVKNAEDESVKKTAQLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  777


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK ALASDNVD+VK+SNRLADTP
Sbjct  636  KDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTP  673



>ref|XP_009334927.1| PREDICTED: endoplasmin homolog [Pyrus x bretschneideri]
Length=818

 Score =   204 bits (518),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            KL+      PCVVVTSKYGWSANMERIMQSQTLSDA+KQ YMRGKR+LEINPRHPIIKEL
Sbjct  664  KLSNRLADTPCVVVTSKYGWSANMERIMQSQTLSDANKQGYMRGKRILEINPRHPIIKEL  723

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVVK+ EDES K+TAQLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  724  RERVVKNAEDESVKKTAQLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  777


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK ALASDNVD+VK+SNRLADTP
Sbjct  636  KDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTP  673



>ref|XP_006342064.1| PREDICTED: endoplasmin homolog [Solanum tuberosum]
Length=806

 Score =   191 bits (486),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSA ME+IM SQTLSDASKQAYMRGKRVLEINPRHPIIK LRERVV DPE
Sbjct  667  PCVVVTSKYGWSAYMEKIMHSQTLSDASKQAYMRGKRVLEINPRHPIIKALRERVVTDPE  726

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K TA+LIY+TALMESGF++ DPKDFAS IY+SVKSSLNISP
Sbjct  727  DESVKLTAKLIYQTALMESGFDLSDPKDFASHIYSSVKSSLNISP  771


 Score = 56.2 bits (134),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 27/43 (63%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  761  RLRIQKPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            +L+  K K  +   K LTKWWK  LASDNV++VKISNRLADTP
Sbjct  625  KLKDSKTKELKESFKGLTKWWKTTLASDNVEDVKISNRLADTP  667



>ref|XP_007160650.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
 gb|ESW32644.1| hypothetical protein PHAVU_001G005200g [Phaseolus vulgaris]
Length=817

 Score =   196 bits (498),  Expect(2) = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PE
Sbjct  674  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPE  733

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+TAQL+Y+TAL ESGF + DPKDF SRIY+SVK+SL+ISP
Sbjct  734  DEGVKQTAQLMYQTALFESGFLLDDPKDFTSRIYDSVKTSLDISP  778


 Score = 51.6 bits (122),  Expect(2) = 1e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK +L+ DNVD+VKISNRL +TP
Sbjct  637  KNKELKESFKDLTKWWKSSLSKDNVDDVKISNRLDNTP  674



>ref|XP_010266798.1| PREDICTED: endoplasmin homolog [Nelumbo nucifera]
Length=822

 Score =   195 bits (495),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQ+LSD  KQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  669  PCVVVTSKYGWSANMERIMQSQSLSDHRKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  728

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D S K+TA+LIY+T+LMESGF + DPKDFASRIY+SVK+SLNISP
Sbjct  729  DNSVKQTARLIYQTSLMESGFMLDDPKDFASRIYDSVKTSLNISP  773


 Score = 52.0 bits (123),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGAL S+NVD+VKISNRL ++P
Sbjct  632  KDKELKESFKELTKWWKGALTSENVDDVKISNRLDNSP  669



>ref|XP_006413464.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
 gb|ESQ54917.1| hypothetical protein EUTSA_v10024414mg [Eutrema salsugineum]
Length=822

 Score =   191 bits (486),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++RV  D E
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRVASDAE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKSSL ISP
Sbjct  730  DESVKETAQLMYQTALIESGFILNDPKDFAARIYNSVKSSLKISP  774


 Score = 55.5 bits (132),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+LTKWWK +LAS+NVD+VKISNRLADTP
Sbjct  642  KELTKWWKESLASENVDDVKISNRLADTP  670



>ref|XP_008377135.1| PREDICTED: endoplasmin homolog [Malus domestica]
Length=818

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            KL+      PCVVVTSKYGWSANMERIMQSQTLSDA+KQ YMRGKR+LEINPRHPIIKEL
Sbjct  664  KLSNRLADTPCVVVTSKYGWSANMERIMQSQTLSDANKQGYMRGKRILEINPRHPIIKEL  723

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVVK+ EDES K TAQLIY+TALMESGFN+PDPKDFASRIY+SVKSSLNI+P
Sbjct  724  RERVVKNAEDESVKLTAQLIYQTALMESGFNLPDPKDFASRIYSSVKSSLNINP  777


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK ALASDNVD+VK+SNRLADTP
Sbjct  636  KDKELKESYKELTKWWKSALASDNVDDVKLSNRLADTP  673



>ref|XP_010691883.1| PREDICTED: endoplasmin homolog [Beta vulgaris subsp. vulgaris]
Length=810

 Score =   188 bits (478),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 120/144 (83%), Gaps = 5/144 (3%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELRERV  DPE
Sbjct  672  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVATDPE  731

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPdavveeddeveeeae  275
            D+  K+TA+L+Y+TAL ESGF + DPKDFASR+Y+SVK+SL+I+PDA VEE+D+ EE   
Sbjct  732  DDGVKQTARLMYQTALFESGFLLDDPKDFASRVYDSVKTSLSINPDAAVEEEDDTEEPEI  791

Query  274  tsskeaeSNPENAEDGADGIKDEL  203
                ++ SN E     AD +KDEL
Sbjct  792  EMKGDSSSNAE-----ADDVKDEL  810


 Score = 57.8 bits (138),  Expect(2) = 3e-56, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALA+D VD+VKISNRLADTP
Sbjct  635  KDKEIKESYKELTKWWKGALATDKVDDVKISNRLADTP  672



>ref|XP_004499281.1| PREDICTED: endoplasmin homolog isoform X1 [Cicer arietinum]
 ref|XP_004499282.1| PREDICTED: endoplasmin homolog isoform X2 [Cicer arietinum]
Length=817

 Score =   196 bits (497),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PE
Sbjct  673  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPda--vveeddeveee  281
            DE  K TAQL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP+A    E+D EVE E
Sbjct  733  DEGVKNTAQLMYQTALFESGFLLNDPKDFASRIYDSVKTSLDISPEATVEEEDDTEVEVE  792

Query  280  aetsskeaeSNPENAEDGADGIKDEL  203
            +ET  + + SNPE A++  D +KDEL
Sbjct  793  SETKEETSTSNPE-ADEVNDDVKDEL  817


 Score = 50.4 bits (119),  Expect(2) = 4e-56, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK +L+ DNVD+VKIS+RL +TP
Sbjct  636  KDKELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTP  673



>ref|XP_004499283.1| PREDICTED: endoplasmin homolog isoform X3 [Cicer arietinum]
Length=816

 Score =   196 bits (497),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 126/146 (86%), Gaps = 3/146 (2%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK+PE
Sbjct  672  PCVVVTSKFGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKNPE  731

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPda--vveeddeveee  281
            DE  K TAQL+Y+TAL ESGF + DPKDFASRIY+SVK+SL+ISP+A    E+D EVE E
Sbjct  732  DEGVKNTAQLMYQTALFESGFLLNDPKDFASRIYDSVKTSLDISPEATVEEEDDTEVEVE  791

Query  280  aetsskeaeSNPENAEDGADGIKDEL  203
            +ET  + + SNPE A++  D +KDEL
Sbjct  792  SETKEETSTSNPE-ADEVNDDVKDEL  816


 Score = 50.4 bits (119),  Expect(2) = 4e-56, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK +L+ DNVD+VKIS+RL +TP
Sbjct  635  KDKELKESFKDLTKWWKNSLSKDNVDDVKISDRLDNTP  672



>ref|XP_004291352.1| PREDICTED: endoplasmin homolog [Fragaria vesca subsp. vesca]
Length=815

 Score =   202 bits (513),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 129/155 (83%), Gaps = 2/155 (1%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            KL+      PCVVVTSK+GWSANME+IMQSQTLSD++KQAYMRGKRVLEINPRHPIIKEL
Sbjct  661  KLSNRLADTPCVVVTSKFGWSANMEKIMQSQTLSDSAKQAYMRGKRVLEINPRHPIIKEL  720

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPdavvee  302
            RERVVK+PEDES K TAQLIY+TALMESGF +PDPKDFASRIY+SVKSSLNI+PDA VEE
Sbjct  721  RERVVKNPEDESVKHTAQLIYQTALMESGFVLPDPKDFASRIYSSVKSSLNINPDATVEE  780

Query  301  ddeve--eeaetsskeaeSNPENAEDGADGIKDEL  203
            +D+ E   EAE  +   E+ PE     AD +KDEL
Sbjct  781  EDDTEDPAEAEAETPANEATPEAEAANADSLKDEL  815


 Score = 59.7 bits (143),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALASDNVD+VK+SNRLADTP
Sbjct  633  KDKELKESYKELTKWWKGALASDNVDDVKLSNRLADTP  670



>ref|XP_004152644.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 ref|XP_004162237.1| PREDICTED: endoplasmin homolog [Cucumis sativus]
 gb|KGN62687.1| hypothetical protein Csa_2G368880 [Cucumis sativus]
Length=817

 Score =   194 bits (492),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIK+LRER+VKDPE
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKDLRERIVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+ A+L+Y+TAL+ESGF + DPKDFAS+IY++VK+SLNISP
Sbjct  733  DEGAKQAAKLMYQTALLESGFILSDPKDFASQIYDTVKTSLNISP  777


 Score = 51.2 bits (121),  Expect(2) = 7e-56, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK AL+ DNVD+VK+SNRL +TP
Sbjct  636  KDKELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTP  673



>ref|XP_011074690.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=811

 Score =   193 bits (491),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDA KQ+YMRGKRVLEIN RHPIIKELRERVVKDPE
Sbjct  670  PCVVVTSKYGWSANMERIMQSQTLSDARKQSYMRGKRVLEINARHPIIKELRERVVKDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TAL+ESGF + DPKDFASRIY+SVK+SL ISP
Sbjct  730  DESVKQTAQLMYQTALLESGFILNDPKDFASRIYSSVKNSLRISP  774


 Score = 51.2 bits (121),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGAL S+NVD+VKISNRL+ +P
Sbjct  633  KDKALKESFKELTKWWKGALVSENVDDVKISNRLSGSP  670



>ref|XP_008444821.1| PREDICTED: endoplasmin homolog [Cucumis melo]
Length=817

 Score =   193 bits (490),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPI+K+LRER+VKDPE
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIVKDLRERIVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K+ A+L+Y+TAL+ESGF + DPKDFAS+IY++VK+SLNISP
Sbjct  733  DEGAKQAAKLMYQTALLESGFILSDPKDFASQIYDTVKTSLNISP  777


 Score = 51.2 bits (121),  Expect(2) = 1e-55, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWK AL+ DNVD+VK+SNRL +TP
Sbjct  636  KDKELKESFKDLTKWWKTALSFDNVDDVKVSNRLDNTP  673



>gb|EPS69355.1| hypothetical protein M569_05408 [Genlisea aurea]
Length=815

 Score =   186 bits (472),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 98/106 (92%), Gaps = 1/106 (1%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQA-YMRGKRVLEINPRHPIIKELRERVVKDP  458
            PCVVVTSKYGWSANMERIMQSQTLSD++KQ+ YMRGKRVLEINPRHPIIKELR+RV  +P
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLSDSNKQSSYMRGKRVLEINPRHPIIKELRDRVALNP  732

Query  457  EDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            EDE  K+TAQL+Y+TALMESGF + DPKDFASRIY SVK+SLNISP
Sbjct  733  EDEGVKQTAQLMYQTALMESGFVLNDPKDFASRIYGSVKNSLNISP  778


 Score = 57.0 bits (136),  Expect(2) = 3e-55, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+LTKWWKGALASDNVD+VKIS+RL+D+P
Sbjct  645  KELTKWWKGALASDNVDDVKISSRLSDSP  673



>gb|KFK29085.1| hypothetical protein AALP_AA7G086900 [Arabis alpina]
Length=823

 Score =   187 bits (474),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKEL++R+  D E
Sbjct  670  PCVVVTSKFGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELKDRIASDSE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            DES KETAQL+Y+TAL+ESGF + DPKDFA+RIYNSVKS L IS
Sbjct  730  DESVKETAQLMYQTALIESGFVLNDPKDFAARIYNSVKSGLKIS  773


 Score = 55.8 bits (133),  Expect(2) = 4e-55, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWKG LASDNVD VKISNRLADTP
Sbjct  633  KDKELKEAFKELTTWWKGILASDNVDSVKISNRLADTP  670



>emb|CDY24830.1| BnaA08g14800D [Brassica napus]
Length=819

 Score =   188 bits (478),  Expect(2) = 9e-55, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC+VVTSK+GWSANMERIMQSQTLSDA KQAYMRGKRVLEINPRHPIIKEL++RV  D E
Sbjct  670  PCIVVTSKFGWSANMERIMQSQTLSDAKKQAYMRGKRVLEINPRHPIIKELKDRVASDQE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D+S KETAQL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  730  DKSVKETAQLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  774


 Score = 53.1 bits (126),  Expect(2) = 9e-55, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+LTKWWK +LA +NVD+VKISNRLADTP
Sbjct  642  KELTKWWKESLAGENVDDVKISNRLADTP  670



>ref|XP_008808636.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=817

 Score =   193 bits (490),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV +DPE
Sbjct  670  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TA+LIY+TALMESGFN+ DPK+FAS IY SV  SL+ISP
Sbjct  730  DESMKQTARLIYQTALMESGFNLNDPKEFASSIYKSVHKSLDISP  774


 Score = 48.5 bits (114),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK AL+S+NVD VKISNRL +TP
Sbjct  633  KLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTP  670



>ref|XP_011045067.1| PREDICTED: endoplasmin homolog [Populus euphratica]
Length=823

 Score =   181 bits (459),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  673  PCVVVTSKYGWSANMERIMQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIY  353
            D+S K+TA L+Y+TALMESGF + DPKDFASRIY
Sbjct  733  DDSVKQTAHLMYQTALMESGFILNDPKDFASRIY  766


 Score = 59.3 bits (142),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VKISNRLADTP
Sbjct  636  KAKELKESFKELTKWWKGALASENVDDVKISNRLADTP  673



>emb|CDP07384.1| unnamed protein product [Coffea canephora]
Length=815

 Score =   197 bits (502),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            K++      PCVVVTSKYGWSANMERIMQSQTLSD+SKQAYMRGKRVLEINPRHPIIKEL
Sbjct  663  KISNRLANTPCVVVTSKYGWSANMERIMQSQTLSDSSKQAYMRGKRVLEINPRHPIIKEL  722

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVVKDPE ES K+TA L+Y+TALMESGF + DPKDFASRIY+SVKSSL+ISP
Sbjct  723  RERVVKDPEGESVKQTAHLMYQTALMESGFMLNDPKDFASRIYDSVKSSLHISP  776


 Score = 57.8 bits (138),  Expect = 3e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   KDLTKWWKG LAS+NVD+VKISNRLA+TP
Sbjct  635  KDKELKESFKDLTKWWKGTLASENVDDVKISNRLANTP  672



>ref|XP_002307732.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
 gb|EEE94728.1| hypothetical protein POPTR_0005s26260g [Populus trichocarpa]
Length=823

 Score =   181 bits (459),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC+VVTSKYGWSANMERIMQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  673  PCIVVTSKYGWSANMERIMQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIY  353
            D+S K+TA L+Y+TALMESGF + DPKDFASRIY
Sbjct  733  DDSVKQTAHLMYQTALMESGFILNDPKDFASRIY  766


 Score = 59.3 bits (142),  Expect(2) = 2e-54, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VKISNRLADTP
Sbjct  636  KAKELKESFKELTKWWKGALASENVDDVKISNRLADTP  673



>gb|AIZ68158.1| heat shock protein 90 [Ornithogalum saundersiae]
Length=814

 Score =   191 bits (485),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRER+  +P+
Sbjct  671  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERIAANPQ  730

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISPdavveeddeveeeae  275
            DES K+TA+L+Y+TALMESGF + DPKDFA RIY+SVK+SL+ISPDA  EE+D++EE   
Sbjct  731  DESIKQTARLMYQTALMESGFLLNDPKDFAERIYSSVKASLDISPDATAEEEDDIEETEA  790

Query  274  tsskeaeSNPENAEDGADGIKDEL  203
               + A ++ E  E+ +  +KDEL
Sbjct  791  EEKESASADKEADEEDSSSLKDEL  814


 Score = 48.9 bits (115),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK AL+++NVD VKISNRL +TP
Sbjct  634  KGKELKETFKELTKWWKDALSAENVDSVKISNRLDNTP  671



>gb|ABK92622.1| unknown [Populus trichocarpa]
Length=214

 Score =   180 bits (457),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC+VVTSKYGWSANMERIMQ+QTLSDA+KQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  64   PCIVVTSKYGWSANMERIMQAQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  123

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIY  353
            D+S K+TA L+Y+TALMESGF + DPKDFASRIY
Sbjct  124  DDSVKQTAHLMYQTALMESGFILNDPKDFASRIY  157


 Score = 59.7 bits (143),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VKISNRLADTP
Sbjct  27   KAKELKESFKELTKWWKGALASENVDDVKISNRLADTP  64



>ref|XP_006851911.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
 gb|ERN13378.1| hypothetical protein AMTR_s00041p00161550 [Amborella trichopoda]
Length=818

 Score =   190 bits (482),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELRERV  DP+
Sbjct  673  PCVVVTSKYGWSANMERIMQSQTLSDANKQAYMRGKRVLEINPRHPIIKELRERVAVDPQ  732

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE+ KETA+L+Y+TALMESGF + +PK+FAS IYNSVKSSL ISP
Sbjct  733  DENVKETAKLMYQTALMESGFMLSEPKEFASSIYNSVKSSLKISP  777


 Score = 49.3 bits (116),  Expect(2) = 4e-54, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK  L+SDNVD VKISNRL +TP
Sbjct  636  KIKETKESFKELTNWWKDVLSSDNVDSVKISNRLDNTP  673



>ref|XP_010935079.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=822

 Score =   190 bits (483),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV +DP+
Sbjct  675  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAQDPK  734

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQLIY+TALMESGF + DPK+FAS IY SV+ SL+ISP
Sbjct  735  DESVKQTAQLIYQTALMESGFILNDPKEFASSIYKSVQKSLDISP  779


 Score = 48.5 bits (114),  Expect(2) = 6e-54, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK AL+S+NVD VKISNRL +TP
Sbjct  638  KLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTP  675



>gb|AAN34791.1| Grp94 [Xerophyta viscosa]
Length=812

 Score =   189 bits (481),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERV  DP+
Sbjct  670  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVAVDPQ  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE+ K+TA+LIY+TALMESGF + DPK+FA+ IY+SVKSSLNISP
Sbjct  730  DENIKQTAKLIYQTALMESGFLMNDPKEFATSIYSSVKSSLNISP  774


 Score = 48.9 bits (115),  Expect(2) = 8e-54, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL+S+NVD VKISNRL +TP
Sbjct  633  KIKDLKESFKELTSWWKEALSSENVDSVKISNRLDNTP  670



>ref|XP_006657350.1| PREDICTED: endoplasmin homolog [Oryza brachyantha]
Length=810

 Score =   188 bits (478),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  670  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAEDNE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             ES K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  730  SESLKQTAKLVYQTALMESGFNLPDPKDFASSIYKSVQKSLDLSP  774


 Score = 49.3 bits (116),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL S+NVD VKISNRL DTP
Sbjct  633  KLKDLKESFKELTDWWKKALDSENVDSVKISNRLHDTP  670



>gb|AAL79732.1|AC091774_23 heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD53585.1| heat shock protein 90 [Oryza sativa Japonica Group]
 dbj|BAD61715.1| heat shock protein 90 [Oryza sativa Japonica Group]
 gb|ADR66979.1| 90 kDa heat shock protein [Oryza sativa Japonica Group]
Length=812

 Score =   189 bits (479),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  671  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSE  730

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             ES K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  731  SESLKQTAKLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  775


 Score = 47.4 bits (111),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL +++VD VKISNRL+DTP
Sbjct  634  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTP  671



>ref|NP_001058590.1| Os06g0716700 [Oryza sativa Japonica Group]
 dbj|BAF20504.1| Os06g0716700 [Oryza sativa Japonica Group]
Length=810

 Score =   189 bits (479),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  669  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSE  728

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             ES K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  729  SESLKQTAKLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  773


 Score = 47.4 bits (111),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL +++VD VKISNRL+DTP
Sbjct  632  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTP  669



>gb|EAZ38293.1| hypothetical protein OsJ_22671 [Oryza sativa Japonica Group]
Length=838

 Score =   189 bits (479),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  697  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSE  756

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             ES K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  757  SESLKQTAKLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  801


 Score = 47.8 bits (112),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL +++VD VKISNRL+DTP
Sbjct  660  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTP  697



>gb|EAZ02369.1| hypothetical protein OsI_24473 [Oryza sativa Indica Group]
Length=837

 Score =   189 bits (479),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  696  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSE  755

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             ES K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  756  SESLKQTAKLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  800


 Score = 47.8 bits (112),  Expect(2) = 3e-53, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL +++VD VKISNRL+DTP
Sbjct  659  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTP  696



>ref|XP_008788614.1| PREDICTED: endoplasmin homolog [Phoenix dactylifera]
Length=822

 Score =   189 bits (479),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYM GKRVLEINPRHPIIKELRERV +DP+
Sbjct  675  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMHGKRVLEINPRHPIIKELRERVAQDPK  734

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TA+LIY+TALMESGF + DPK+FAS IYNSV+ SL+ISP
Sbjct  735  DESVKQTARLIYQTALMESGFILNDPKEFASSIYNSVQKSLDISP  779


 Score = 47.4 bits (111),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK +L+S+NVD VKISNRL +TP
Sbjct  638  KLKELKESFKELTDWWKNSLSSENVDSVKISNRLDNTP  675



>ref|XP_010941296.1| PREDICTED: endoplasmin homolog [Elaeis guineensis]
Length=838

 Score =   187 bits (476),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 87/105 (83%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPI+KELRERV +DP+
Sbjct  691  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIVKELRERVAQDPK  750

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TA+LIY+TALMESGF + DPK+FAS IY SV+ SL+ISP
Sbjct  751  DESVKQTARLIYQTALMESGFILNDPKEFASSIYKSVQKSLDISP  795


 Score = 48.5 bits (114),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK AL+S+NVD VKISNRL +TP
Sbjct  654  KLKELKESFKELTDWWKNALSSENVDSVKISNRLDNTP  691



>emb|CDY08910.1| BnaC08g11400D [Brassica napus]
Length=783

 Score =   184 bits (468),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/104 (84%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -3

Query  631  CVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPED  452
            CVVVTSK+GWSANMERIMQSQTLSDA KQAYMRGKRVLEIN RHPIIKEL++RV  DPED
Sbjct  653  CVVVTSKFGWSANMERIMQSQTLSDAKKQAYMRGKRVLEINLRHPIIKELKDRVASDPED  712

Query  451  ESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             S KETAQL+Y+TAL+ESGF + DPKDFA RIYNSVKSSL ISP
Sbjct  713  GSVKETAQLMYQTALIESGFILNDPKDFAGRIYNSVKSSLKISP  756


 Score = 51.2 bits (121),  Expect(2) = 5e-53, Method: Composition-based stats.
 Identities = 25/31 (81%), Positives = 28/31 (90%), Gaps = 1/31 (3%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTPLC  627
            KDLTKWWK +LA +NVD+VKISNRLADT LC
Sbjct  624  KDLTKWWKESLAGENVDDVKISNRLADT-LC  653



>sp|P35016.1|ENPL_CATRO RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Catharanthus roseus]
 gb|AAA16785.1| heat shock protein 90 [Catharanthus roseus]
Length=817

 Score =   192 bits (488),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            K++      PCVVVTSKYGWS+NMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL
Sbjct  665  KISNRLANTPCVVVTSKYGWSSNMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  724

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVVKD EDES K+TA+L+Y+TALMESGF + DPK+FAS IY+SVKSSL ISP
Sbjct  725  RERVVKDAEDESVKQTARLMYQTALMESGFMLNDPKEFASSIYDSVKSSLKISP  778


 Score = 57.4 bits (137),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VKISNRLA+TP
Sbjct  637  KDKELKESFKELTKWWKGALASENVDDVKISNRLANTP  674



>dbj|BAA90487.1| heat shock protein 90 [Oryza sativa]
Length=810

 Score =   186 bits (473),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  669  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSE  728

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             ES K+TA+L+Y+TALMESGFN+PDPKDFA  IY SV+ SL++SP
Sbjct  729  SESLKQTAKLVYQTALMESGFNLPDPKDFAFSIYRSVQKSLDLSP  773


 Score = 47.4 bits (111),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL +++VD VKISNRL+DTP
Sbjct  632  KLKDLKESFKELTDWWKKALDTESVDSVKISNRLSDTP  669



>ref|XP_004238368.1| PREDICTED: endoplasmin homolog [Solanum lycopersicum]
Length=812

 Score =   191 bits (485),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 92/114 (81%), Positives = 101/114 (89%), Gaps = 0/114 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            K+++     PCVVVTSKYGWSA ME+IM SQTLSDASKQAYMRGKRVLEINPRHPIIK L
Sbjct  664  KISSRLADTPCVVVTSKYGWSAYMEKIMHSQTLSDASKQAYMRGKRVLEINPRHPIIKAL  723

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            RERVV DPEDES K TA+LIY+TALMESGF++ DPKDFAS IY+SVKSSLNISP
Sbjct  724  RERVVTDPEDESVKLTAKLIYQTALMESGFDLSDPKDFASHIYSSVKSSLNISP  777


 Score = 54.3 bits (129),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 26/43 (60%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  761  RLRIQKPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            +L+  K K  +   K LTKWWK  LASDNV++VKIS+RLADTP
Sbjct  631  KLKDSKTKELKESFKGLTKWWKNTLASDNVEDVKISSRLADTP  673



>ref|XP_004966467.1| PREDICTED: endoplasmin homolog [Setaria italica]
Length=807

 Score =   183 bits (464),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  667  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDTE  726

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPK+FAS IY SV+ SL++SP
Sbjct  727  SEGLKQTARLVYQTALMESGFNLPDPKEFASSIYKSVQKSLDLSP  771


 Score = 49.7 bits (117),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL S+NVD VKISNRL DTP
Sbjct  630  KLKDLKESFKELTDWWKKALESENVDSVKISNRLHDTP  667



>ref|XP_009409971.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=814

 Score =   182 bits (463),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDA+KQAYMRGKRVLEINPRHPIIKELR+RV +D +
Sbjct  672  PCVVVTSKYGWSANMEKIMQSQTLSDATKQAYMRGKRVLEINPRHPIIKELRDRVAQDSK  731

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE  K TA+LIY+TALMESGF + DPKDFAS IY SV+ SL+ISP
Sbjct  732  DEGLKHTARLIYQTALMESGFILNDPKDFASSIYKSVQKSLDISP  776


 Score = 48.5 bits (114),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 23/38 (61%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL+S+NVD VKISNRL +TP
Sbjct  635  KLKDLKESFKELTNWWKDALSSENVDSVKISNRLDNTP  672



>ref|NP_001151475.1| endoplasmin precursor [Zea mays]
 gb|ACG42989.1| endoplasmin precursor [Zea mays]
Length=807

 Score =   180 bits (457),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  670  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  729

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K TA+L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  730  SEELKHTARLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  774


 Score = 49.7 bits (117),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL S+NVD VKISNRL DTP
Sbjct  633  KLKDLKESFKELTDWWKKALESENVDSVKISNRLHDTP  670



>gb|AFW75767.1| endoplasmin [Zea mays]
Length=804

 Score =   180 bits (457),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  668  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  727

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K TA+L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  728  SEELKHTARLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  772


 Score = 49.3 bits (116),  Expect(2) = 3e-51, Method: Composition-based stats.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK AL S+NVD VKISNRL DTP
Sbjct  631  KLKELKESFKELTDWWKKALESENVDSVKISNRLHDTP  668



>gb|AFW75769.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=429

 Score =   180 bits (457),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  293  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  352

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K TA+L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  353  SEELKHTARLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  397


 Score = 48.9 bits (115),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK AL S+NVD VKISNRL DTP
Sbjct  256  KLKELKESFKELTDWWKKALESENVDSVKISNRLHDTP  293



>ref|XP_003563275.1| PREDICTED: endoplasmin homolog [Brachypodium distachyon]
Length=807

 Score =   183 bits (465),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  667  PCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSE  726

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
             ES K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++S
Sbjct  727  SESLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLS  770


 Score = 45.4 bits (106),  Expect(2) = 5e-51, Method: Composition-based stats.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL S+++D VKISNRL +TP
Sbjct  630  KLKDLKESFKELTDWWKKALESESIDSVKISNRLHNTP  667



>gb|AFW75768.1| hypothetical protein ZEAMMB73_790349 [Zea mays]
Length=667

 Score =   180 bits (457),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  531  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  590

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K TA+L+Y+TALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  591  SEELKHTARLVYQTALMESGFNLPDPKEFASSIYKSVQKGLDLSP  635


 Score = 48.9 bits (115),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LT WWK AL S+NVD VKISNRL DTP
Sbjct  494  KLKELKESFKELTDWWKKALESENVDSVKISNRLHDTP  531



>ref|XP_009393849.1| PREDICTED: endoplasmin homolog [Musa acuminata subsp. malaccensis]
Length=815

 Score =   182 bits (462),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 85/105 (81%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQSQTLSDASKQAYMRGKRVLEINPRHP+IKELR+RV +D +
Sbjct  669  PCVVVTSKYGWSANMEKIMQSQTLSDASKQAYMRGKRVLEINPRHPVIKELRDRVAQDSK  728

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K TA+LIY+TALMESGF + DPK+FAS IY SV+ SL+ISP
Sbjct  729  DESLKHTARLIYQTALMESGFILNDPKEFASSIYKSVQKSLDISP  773


 Score = 46.6 bits (109),  Expect(2) = 5e-51, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WW  AL+S+NVD VKISNRL +TP
Sbjct  632  KLKDLKESFKELTNWWNDALSSENVDSVKISNRLDNTP  669



>gb|ABV82432.1| Hsp90-like protein [Dactylis glomerata]
Length=808

 Score =   184 bits (467),  Expect(2) = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  666  PCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  725

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D   K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  726  DVGLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  770


 Score = 43.9 bits (102),  Expect(2) = 9e-51, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL ++ +D VKISNRL +TP
Sbjct  629  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTP  666



>ref|XP_011083591.1| PREDICTED: endoplasmin homolog [Sesamum indicum]
Length=808

 Score =   171 bits (433),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 92/105 (88%), Gaps = 8/105 (8%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NMERIMQSQTLSDASKQAYMRGKRVLEINPRHPII  +        +
Sbjct  672  PCVVVTSKYGWSSNMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIFLV--------Q  723

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DES K+TAQL+Y+TALMESGF + DPKDFASRIY+SVKSSLNISP
Sbjct  724  DESVKQTAQLMYQTALMESGFLLNDPKDFASRIYSSVKSSLNISP  768


 Score = 57.0 bits (136),  Expect(2) = 1e-50, Method: Composition-based stats.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VKISNRL+D+P
Sbjct  635  KDKELKESFKELTKWWKGALASENVDDVKISNRLSDSP  672



>sp|P36183.1|ENPL_HORVU RecName: Full=Endoplasmin homolog; AltName: Full=Glucose-regulated 
protein 94 homolog; Short=GRP-94 homolog; Flags: Precursor 
[Hordeum vulgare]
 emb|CAA48143.1| GRP94 homologue [Hordeum vulgare]
 dbj|BAJ91793.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=809

 Score =   184 bits (466),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D +
Sbjct  667  PCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSD  726

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  727  SEGLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  771


 Score = 43.9 bits (102),  Expect(2) = 1e-50, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL ++ +D VKISNRL +TP
Sbjct  630  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTP  667



>gb|EMS56078.1| Endoplasmin-like protein [Triticum urartu]
Length=875

 Score =   183 bits (465),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D +
Sbjct  735  PCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSD  794

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  795  SEGLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  839


 Score = 44.3 bits (103),  Expect(2) = 1e-50, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL ++ +D VKISNRL +TP
Sbjct  698  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTP  735



>ref|XP_002439030.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
 gb|EER90397.1| hypothetical protein SORBIDRAFT_10g030240 [Sorghum bicolor]
Length=807

 Score =   181 bits (460),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  668  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  727

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K TA+L+Y+TALMESGFN+PDPK+FAS IY SV+ SL++SP
Sbjct  728  SEELKHTARLVYQTALMESGFNLPDPKEFASSIYKSVQKSLDLSP  772


 Score = 46.2 bits (108),  Expect(2) = 1e-50, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+L+ WWK AL S+NVD VKISNRL +TP
Sbjct  631  KLKELKESFKELSDWWKKALESENVDSVKISNRLHNTP  668



>gb|AFW69515.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=1001

 Score =   181 bits (460),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  861  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  920

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPK+FAS IY SV  SL++SP
Sbjct  921  SEELKQTARLVYQTALMESGFNLPDPKEFASSIYKSVHKSLDLSP  965


 Score = 46.2 bits (108),  Expect(2) = 1e-50, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  740  KN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+ +   K+LT+WWK AL S++VD VK+S+RL DTP
Sbjct  826  KDLKESFKELTEWWKKALESESVDSVKVSSRLHDTP  861



>gb|EMT19498.1| Endoplasmin-like protein [Aegilops tauschii]
Length=1222

 Score =   182 bits (463),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D +
Sbjct  676  PCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSD  735

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  736  SEGLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  780


 Score = 44.7 bits (104),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K+ +   K+LT WWK AL ++ +D VKISNRL +TP
Sbjct  639  KLKDLKESFKELTDWWKKALDTEGIDSVKISNRLHNTP  676



>ref|XP_008643502.1| PREDICTED: shepherd-like1 isoform X1 [Zea mays]
 gb|AFW69514.1| hypothetical protein ZEAMMB73_665489 [Zea mays]
Length=808

 Score =   181 bits (460),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  668  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  727

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPK+FAS IY SV  SL++SP
Sbjct  728  SEELKQTARLVYQTALMESGFNLPDPKEFASSIYKSVHKSLDLSP  772


 Score = 45.4 bits (106),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  740  KN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+ +   K+LT+WWK AL S++VD VK+S+RL DTP
Sbjct  633  KDLKESFKELTEWWKKALESESVDSVKVSSRLHDTP  668



>ref|NP_001146348.1| shepherd-like1 [Zea mays]
 gb|ACL53742.1| unknown [Zea mays]
Length=719

 Score =   181 bits (460),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E
Sbjct  579  PCVVVTSKYGWSANMEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNE  638

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPK+FAS IY SV  SL++SP
Sbjct  639  SEELKQTARLVYQTALMESGFNLPDPKEFASSIYKSVHKSLDLSP  683


 Score = 45.1 bits (105),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = -2

Query  740  KN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K+ +   K+LT+WWK AL S++VD VK+S+RL DTP
Sbjct  544  KDLKESFKELTEWWKKALESESVDSVKVSSRLHDTP  579



>dbj|BAJ89816.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=542

 Score =   183 bits (465),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 97/105 (92%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWS+NME+IMQ+QTLSDASKQAYMRGKRVLEINPRHPIIKELR++V +D +
Sbjct  400  PCVVVTSKYGWSSNMEKIMQAQTLSDASKQAYMRGKRVLEINPRHPIIKELRDKVAQDSD  459

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
             E  K+TA+L+Y+TALMESGFN+PDPKDFAS IY SV+ SL++SP
Sbjct  460  SEGLKQTARLVYQTALMESGFNLPDPKDFASSIYRSVQKSLDLSP  504



>gb|ABK24228.1| unknown [Picea sitchensis]
Length=466

 Score =   179 bits (453),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            P VVVTSKYGWSANMERIMQSQTLSDA++Q+YMRGKRVLEINPRHPIIKELRERV + PE
Sbjct  304  PGVVVTSKYGWSANMERIMQSQTLSDANRQSYMRGKRVLEINPRHPIIKELRERVTQSPE  363

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE+ K+TA+LIY+TALMESGF + DPK+FAS IY+++K++LN++P
Sbjct  364  DENIKQTARLIYQTALMESGFILNDPKEFASSIYSTIKTTLNVNP  408


 Score = 46.2 bits (108),  Expect(2) = 1e-49, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  ++  K+LT WWK  L+S+NVD VKISNRL +TP
Sbjct  267  KDKEIKDSFKELTNWWKDILSSENVDSVKISNRLDNTP  304



>gb|ABV21762.1| GRP94 [Pinus taeda]
Length=834

 Score =   175 bits (444),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 99/105 (94%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            P VVVTSKYGWSANMERIMQSQTLSDA++Q+YMRGKRVLEINP+HPIIKELRERV ++PE
Sbjct  672  PGVVVTSKYGWSANMERIMQSQTLSDANRQSYMRGKRVLEINPKHPIIKELRERVTQNPE  731

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            +E+ K+TA+LIY+TALMESGF + DPK+FA+ IY+++K++LN++P
Sbjct  732  EENIKQTARLIYQTALMESGFILNDPKEFATSIYSTIKTTLNVNP  776


 Score = 48.1 bits (113),  Expect(2) = 2e-49, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  ++  K+LT WWK  L+S+NVD VKISNRL +TP
Sbjct  635  KDKEIKDSFKELTNWWKDVLSSENVDSVKISNRLDNTP  672



>ref|XP_002969701.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
 gb|EFJ28825.1| hypothetical protein SELMODRAFT_451343 [Selaginella moellendorffii]
Length=867

 Score =   165 bits (417),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            P VVVTS YGWSANMERIM++QTL+D S+Q YMRGKRVLEINPRHPIIKELR +V + PE
Sbjct  692  PAVVVTSTYGWSANMERIMRAQTLTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPE  751

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DESTK T +LIYKTAL++SGF V D K+FAS+IY+ +KS+LNISP
Sbjct  752  DESTKATGKLIYKTALIDSGFLVDDSKEFASQIYSIIKSNLNISP  796


 Score = 44.7 bits (104),  Expect(2) = 3e-45, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = -2

Query  749  QKPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            +K K  +   K L  WWK  L  + VD VKISNRLADTP
Sbjct  654  EKAKELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTP  692



>ref|XP_002981308.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
 gb|EFJ17496.1| hypothetical protein SELMODRAFT_444847 [Selaginella moellendorffii]
Length=867

 Score =   165 bits (417),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 92/105 (88%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            P VVVTS YGWSANMERIM++QTL+D S+Q YMRGKRVLEINPRHPIIKELR +V + PE
Sbjct  692  PAVVVTSTYGWSANMERIMRAQTLTDNSRQNYMRGKRVLEINPRHPIIKELRGKVDEQPE  751

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DESTK T +LIYKTAL++SGF V D K+FAS+IY+ +KS+LNISP
Sbjct  752  DESTKATGKLIYKTALIDSGFLVDDSKEFASQIYSIIKSNLNISP  796


 Score = 44.7 bits (104),  Expect(2) = 3e-45, Method: Composition-based stats.
 Identities = 21/39 (54%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = -2

Query  749  QKPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            +K K  +   K L  WWK  L  + VD VKISNRLADTP
Sbjct  654  EKAKELKQSFKPLLAWWKDVLKPEGVDSVKISNRLADTP  692



>ref|XP_001770511.1| predicted protein [Physcomitrella patens]
 gb|EDQ64680.1| predicted protein [Physcomitrella patens]
Length=849

 Score =   165 bits (418),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 72/105 (69%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            P VVVTSKYGWSANMERIMQ+QTL+D SKQ+YMRGKR+LEINP+HPIIK+L+E++    E
Sbjct  677  PAVVVTSKYGWSANMERIMQAQTLADPSKQSYMRGKRILEINPKHPIIKDLKEKISLSSE  736

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            D+S K+ A+L+++TAL+ESGF + DPKDFA+RIY+ +KS+LN+SP
Sbjct  737  DDSAKQAAKLVFETALLESGFVLEDPKDFANRIYSVIKSNLNVSP  781


 Score = 43.1 bits (100),  Expect(2) = 7e-45, Method: Composition-based stats.
 Identities = 20/38 (53%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWK  L+ + V+ VK+SNRLA+TP
Sbjct  640  KFKEIKESYKELTKWWKDLLSGEMVEAVKVSNRLANTP  677



>gb|AFK40768.1| unknown [Lotus japonicus]
Length=82

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = -3

Query  592  MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKT  413
            MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDES K+TAQL+Y+T
Sbjct  1    MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESVKQTAQLMYQT  60

Query  412  ALMESGFNVPDPKDFASRI  356
            AL ESGF + DPKDFASRI
Sbjct  61   ALFESGFLLNDPKDFASRI  79



>gb|ACN26939.1| unknown [Zea mays]
Length=123

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 81/91 (89%), Gaps = 0/91 (0%)
 Frame = -3

Query  592  MERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPEDESTKETAQLIYKT  413
            ME+IMQ+QTLSD+SKQAYMRGKRVLEINPRHPIIKELR++V +D E E  K TA+L+Y+T
Sbjct  1    MEKIMQAQTLSDSSKQAYMRGKRVLEINPRHPIIKELRDKVAQDNESEELKHTARLVYQT  60

Query  412  ALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            ALMESGFN+PDPK+FAS IY SV+  L++SP
Sbjct  61   ALMESGFNLPDPKEFASSIYKSVQKGLDLSP  91



>gb|KDO84886.1| hypothetical protein CISIN_1g003458mg [Citrus sinensis]
Length=762

 Score =   131 bits (330),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/60 (100%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE
Sbjct  675  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  734


 Score = 54.3 bits (129),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 25/38 (66%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K K  +   K+LTKWWKGALAS+NVD+VK+SNRL +TP
Sbjct  638  KDKELKESFKELTKWWKGALASENVDDVKVSNRLDNTP  675



>ref|XP_003063917.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH51539.1| predicted protein [Micromonas pusilla CCMP1545]
Length=820

 Score =   146 bits (369),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            K++   +T PC VVTSKYGWSANMERIM++Q LSD S+ +YM+GK+ LEINPRHPIIK L
Sbjct  663  KISNRLVTTPCSVVTSKYGWSANMERIMKAQALSDESRLSYMKGKKTLEINPRHPIIKAL  722

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            +ER   D +DE TK  A+++++TA++ESGF   +P  FASR+++ V+S++ +S
Sbjct  723  KERAADDADDEETKTLAKVMFETAMLESGFTFEEPAGFASRLFDMVRSNMGVS  775



>gb|KJB14398.1| hypothetical protein B456_002G122800 [Gossypium raimondii]
Length=739

 Score =   125 bits (315),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 54/60 (90%), Positives = 60/60 (100%), Gaps = 0/60 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCVVVTSK+GWSANMER+MQ+QTL+DASKQAYMRGKR+LEINPRHPI+KELRERVVKDPE
Sbjct  668  PCVVVTSKFGWSANMERLMQAQTLTDASKQAYMRGKRILEINPRHPIVKELRERVVKDPE  727


 Score = 50.4 bits (119),  Expect(2) = 4e-35, Method: Composition-based stats.
 Identities = 22/38 (58%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = -2

Query  746  KPKN*RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            K +  ++  K+LTKWWKG L +++VDEVKISNRL +TP
Sbjct  631  KSRELKDSFKELTKWWKGTLKTEDVDEVKISNRLDNTP  668



>ref|XP_002508627.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69885.1| predicted protein [Micromonas sp. RCC299]
Length=777

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 0/112 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            K++   +T PC VVTSKYGWSANMERIM++Q LSD  + AYMRG++ LEINP HPIIK L
Sbjct  639  KISNRLVTTPCSVVTSKYGWSANMERIMKAQALSDDGRMAYMRGRKTLEINPGHPIIKAL  698

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            +E+   D  DE TK TA ++Y+TAL+ESGF   +PK FA R+++ V+  L +
Sbjct  699  KEKSEDDAGDEDTKRTALIMYETALLESGFMFEEPKGFAGRLFDMVRRDLGV  750



>ref|XP_001421809.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00103.1| Heat Shock Protein 90, endoplasmic reticulum [Ostreococcus lucimarinus 
CCE9901]
Length=794

 Score =   141 bits (355),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -3

Query  685  PVTMLMK*KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINP  506
            P TM+   K++    T PCVVV+SKYGWSANMERIM++Q + D S+  YMRGK+ LE+NP
Sbjct  636  PDTMIEAVKVSNRLSTTPCVVVSSKYGWSANMERIMKAQAMGDESRHEYMRGKKTLEVNP  695

Query  505  RHPIIKELRERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            RHP+I  L+ER   DP+ E T+  A+L+++TA++ESGF+   P+++ SR+++ +KS++ I
Sbjct  696  RHPMIAALKERAATDPDSEETETLAKLMFETAMLESGFSFDKPQEYTSRVFDLLKSNMGI  755



>emb|CEG00480.1| Histidine kinase-like ATPase, ATP-binding domain [Ostreococcus 
tauri]
Length=789

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PCVVV+SKYGWSANMERIM++Q + D S+  YMRGK+ LEINPRHP+I  L+ER   D
Sbjct  649  TTPCVVVSSKYGWSANMERIMKAQAMGDESRHEYMRGKKTLEINPRHPMIAALKERAASD  708

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            P+    +  A+L+++TA++ESGF+   P D+A R+++ +K ++ +
Sbjct  709  PDSTENEALAKLMFETAMLESGFSFDKPGDYAGRVFDLLKMNMGV  753



>ref|XP_003083767.1| heat shock protein 90 (ISS) [Ostreococcus tauri]
Length=788

 Score =   132 bits (333),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 79/105 (75%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PCVVV+SKYGWSANMERIM++Q + D S+  YMRGK+ LEINPRHP+I  L+ER   D
Sbjct  648  TTPCVVVSSKYGWSANMERIMKAQAMGDESRHEYMRGKKTLEINPRHPMIAALKERAASD  707

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            P+    +  A+L+++TA++ESGF+   P D+A R+++ +K ++ +
Sbjct  708  PDSTENEALAKLMFETAMLESGFSFDKPGDYAGRVFDLLKMNMGV  752



>ref|XP_006220022.1| PREDICTED: heat shock protein 90-like, partial [Vicugna pacos]
Length=189

 Score =   122 bits (307),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  
Sbjct  53   PCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKN  112

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D++ K+   L+++TAL+ SGF + +P+  ASRIY  +K  L+I 
Sbjct  113  DKTVKDLVILLFETALLSSGFTLEEPQSHASRIYRMIKLGLDIG  156



>emb|CAG01829.1| unnamed protein product [Tetraodon nigroviridis]
Length=212

 Score =   123 bits (308),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS YGW+ANMERIM+SQ L D+S   YM  K+ LEINP HPII+ LRE+   D  
Sbjct  76   PCCIVTSTYGWTANMERIMKSQALRDSSTMGYMTAKKHLEINPLHPIIETLREKAEADKN  135

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y+TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  136  DKAVKDLVILLYETALLSSGFTLEDPQTHANRIYRMIKLGLGI  178



>ref|XP_005842771.1| hypothetical protein CHLNCDRAFT_59468, partial [Chlorella variabilis]
 gb|EFN50654.1| hypothetical protein CHLNCDRAFT_59468 [Chlorella variabilis]
Length=325

 Score =   124 bits (312),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PCVVV+SKYGWSA ME+I +SQTL D+ +  +MRG+R LEINPRHP+I+EL+ + + D
Sbjct  232  TTPCVVVSSKYGWSATMEKIARSQTLGDSERAKWMRGQRTLEINPRHPLIRELKAQHIAD  291

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASR  359
            PE  S K+ AQL+Y+T L+ESG  + D K+F SR
Sbjct  292  PESASVKDNAQLLYQTCLLESGCLLDDMKEFNSR  325


 Score = 35.0 bits (79),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 21/33 (64%), Gaps = 1/33 (3%)
 Frame = -2

Query  731  RNHSKDLTKWWKGALASDNVDEVKISNRLADTP  633
            +   KDL KWWK +L    V+ VK+S RLA TP
Sbjct  203  KEEFKDLAKWWKESLGP-AVESVKVSKRLATTP  234



>ref|XP_005911315.1| PREDICTED: heat shock protein HSP 90-alpha-like, partial [Bos 
mutus]
Length=164

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D SK  YM  K+ LEINP H II+ LR++   
Sbjct  25   VTSPCCIVTSTYGWTANMERIMKAQALRDNSKMGYMAAKKHLEINPDHSIIETLRQKAEA  84

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  85   DKNDKSVKDLVILLYDTALLSSGFSLEDPQTHANRIYRMIKLGLGI  130



>gb|KHJ75602.1| Hsp90 protein [Oesophagostomum dentatum]
Length=212

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  73   VNSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEV  132

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  133  DKNDKTVKDLVILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  179



>ref|XP_007512535.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17135.1| predicted protein [Bathycoccus prasinos]
Length=1223

 Score =   129 bits (324),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = -3

Query  640   TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
             T PCVVVTSKYGWSANMERIM++Q LSD S+  YM+GK+ LEIN +HP++  L+E+   D
Sbjct  1072  TTPCVVVTSKYGWSANMERIMRAQALSDDSRAQYMKGKKTLEINYKHPLVAALKEKYEAD  1131

Query  460   PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
              EDE++K  A ++++TAL+ESGF + D K  ASR+++ +K  + +
Sbjct  1132  GEDETSKNLAVVMFETALIESGFVIDDSKSMASRVFDLLKDKMGV  1176



>ref|XP_001740319.1| heat shock protein [Entamoeba dispar SAW760]
 gb|EDR23250.1| heat shock protein, putative [Entamoeba dispar SAW760]
Length=207

 Score =   121 bits (304),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGWSANMERIM++Q L D S   YM  K+ LEINP HPI++ELR+RV  D  
Sbjct  76   PCALVTGEYGWSANMERIMKAQALRDNSMSTYMVSKKTLEINPDHPIVQELRKRVHTDNS  135

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++ +P  FA RIY  VK  L++
Sbjct  136  DKTVKDLVVLLFETALLSSGFSLDEPAAFAGRIYRMVKLGLSL  178



>dbj|BAA13431.1| heat shock protein 90 [Homo sapiens]
Length=151

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP H II+ LR++   
Sbjct  12   VTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEA  71

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  72   DKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI  117



>emb|CAU15484.1| heat shock protein 90 [Meloidogyne artiellia]
Length=723

 Score =   127 bits (319),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ LEINP H IIK LRERV  
Sbjct  582  VSSPCCIVTGEYGWTANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRERVDS  641

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D +D++ K+   L+Y+TAL+ SGF++ DP+  ASRIY  VK  L+I+
Sbjct  642  DQDDKTAKDLVVLLYETALLTSGFSLEDPQQHASRIYRMVKLGLDIT  688



>gb|ADD10372.1| heat shock protein 90 [Meloidogyne incognita]
Length=708

 Score =   126 bits (317),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ LEINP H IIK LRER+  
Sbjct  567  VSSPCCIVTGEYGWTANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRERIDS  626

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D +D++ K+   L+Y+TAL+ SGF++ DP+  ASRIY  VK  L+I+
Sbjct  627  DQDDKTAKDLVVLLYETALLTSGFSLEDPQQHASRIYRMVKLGLDIT  673



>ref|XP_005651682.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
 gb|EIE27138.1| heat shock protein Hsp90 [Coccomyxa subellipsoidea C-169]
Length=768

 Score =   126 bits (317),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 80/112 (71%), Gaps = 0/112 (0%)
 Frame = -3

Query  661  KLATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKEL  482
            K++T   T P +V+TSKYGWSANMERIM+SQ L D + ++YM+G + LEINPRHP++ EL
Sbjct  627  KVSTRLATSPAIVLTSKYGWSANMERIMKSQALGDTADRSYMKGMKTLEINPRHPLVLEL  686

Query  481  RERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            + +  +D E +     A+L++ TAL+ESGF +  PK+F SRIY  +  + NI
Sbjct  687  KRQFEEDKESDKAAAYARLLWDTALLESGFEIEAPKEFNSRIYGLLAQAYNI  738



>gb|AEF33377.1| heat shock protein 90, partial [Crassostrea ariakensis]
Length=169

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H IIK L+E+   
Sbjct  31   VTSPCCIVTSQYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSIIKSLKEKAEA  90

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+++T+L+ SGF++ +P   ASRI+  +K  L I
Sbjct  91   DKNDKSVKDLVMLLFETSLLASGFSLEEPGTHASRIHRMIKLGLGI  136



>ref|XP_001753222.1| predicted protein [Physcomitrella patens]
 gb|EDQ81851.1| predicted protein [Physcomitrella patens]
Length=759

 Score =   118 bits (296),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 77/105 (73%), Gaps = 0/105 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            P VVVTS+ GWS+NMER++ +Q L D SK + M+ KR+LEINPRHPII+ L ++V +DP 
Sbjct  616  PAVVVTSRTGWSSNMERVVLAQALVDPSKVSQMKSKRILEINPRHPIIRMLLQKVTEDPA  675

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNISP  320
            DE     A LIY+TAL+ESGF + + K FA +I++ +K  L++ P
Sbjct  676  DEVAHRVAVLIYETALLESGFTLNNAKTFAEQIHSLMKLVLDVDP  720


 Score = 37.4 bits (85),  Expect(2) = 3e-29, Method: Composition-based stats.
 Identities = 15/27 (56%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = -2

Query  713  LTKWWKGALASDNVDEVKISNRLADTP  633
            LT+WWK  LA +++  VK+S RLA+TP
Sbjct  590  LTRWWKDLLAGESIGFVKVSARLANTP  616



>gb|KHN76289.1| Heat shock protein HSP 90-alpha [Toxocara canis]
Length=656

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  514  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  573

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  574  DKNDKTVKDLVVLLFETALLSSGFSLDDPQLHASRIYRMIKLGLDIA  620



>emb|CDP96098.1| Protein BM-DAF-21, isoform a [Brugia malayi]
Length=717

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  575  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  634

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  635  DKNDKTVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDIT  681



>ref|XP_003135662.1| heat shock protein 90 [Loa loa]
Length=700

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  558  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  617

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  618  DKNDKTVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDIT  664



>gb|ACO55133.1| heat shock protein 90 [Litomosoides sigmodontis]
Length=718

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  576  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  635

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  636  DKNDKTVKDLVVLLFETALLSSGFSLDDPQLHASRIYRMIKLGLDIT  682



>emb|CAA06694.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  575  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  634

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  635  DKNDKTVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDIT  681



>sp|O61998.2|HSP90_BRUPA RecName: Full=Heat shock protein 90 [Brugia pahangi]
 emb|CAA06695.1| heat shock protein 90 [Brugia pahangi]
Length=717

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  575  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  634

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  635  DKNDKTVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDIT  681



>gb|EJW88125.1| heat shock protein 90 [Wuchereria bancrofti]
Length=717

 Score =   126 bits (316),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  575  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  634

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  635  DKNDKTVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDIT  681



>ref|XP_005538149.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAC67671.2| heat shock 90kD protein [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82113.1| heat shock protein of Hsp90 family [Cyanidioschyzon merolae strain 
10D]
Length=706

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC++VTS++GWSANMERIM++Q L D++   YM  K+++E+NP +PII+ELR+RV  DP 
Sbjct  570  PCILVTSEFGWSANMERIMKAQALRDSTMSMYMSAKKIMEVNPSNPIIRELRDRVEADPS  629

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y TAL+ SGF++ +P  F+SRI+  +K  L+I
Sbjct  630  DKTVKDLVNLLYDTALLASGFSLDEPNTFSSRIHRMIKLGLSI  672



>ref|XP_010928209.1| PREDICTED: heat shock protein 90-2-like, partial [Elaeis guineensis]
Length=132

 Score =   117 bits (294),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ +EINP +PI++ELR+R   D  
Sbjct  1    PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKN  60

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++TAL+ SGF++ DP  F +RI+  +K  L+I
Sbjct  61   DKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI  103



>ref|XP_001901767.1| heat shock protein 90 [Brugia malayi]
Length=699

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  557  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  616

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  617  DKNDKTVKDLVVLLFETALLSSGFSLEDPQLHASRIYRMIKLGLDIT  663



>gb|ACO55135.1| heat shock protein 90 [Toxocara cati]
Length=723

 Score =   125 bits (315),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  581  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  640

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I+
Sbjct  641  DKNDKTVKDLVVLLFETALLSSGFSLDDPQLHASRIYRMIKLGLDIA  687



>dbj|BAF75058.1| heat shock protein [Prymnesium parvum]
Length=150

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGW+ANMERIM++Q L D+S  +YM  K+ +EINP+H I+KEL+ +   D  
Sbjct  19   PCVLVTGEYGWTANMERIMRAQALRDSSMSSYMASKKTMEINPKHSIMKELKAKAAADKG  78

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++T+L+ SGF++ +P  FA RI+  +K  L+I
Sbjct  79   DKTVKDLVHLLFETSLLTSGFSLDEPATFAGRIHRMIKLGLSI  121



>ref|XP_008256039.1| PREDICTED: heat shock protein HSP 90-alpha-like, partial [Oryctolagus 
cuniculus]
Length=152

 Score =   117 bits (294),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = -3

Query  655  ATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRE  476
            +T  +T PC +VTS YGW+ANMERIM++Q L D S   Y+  K+ LE+NP H II+ LR+
Sbjct  9    STRLVTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYVAAKKHLEVNPDHSIIETLRQ  68

Query  475  RVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            +   D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY+ +K  L I
Sbjct  69   KAEADKNDKSVKDLIILLYETALLSSGFSLEDPQTHANRIYSMIKLGLGI  118



>ref|XP_308797.3| AGAP006961-PA [Anopheles gambiae str. PEST]
 gb|EAA45456.3| AGAP006961-PA [Anopheles gambiae str. PEST]
Length=369

 Score =   122 bits (306),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM GK+ LEINP H II+ LR+R   D  
Sbjct  225  PCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKN  284

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++ +P   ASRIY  +K  L I
Sbjct  285  DKAVKDLVILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGI  327



>gb|ACO55134.1| heat shock protein 90 [Ascaris suum]
Length=721

 Score =   125 bits (313),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  579  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  638

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I
Sbjct  639  DKNDKTVKDLVVLLFETALLSSGFSLDDPQLHASRIYRMIKLGLDI  684



>gb|ERG82208.1| heat shock protein hsp 90-alpha [Ascaris suum]
Length=726

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  579  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  638

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ASRIY  +K  L+I
Sbjct  639  DKNDKTVKDLVVLLFETALLSSGFSLDDPQLHASRIYRMIKLGLDI  684



>ref|XP_006678605.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80649.1| hypothetical protein BATDEDRAFT_36900 [Batrachochytrium dendrobatidis 
JAM81]
Length=586

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PCV+VT++YGWSANMERIM++Q L DAS Q+YM GK+ LE+NP + I+K L+ +V +
Sbjct  452  VNSPCVLVTNQYGWSANMERIMKAQALRDASMQSYMLGKKTLELNPDNAIVKALKVKVDE  511

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+  QL+Y+TAL+ SGF++ +P  FA RI+  +K  L+I
Sbjct  512  DKNDKTVKDLTQLLYETALLSSGFSLEEPSSFAGRIHRMIKLGLSI  557



>ref|XP_011398501.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
 gb|KFM25605.1| Heat shock protein 90-2 [Auxenochlorella protothecoides]
Length=432

 Score =   122 bits (307),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D+S   YM  K+ LEIN  +P+I ELR R   D  
Sbjct  299  PCVLVTGEYGWSANMERIMKAQALRDSSMAGYMSSKKTLEINAANPVIAELRTRAEADKG  358

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++  QL+++TAL+ SGF++ DP  FASRI+  VK  L+I
Sbjct  359  DKTVRDLVQLLFETALLASGFSLDDPNTFASRIHRMVKLGLSI  401



>gb|AAG22091.1|AF306643_1 90 kDa heat-shock protein [Scyliorhinus torazame]
Length=138

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI+  LR++   
Sbjct  30   VSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVDTLRQKADV  89

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ++RIY  +K  L I
Sbjct  90   DKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI  135



>gb|AAO14563.2|AF461150_1 Hsp90 [Heterodera glycines]
Length=721

 Score =   125 bits (313),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 78/106 (74%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VT +YGWSANMERIM++Q L D+S   YM  K+ LEINP H IIK LR+RV K
Sbjct  579  VSSPCCIVTGEYGWSANMERIMRAQALRDSSTMGYMASKKNLEINPDHSIIKSLRDRVEK  638

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            + +D++ K+   L+Y+T+L+ SGF++ DP+  ASRIY  VK  L+I
Sbjct  639  EQDDKTAKDLVVLLYETSLLTSGFSLEDPQQHASRIYRMVKLGLDI  684



>gb|EKF32566.1| heat shock protein 85, putative, partial [Trypanosoma cruzi marinkellei]
Length=323

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PC++VTS++GWSA+ME+IM++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV  D
Sbjct  188  TSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEAD  247

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
              D++ K+   L++ TAL+ SGF + DP  +A RI+  +K  L++
Sbjct  248  ENDKAVKDLVYLLFDTALLTSGFTLDDPTSYAERIHRMIKLGLSL  292


 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 73/100 (73%), Gaps = 0/100 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PC++VTS++GWSA+ME+IM++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV  D
Sbjct  44   TSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEAD  103

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVK  341
              D++ K+   L++ TAL+ SGF + DP  +A RI+  +K
Sbjct  104  ENDKAVKDLVYLLFDTALLTSGFTLDDPTSYAERIHRMIK  143



>emb|CAA34748.1| heat shock-like protein [Mus musculus]
Length=274

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP H II+ LR++   
Sbjct  135  VTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEA  194

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  195  DKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI  240



>gb|AIU38245.1| heat shock protein 90 [Anisakis physeteris]
Length=720

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  578  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  637

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  638  DKNDKTVKDLVVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  683



>gb|ABF61871.1| chaperone [Agave tequilana]
Length=174

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGW+ANMERIM++Q L D +  AYM  K+ +EINP + I++ELR+R   D  
Sbjct  44   PCCLVTGEYGWTANMERIMKAQALRDNNMSAYMSSKKTMEINPDNGIMEELRKRAEADKN  103

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++TAL+ SGF++ DP  FA RI+  +K  LNI
Sbjct  104  DKSVKDLVMLLFETALLTSGFSLEDPNTFAGRIHRMLKLGLNI  146



>gb|AIU38246.1| heat shock protein 90 [Anisakis brevispiculata]
Length=721

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  579  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  638

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  639  DKNDKTVKDLVVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  684



>gb|ADM83426.1| heat shock protein 90 [Panonychus citri]
Length=730

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS+YGWSANMERIM++Q L D +   YM  K+ LEINP HPI++ LR+R+  
Sbjct  589  VTSPCCIVTSQYGWSANMERIMKAQALRDTTTMGYMAAKKHLEINPDHPIVENLRQRIEA  648

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP++ +SRIY  +K  L I
Sbjct  649  DKSDKAVKDLVMLLFETALLCSGFSLEDPQNHSSRIYRMIKLGLGI  694



>gb|AIU38242.1| heat shock protein 90 [Anisakis pegreffii]
Length=718

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  576  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  635

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  636  DKNDKTVKDLVVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  681



>gb|AIU38243.1| heat shock protein 90 [Anisakis typica]
Length=720

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  578  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  637

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  638  DKNDKTVKDLVVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  683



>gb|AIU38244.1| heat shock protein 90 [Anisakis paggiae]
Length=720

 Score =   124 bits (312),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H +IK LRERV  
Sbjct  578  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSVIKALRERVEA  637

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF + DP+  ASRIY  +K  L+I
Sbjct  638  DKNDKTVKDLVVLLFETALLSSGFTLDDPQLHASRIYRMIKLGLDI  683



>ref|XP_308799.3| AGAP006959-PA [Anopheles gambiae str. PEST]
 gb|EAA04769.4| AGAP006959-PA [Anopheles gambiae str. PEST]
Length=393

 Score =   122 bits (305),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM GK+ LEINP H II+ LR+R   D  
Sbjct  249  PCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIIETLRQRAEADKN  308

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++ +P   ASRIY  +K  L I
Sbjct  309  DKAVKDLVILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGI  351



>emb|CBY17856.1| unnamed protein product [Oikopleura dioica]
Length=213

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D S   YM  K+ LEINP H I+++LR++V  
Sbjct  75   VSSPCCIVTSQYGWSANMERIMKAQALKDTSTMGYMAAKKHLEINPDHVIVEQLRQKVEA  134

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+T+L+ SGF++ DP   A+RI+  +K  L  
Sbjct  135  DKNDKSVKDLVMLLYETSLLTSGFSLEDPGTHATRIHRMIKLGLGF  180



>dbj|BAN64175.1| hsp90 protein [Babesia bovis]
Length=205

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS++GWSANMERIM++Q L D+S  ++M  K+ +E+NP H I+KELR+R   D  
Sbjct  76   PCALVTSEFGWSANMERIMKAQALRDSSFGSFMISKKTMELNPHHSIMKELRQRAETDKS  135

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D++ K+   L+Y TA++ SGFN+ DP  F  RIY  +K  L++ 
Sbjct  136  DKTLKDLVWLLYDTAMLTSGFNLDDPTQFGGRIYRMIKLGLSLD  179



>gb|EWM29604.1| heat shock protein 90 [Nannochloropsis gaditana]
Length=713

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D+S  AYM  K+ +EINP+HPI+K LRE+   +  
Sbjct  577  PCVLVTGEYGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPKHPIVKALREKAEANQT  636

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y T+L+ SGF++ DP  FASRI+  +K  L+I
Sbjct  637  DKTLKDLTWLLYDTSLLTSGFSLDDPNTFASRIHRLIKLGLSI  679



>ref|XP_005855339.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
 gb|EKU21014.1| molecular chaperone HtpG [Nannochloropsis gaditana CCMP526]
Length=712

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D+S  AYM  K+ +EINP+HPI+K LRE+   +  
Sbjct  577  PCVLVTGEYGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPKHPIVKALREKAEANQT  636

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y T+L+ SGF++ DP  FASRI+  +K  L+I
Sbjct  637  DKTLKDLTWLLYDTSLLTSGFSLDDPNTFASRIHRLIKLGLSI  679



>gb|AEG78394.1| heat shock protein 90, partial [Epinephelus coioides]
Length=150

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI++ LR++   
Sbjct  8    VSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKADA  67

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ++RIY  +K  L I
Sbjct  68   DKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI  113



>ref|XP_002637777.1| C. briggsae CBR-DAF-21 protein [Caenorhabditis briggsae]
 sp|Q61W58.1|HSP90_CAEBR RecName: Full=Heat shock protein 90; AltName: Full=Abnormal dauer 
formation protein 21 [Caenorhabditis briggsae]
 emb|CAP25236.1| Protein CBR-DAF-21 [Caenorhabditis briggsae]
Length=706

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  567  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEA  626

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  627  DKNDKTVKDLVVLLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  673



>gb|ADZ13510.1| HSP90-1 [Ditylenchus destructor]
Length=719

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV K
Sbjct  578  VSSPCCIVTGEYGWTANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIMKTLRERVEK  637

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D +D++ K+   L+++TAL+ SGF++ +P+  ASRI+  +K  L+IS
Sbjct  638  DQDDKTAKDLVVLLFETALLTSGFSLEEPQSHASRIFRMIKLGLDIS  684



>gb|EGT39214.1| CBN-DAF-21 protein [Caenorhabditis brenneri]
Length=706

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  567  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEA  626

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  627  DKNDKTVKDLVVLLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  673



>ref|XP_003102316.1| CRE-DAF-21 protein [Caenorhabditis remanei]
 gb|EFP05935.1| CRE-DAF-21 protein [Caenorhabditis remanei]
Length=702

 Score =   124 bits (310),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  563  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVET  622

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  623  DKNDKTVKDLVVLLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  669



>gb|EKG06682.1| heat shock protein 85, putative, partial [Trypanosoma cruzi]
Length=343

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PC++VTS++GWSA+ME+IM++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV  D
Sbjct  208  TSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEAD  267

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
              D++ K+   L++ TAL+ SGF + DP  +A RI+  +K  L++
Sbjct  268  ENDKAVKDLVYLLFDTALLTSGFTLDDPTSYAERIHRMIKLGLSL  312



>gb|ACO58580.1| heat shock protein 90 [Apis mellifera]
Length=362

 Score =   121 bits (303),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGW+ANMERIM++Q L DAS   YM  K+ LEINP HPI++ LR++   D  
Sbjct  226  PCCIVTSQYGWTANMERIMKAQALRDASTMGYMAAKKHLEINPDHPIMENLRQKAEADKH  285

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++TAL+ SGF + DP+  ASRIY  +K  L  
Sbjct  286  DKSVKDLVMLLFETALLSSGFALEDPQVHASRIYRMIKLGLGF  328



>gb|AGW82181.1| heat shcok protein 90, partial [Corbicula fluminea]
Length=190

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H IIK L+E+V  
Sbjct  83   VNSPCCIVTSQYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHSIIKALKEKVSV  142

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+++TAL+ SGF + DP   A+RI   +K  L I
Sbjct  143  DKNDKSVKDLVLLMFETALLASGFALEDPTTHANRINRMIKLGLGI  188



>ref|XP_007515443.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14322.1| predicted protein [Bathycoccus prasinos]
Length=802

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC++VTSK+GWSANMERIM++Q + DA  Q YM+GK+ LEINP  P+IK+L+ RV   P+
Sbjct  686  PCILVTSKFGWSANMERIMKAQAMGDARAQDYMKGKKTLEINPFSPVIKQLKMRVESAPD  745

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
             E TKE  +L++ TAL+ SGF++  P +FA R++  +    N+
Sbjct  746  AEETKEMCKLLFDTALLTSGFSIDQPAEFAERVFKLMTQEANL  788



>ref|XP_010928210.1| PREDICTED: heat shock protein 90-2-like, partial [Elaeis guineensis]
Length=132

 Score =   115 bits (289),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ +EINP +PI++ELR+R   D  
Sbjct  1    PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRAEADKN  60

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++TAL+ SGF++ +P  F +RI+  +K  L+I
Sbjct  61   DKSVKDLVLLLFETALLTSGFSLDEPNTFGNRIHRMLKLGLSI  103



>ref|XP_952473.1| heat shock protein 90 [Theileria annulata strain Ankara]
 sp|Q4UDU8.1|HSP90_THEAN RecName: Full=Heat shock protein 90; Short=HSP90 [Theileria annulata]
 emb|CAI74741.1| heat shock protein 90, putative [Theileria annulata]
Length=722

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = -3

Query  655  ATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRE  476
             T +   PC +VTS++GWSANMERIM++Q L D+S  +YM  K+++EINPRH I+KEL+ 
Sbjct  585  GTRFTDSPCALVTSEFGWSANMERIMKAQALRDSSITSYMLSKKIMEINPRHSIMKELKA  644

Query  475  RVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            R   D  D++ K+   L+Y TAL+ SGFN+ +P  F +RIY  +K  L++
Sbjct  645  RAANDKTDKTVKDLVWLLYDTALLTSGFNLDEPTQFGNRIYRMIKLGLSL  694



>gb|EPY40503.1| heat shock protein 83-1 [Angomonas deanei]
Length=270

 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PC++VTS++GWSA+ME+IM++Q L D+S   YM  K+ +EINPRH IIKEL+ RV  D
Sbjct  135  TSPCILVTSEFGWSAHMEQIMRNQALRDSSMSTYMMSKKTMEINPRHSIIKELKRRVDND  194

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
              D++ K+   L++ T+L+ SGF + DP  +A RI++ +K  L++
Sbjct  195  ENDKAIKDLVYLLFDTSLLTSGFALEDPSSYAERIHHMIKLGLSL  239



>gb|AAA30132.1| heat shock protein 90 [Theileria parva]
 prf||2106315A heat shock protein 90kD
Length=721

 Score =   123 bits (309),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = -3

Query  655  ATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRE  476
             T +   PC +VTS++GWSANMERIM++Q L D+S  +YM  K+++EINPRH I+KEL+ 
Sbjct  584  GTRFTDSPCALVTSEFGWSANMERIMKAQALRDSSITSYMLSKKIMEINPRHSIMKELKT  643

Query  475  RVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            R   D  D++ K+   L+Y TAL+ SGFN+ +P  F +RIY  +K  L++
Sbjct  644  RAANDKTDKTVKDLVWLLYDTALLTSGFNLDEPTQFGNRIYRMIKLGLSL  693



>gb|AAQ63041.1| heat shock protein HSP 90 alpha, partial [Platichthys flesus]
Length=207

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI++ LR++   
Sbjct  67   VSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHPIVETLRQKAEA  126

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D+S K+   L+++TAL+ SGF + DP+  ++RIY  +K  L I 
Sbjct  127  DKNDKSVKDLVILLFETALLSSGFTLDDPQTHSNRIYRMIKLGLGID  173



>ref|XP_009690258.1| heat shock protein 90 [Theileria orientalis strain Shintoku]
 dbj|BAM39957.1| heat shock protein 90 [Theileria orientalis strain Shintoku]
Length=668

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS++GWSANMERIM++Q L D+S  +YM  K+++EINPRH I+KEL+ R   D  
Sbjct  540  PCALVTSEFGWSANMERIMKAQALRDSSITSYMLSKKIMEINPRHSIMKELKNRAATDKT  599

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y TAL+ SGFN+ +P  F +RIY  +K  L++
Sbjct  600  DKTVKDLVWLLYDTALLTSGFNLDEPTQFGNRIYRMIKLGLSL  642



>ref|XP_764810.1| heat shock protein 90 [Theileria parva strain Muguga]
 sp|P24724.2|HSP90_THEPA RecName: Full=Heat shock protein 90; Short=HSP90 [Theileria parva]
 gb|EAN32527.1| heat shock protein 90 [Theileria parva]
Length=721

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = -3

Query  655  ATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRE  476
             T +   PC +VTS++GWSANMERIM++Q L D+S  +YM  K+++EINPRH I+KEL+ 
Sbjct  584  GTRFTDSPCALVTSEFGWSANMERIMKAQALRDSSITSYMLSKKIMEINPRHSIMKELKT  643

Query  475  RVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            R   D  D++ K+   L+Y TAL+ SGFN+ +P  F +RIY  +K  L++
Sbjct  644  RAANDKTDKTVKDLVWLLYDTALLTSGFNLDEPTQFGNRIYRMIKLGLSL  693



>gb|AAB23704.1| HSP90, partial [Mus sp.]
Length=194

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI++ LR++   
Sbjct  55   VSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEA  114

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ++RIY  +K  L I
Sbjct  115  DKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGI  160



>gb|ACR57215.1| Hsp90 [Heterodera glycines]
Length=721

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +V  +YGWSANMERIM++Q L D+S   YM  K+ LEINP H IIK LR+RV K
Sbjct  579  VSSPCCIVAGEYGWSANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRDRVEK  638

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            + +D++ K+   L+Y+T+L+ SGF++ DP+  ASRIY  VK  L+I
Sbjct  639  EQDDKTAKDLVVLLYETSLLTSGFSLEDPQQHASRIYRMVKLGLDI  684



>gb|ESL09761.1| heat shock protein 85 [Trypanosoma rangeli SC58]
Length=367

 Score =   120 bits (301),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PC++VTS++GWSA+ME+IM++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV  D
Sbjct  231  TSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMSKKTMEINPTHPIVKELKRRVEAD  290

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
              D++ K+   L++ TAL+ SGF + DP  +A RI+  +K  L++
Sbjct  291  ENDKAVKDLVYLLFDTALLTSGFALDDPTSYADRIHRMIKLGLSL  335



>gb|ADC53691.1| heat shock protein 90-2 [Cryptocoryne ciliata]
Length=236

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ +EINP +PI++ELR+R   D  
Sbjct  104  PCCLVTGEYGWTANMERIMKAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKN  163

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++TAL+ SGF++ DP  F +RI+  +K  L+I
Sbjct  164  DKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI  206



>gb|AAN76524.1|AF384807_1 heat-shock protein 90 [Cryptococcus gattii]
Length=699

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  565  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKS  624

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  625  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  667



>ref|XP_003197339.1| cytoplasmic chaperone (Hsp90 family); Hsp82p [Cryptococcus gattii 
WM276]
 gb|ADV25552.1| Cytoplasmic chaperone (Hsp90 family), putative; Hsp82p [Cryptococcus 
gattii WM276]
 gb|KIR52818.1| hsp90-like protein [Cryptococcus gattii Ru294]
 gb|KIR78923.1| hsp90-like protein [Cryptococcus gattii EJB2]
 gb|KIY32889.1| hsp90-like protein [Cryptococcus gattii E566]
Length=699

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  565  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKS  624

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  625  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  667



>gb|AAN77149.1| fiber protein Fb9 [Gossypium barbadense]
Length=176

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGW+ANMERIM++Q L D S   YM  K+ +EINP +PI++ELR+R   D  
Sbjct  44   PCCLVTGEYGWTANMERIMKAQALRDNSMAGYMSSKKTMEINPDNPIMEELRKRADADKN  103

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D+S K+   L+++TAL+ SGF++ DP  F +RI+  +K  L+I 
Sbjct  104  DKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSID  147



>gb|KIR45891.1| hsp90-like protein [Cryptococcus gattii CA1280]
 gb|KIR59078.1| hsp90-like protein [Cryptococcus gattii CA1873]
Length=699

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  565  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKS  624

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  625  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  667



>gb|KIR84754.1| hsp90-like protein [Cryptococcus gattii IND107]
Length=698

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  564  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKS  623

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  624  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  666



>gb|EYD92886.1| hsp90 family protein, partial [Escherichia coli 1-176-05_S1_C1]
Length=294

 Score =   119 bits (297),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VTS+YGWSANMERIM++Q L D S  +YM  K+ +EINP +PI+ EL+ ++V D  
Sbjct  163  PCVLVTSEYGWSANMERIMKAQALRDTSMTSYMMSKKTMEINPYNPIMTELKNKIVNDKS  222

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y+T+L+ SGF++ DP  F+SRI   +K  L+I
Sbjct  223  DKTVKDLIWLLYETSLLTSGFSLEDPTQFSSRINRMIKLGLSI  265



>gb|AAK59281.1|AF378703_1 heat shock protein 90 alpha [Anas platyrhynchos]
Length=362

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP H II+ LR++   
Sbjct  223  VTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEA  282

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  283  DKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI  328



>gb|KGB79019.1| hsp90-like protein [Cryptococcus gattii R265]
 gb|KIR27901.1| hsp90-like protein [Cryptococcus gattii LA55]
 gb|KIR35468.1| hsp90-like protein [Cryptococcus gattii MMRL2647]
 gb|KIR38737.1| hsp90-like protein [Cryptococcus gattii Ram5]
 gb|KIR70922.1| hsp90-like protein [Cryptococcus gattii CA1014]
 gb|KIR90532.1| hsp90-like protein [Cryptococcus gattii CBS 10090]
 gb|KIR97264.1| hsp90-like protein [Cryptococcus gattii 2001/935-1]
 gb|KIY57748.1| hsp90-like protein [Cryptococcus gattii 99/473]
Length=699

 Score =   122 bits (307),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  565  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKS  624

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  625  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  667



>gb|ACZ13352.1| HSP90 protein [Bursaphelenchus xylophilus]
Length=448

 Score =   120 bits (301),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  310  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIMKALRERVEN  369

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D +D++ ++   L+++TAL+ SGF++ +P   A+RIY  +K  L+I
Sbjct  370  DQDDKTARDLVVLLFETALLTSGFSLEEPGSHANRIYRMIKLGLDI  415



>gb|KJE05047.1| hsp90-like protein [Cryptococcus gattii NT-10]
Length=699

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  565  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKSRVAEDKS  624

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  625  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  667



>ref|XP_002998541.1| heat shock protein 90 [Phytophthora infestans T30-4]
 gb|EEY69894.1| heat shock protein 90 [Phytophthora infestans T30-4]
Length=706

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  
Sbjct  573  PCVLVTGEYGWSANMERIMKAQALRDSSTSAYMSSKKTMEINPLHPIIKSLREKAEADKS  632

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  633  DKTVKDLIWLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>ref|XP_009534751.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
 gb|EGZ09890.1| hypothetical protein PHYSODRAFT_355817 [Phytophthora sojae]
Length=706

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  
Sbjct  573  PCVLVTGEYGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKS  632

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  633  DKTVKDLIWLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>gb|ETK95017.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETL48421.1| heat shock protein 90-2 [Phytophthora parasitica]
Length=706

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  
Sbjct  573  PCVLVTGEYGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKS  632

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  633  DKTVKDLIWLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>ref|XP_008915791.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETI55191.1| heat shock protein 90-2 [Phytophthora parasitica P1569]
 gb|ETM01491.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM54696.1| heat shock protein 90-2 [Phytophthora parasitica]
 gb|ETM98910.1| heat shock protein 90-2 [Phytophthora parasitica INRA-310]
 gb|ETO83922.1| heat shock protein 90-2 [Phytophthora parasitica P1976]
 gb|ETP24998.1| heat shock protein 90-2 [Phytophthora parasitica CJ01A1]
 gb|ETP52997.1| heat shock protein 90-2 [Phytophthora parasitica P10297]
Length=706

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D+S  AYM  K+ +EINP HPIIK LRE+   D  
Sbjct  573  PCVLVTGEYGWSANMERIMKAQALRDSSTSAYMTSKKTMEINPLHPIIKSLREKAEADKS  632

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y T+L+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  633  DKTVKDLIWLLYDTSLLTSGFSLDEPTTFANRIHRLIKLGLSI  675



>gb|ACU00686.1| heat shock protein 90 [Bursaphelenchus mucronatus]
Length=361

 Score =   119 bits (299),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  223  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIMKALRERVEA  282

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D +D++ ++   L+++TAL+ SGF++ +P   A+RI+  +K  L+I
Sbjct  283  DQDDKTARDLVVLLFETALLTSGFSLEEPGSHANRIFRMIKLGLDI  328



>gb|AFR98377.1| hsp90-like protein [Cryptococcus neoformans var. grubii H99]
Length=699

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  565  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKGRVAEDKS  624

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  625  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  667



>gb|AAN76525.1|AF384808_1 heat-shock protein 90 [Cryptococcus neoformans var. grubii]
Length=691

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPIIKEL+ RV +D  
Sbjct  562  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIKELKGRVAEDKS  621

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  622  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  664



>gb|ETN83529.1| putative heat shock protein 90 [Necator americanus]
Length=689

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  
Sbjct  553  PCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKN  612

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  613  DKTVKDLVILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  656



>ref|XP_010902983.1| PREDICTED: heat shock protein HSP 90-alpha 1 [Esox lucius]
Length=725

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 73/107 (68%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPII+ LRE+   
Sbjct  586  VSSPCCIVTSTYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPTHPIIETLREKAEA  645

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TALM SGF + DP+  A+RIY  +K  L I 
Sbjct  646  DKNDKAVKDLVILLFETALMSSGFTLDDPQTHANRIYRMIKLGLGID  692



>gb|KIH68348.1| Hsp90 protein [Ancylostoma duodenale]
Length=707

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  
Sbjct  571  PCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKN  630

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  631  DKTVKDLVILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  674



>gb|ADZ97023.1| heat shock protein 90 [Rana sauteri]
Length=136

 Score =   114 bits (286),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+AN ERIM++Q L D S   YM  K+ LEINP HPI++ LR++   
Sbjct  4    VSSPCCIVTSTYGWTANTERIMKAQALRDNSTMGYMMAKKHLEINPEHPIVETLRQKAEA  63

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ++RIY  +K  L I
Sbjct  64   DKNDKAVKDLVVLLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI  109



>gb|EYC13285.1| hypothetical protein Y032_0044g1081 [Ancylostoma ceylanicum]
Length=707

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  
Sbjct  571  PCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKN  630

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  631  DKTVKDLVILLFETALLSSGFSLEEPQSHASRIYRMIKLGLDIG  674



>ref|XP_008917763.1| PREDICTED: heat shock protein HSP 90-alpha [Manacus vitellinus]
Length=506

 Score =   120 bits (301),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP H II+ LR++   
Sbjct  367  VTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEA  426

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  427  DKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI  472



>gb|ACR57216.1| Hsp90 [Heterodera glycines]
Length=721

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +V  +YGWSANMERIM++Q L D+S   YM  K+ LEINP H IIK LR+RV K
Sbjct  579  VSSPCCIVAGEYGWSANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIIKSLRDRVEK  638

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            +  D++ K+   L+Y+T+L+ SGF++ DP+  ASRIY  VK  L+I
Sbjct  639  EQNDKTAKDLVVLLYETSLLTSGFSLEDPQQHASRIYRMVKLGLDI  684



>gb|AEG19531.1| heat shock protein 90 [Glaciozyma antarctica]
Length=707

 Score =   120 bits (301),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 76/103 (74%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM+ K+ LEINP + IIKELR +V +D  
Sbjct  574  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMQSKKTLEINPHNAIIKELRRKVQEDAA  633

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K    L+Y+TAL+ SGF +  P DFA+RI+N +   L+I
Sbjct  634  DKTVKSLIVLLYETALLTSGFTLDAPVDFANRIHNMISLGLSI  676


 Score = 30.8 bits (68),  Expect(2) = 9e-28, Method: Compositional matrix adjust.
 Identities = 17/37 (46%), Positives = 23/37 (62%), Gaps = 3/37 (8%)
 Frame = -2

Query  719  KDLTKWWKGALASDNVDEVKISNRLADTP--LCCGNI  615
            +DLT+  K  L  D V++V ISNR+AD+P  L  G  
Sbjct  547  EDLTRTMKDILG-DKVEKVSISNRIADSPCVLVTGQF  582



>gb|ABO93609.1| heat shock protein 90 [Bursaphelenchus xylophilus]
Length=364

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q   D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  226  VSSPCCIVTSEYGWSANMERIMKAQAFRDSSTMGYMASKKNLEINPDHSIMKALRERVEN  285

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D +D++ ++   L+++TAL+ SGF++ +P   A+RIY  +K  L+I
Sbjct  286  DQDDKTARDLVVLLFETALLTSGFSLEEPGSHANRIYRMIKLGLDI  331



>gb|ACU00668.1| heat shock protein 90 [Haemonchus contortus]
Length=707

 Score =   122 bits (306),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  D  
Sbjct  571  PCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRERVEVDKN  630

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D++ K+   L+++TAL+ SGF + +P+  ASRIY  +K  L+I 
Sbjct  631  DKTVKDLVILLFETALLSSGFTLEEPQSHASRIYRMIKLGLDIG  674



>gb|EXX78198.1| Hsp90 family chaperone HSC82 [Rhizophagus irregularis DAOM 197198w]
Length=359

 Score =   119 bits (298),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGW+AN ERIM++Q L D+S  +YM  K+++EINP HPI+K L+ +V  D  
Sbjct  226  PCVLVTGQYGWAANFERIMKAQALRDSSMASYMASKKIMEINPNHPIVKSLKSKVEADKN  285

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D++ K+   L+++T+L++SGF + +P  FA RI+  +K  L+I 
Sbjct  286  DKTVKDLTWLLFETSLLQSGFTLEEPSSFAGRIFKMIKLGLDIG  329



>emb|CAC29071.1| heat shock protein 90 [Pelophylax esculentus]
Length=260

 Score =   117 bits (294),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI++ LR++   
Sbjct  121  VSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPEHPIVETLRQKAEA  180

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ++RIY  +K  L I
Sbjct  181  DKNDKAVKDLVVLLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI  226



>gb|ADC53692.1| heat shock protein 90-1 [Cryptocoryne ciliata]
Length=254

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ +EINP +PI++ELR+R   D  
Sbjct  122  PCCLVTGEYGWTANMERIMRAQALRDSSMAGYMSSKKTMEINPENPIMEELRKRADADKN  181

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++TAL+ SGF++ DP  F +RI+  +K  L+I
Sbjct  182  DKSVKDLVLLLFETALLTSGFSLDDPNTFGNRIHRMLKLGLSI  224



>dbj|BAH71458.1| ACYPI002010 [Acyrthosiphon pisum]
Length=250

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGW+ANMERIM++Q L D+S   YM  K+ LEINP HPII+ LR++   D  
Sbjct  113  PCCIVTSQYGWTANMERIMKAQALRDSSTMGYMSAKKHLEINPDHPIIETLRQKAEADSN  172

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++T+L+ SGF + DP+  ASRI+  +K  L I
Sbjct  173  DKAVRDLVMLLFETSLLSSGFGLEDPQVHASRIHRMIKLGLGI  215



>gb|AFZ62631.1| HSP90-1 [Ditylenchus destructor]
Length=719

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 78/107 (73%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VT +YGW+ANMERIM++Q L D+S   YM  K+ LEINP H I+K LRERV  
Sbjct  578  VSSPCCIVTGEYGWTANMERIMKAQALRDSSTMGYMASKKNLEINPDHSIMKTLRERVEN  637

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D +D++ K+   L+++TAL+ SGF++ +P+  ASRI+  +K  L+IS
Sbjct  638  DQDDKTAKDLVVLLFETALLTSGFSLEEPQSHASRIFRMIKLGLDIS  684



>ref|NP_506626.1| Protein DAF-21 [Caenorhabditis elegans]
 sp|Q18688.1|HSP90_CAEEL RecName: Full=Heat shock protein 90; AltName: Full=Abnormal dauer 
formation protein 21 [Caenorhabditis elegans]
 emb|CAA99793.1| DAF-21 [Caenorhabditis elegans]
Length=702

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP H I+K LR+RV  
Sbjct  563  VSSPCCIVTSEYGWSANMERIMKAQALRDSSTMGYMAAKKHLEINPDHAIMKTLRDRVEV  622

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNIS  323
            D  D++ K+   L+++TAL+ SGF++ +P+  ASRIY  +K  L+I 
Sbjct  623  DKNDKTVKDLVVLLFETALLASGFSLEEPQSHASRIYRMIKLGLDIG  669



>ref|XP_002613491.1| hypothetical protein BRAFLDRAFT_119839 [Branchiostoma floridae]
 gb|EEN69500.1| hypothetical protein BRAFLDRAFT_119839 [Branchiostoma floridae]
Length=731

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/106 (52%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS+YGWSANMERIM++Q L D S   YM  K+ LEINP HPII  LRE+   
Sbjct  594  VSSPCCIVTSQYGWSANMERIMKAQALRDNSSLGYMAAKKHLEINPDHPIIDSLREKADA  653

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+T+LM SGF + DP+  A RIY  ++  L I
Sbjct  654  DKNDKSVKDLCMLLYETSLMASGFTLEDPQVHAGRIYRMIRLGLGI  699



>gb|AEV91217.1| cytosolic heat shock protein 90, partial [Microheliella maris]
Length=640

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWSANMERIM++Q L D++   YM  K+ +EINP H IIKEL+ER  KD  
Sbjct  506  PCVLVTGEFGWSANMERIMKAQALRDSAMSMYMVSKKTMEINPNHAIIKELKERADKDDS  565

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   LI+ TAL+ SGF++ DP  FA R++  +K  L+I
Sbjct  566  DKTVKDLVWLIFDTALLTSGFSLEDPAVFAGRLHRMIKLGLSI  608



>gb|EKG00457.1| heat shock protein 85, putative, partial [Trypanosoma cruzi]
Length=460

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = -3

Query  640  TPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKD  461
            T PC++VTS++GWSA+ME+IM++Q L D+S  AYM  K+ +EINP HPI+KEL+ RV  D
Sbjct  347  TSPCILVTSEFGWSAHMEQIMRNQALRDSSMSAYMMSKKTMEINPAHPIVKELKRRVEAD  406

Query  460  PEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
              D++ K+   L++ TAL+ SGF + DP  +A RI+  +K  L++
Sbjct  407  ENDKAVKDLVYLLFDTALLTSGFTLDDPTSYAERIHRMIKLGLSL  451



>emb|CDS02719.1| Putative Heat shock protein 90-1 [Absidia idahoensis var. thermophila]
Length=703

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -3

Query  658  LATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR  479
            ++ +  T PCV+ T ++GWSANMERIM++Q L D++  +YM  K+ LE+NP H IIK L+
Sbjct  561  ISDILTTSPCVLTTGQFGWSANMERIMKAQALRDSTMSSYMASKKTLELNPNHGIIKALK  620

Query  478  ERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            ++  +D  D + K+  QL+Y+TAL+ SGF++ DP +FA RIY  V   L+I
Sbjct  621  QKFSEDSSDRTVKDLTQLLYETALLTSGFSLDDPSNFAYRIYRMVSLGLSI  671



>gb|AAH07989.2| HSP90AA1 protein, partial [Homo sapiens]
Length=422

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP H II+ LR++   
Sbjct  283  VTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEA  342

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  343  DKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI  388



>ref|XP_008855466.1| heat shock protein 90, putative [Entamoeba nuttalli P19]
 gb|EKE42200.1| heat shock protein 90, putative [Entamoeba nuttalli P19]
Length=718

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VT +YGWSANMERIM++Q L D S   YM  K+ LEINP HPI++ELR+RV  
Sbjct  584  VNSPCALVTGEYGWSANMERIMKAQALRDNSMSTYMVSKKTLEINPDHPIVQELRKRVHT  643

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ +P  FA RIY  VK  L++
Sbjct  644  DNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGRIYRMVKLGLSL  689



>gb|AGT57167.1| heat shock protein 90-alpha 3 [Salmo salar]
Length=727

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   
Sbjct  588  VSSPCCIVTSNYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEA  647

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TALM SGF + DP+  A+RIY  +K  L I
Sbjct  648  DKNDKAVKDLVILLFETALMSSGFTLDDPQTHANRIYRMIKLGLGI  693



>emb|CDQ81678.1| unnamed protein product [Oncorhynchus mykiss]
Length=725

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM+SQ L D S   YM  K+ LEINP HPI++ LRE+   
Sbjct  586  VSSPCCIVTSTYGWTANMERIMKSQALRDNSTMGYMTAKKHLEINPTHPIVETLREKAEA  645

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TALM SGF + DP+  A+RIY  +K  L I
Sbjct  646  DKNDKAVKDLVILLFETALMSSGFTLDDPQTHANRIYRMIKLGLGI  691



>ref|XP_653162.1| heat shock protein 90 [Entamoeba histolytica HM-1:IMSS]
 gb|EAL47778.1| heat shock protein 90, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EMS13969.1| heat shock protein 90, putative [Entamoeba histolytica HM-3:IMSS]
 gb|ENY63588.1| heat shock protein 90, putative [Entamoeba histolytica HM-1:IMSS-A]
Length=718

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VT +YGWSANMERIM++Q L D S   YM  K+ LEINP HPI++ELR+RV  
Sbjct  584  VNSPCALVTGEYGWSANMERIMKAQALRDNSMSTYMVSKKTLEINPDHPIVQELRKRVHT  643

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ +P  FA RIY  VK  L++
Sbjct  644  DNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGRIYRMVKLGLSL  689



>gb|AAN39696.1| heat shock protein [Choristoneura parallela]
Length=171

 Score =   115 bits (287),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 71/103 (69%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT++YGWSANMERIM++Q L D S   YM  K+ LEINP H I++ LR++   D  
Sbjct  36   PCCIVTAQYGWSANMERIMKAQALRDTSTMGYMAAKKHLEINPDHSIVETLRQKADADKN  95

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y+TAL+ SGF + +P+  ASRIY  +K  L I
Sbjct  96   DKAVKDLVILLYETALLSSGFALDEPQVHASRIYRMIKLGLGI  138



>emb|CDH60666.1| heat shock protein 90 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=688

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/111 (47%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -3

Query  658  LATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR  479
            ++ +  T PCV+ T ++GWSANMERIM++Q L D++  +YM  K+ LE+NP H IIK L+
Sbjct  545  ISDILTTSPCVLTTGQFGWSANMERIMKAQALRDSTMSSYMASKKTLELNPNHGIIKALK  604

Query  478  ERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            ++  +D  D + K+  QL+Y+TAL+ SGF++ DP +FA RIY  V   L+I
Sbjct  605  QKFSEDSSDRTVKDLTQLLYETALLTSGFSLDDPSNFAYRIYRMVALGLSI  655



>dbj|BAD83620.1| cytosolic-type hsp90 [Entamoeba histolytica]
Length=708

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VT +YGWSANMERIM++Q L D S   YM  K+ LEINP HPI++ELR+RV  
Sbjct  573  VNSPCALVTGEYGWSANMERIMKAQALRDNSMSTYMVSKKTLEINPDHPIVQELRKRVHT  632

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ +P  FA RIY  VK  L++
Sbjct  633  DNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGRIYRMVKLGLSL  678



>ref|XP_653132.1| heat shock protein 90 [Entamoeba histolytica HM-1:IMSS]
 gb|EAL47746.1| heat shock protein 90, putative [Entamoeba histolytica HM-1:IMSS]
 gb|EMD44554.1| heat shock protein, putative [Entamoeba histolytica KU27]
 gb|EMH77453.1| heat shock protein 90, putative [Entamoeba histolytica HM-1:IMSS-B]
Length=718

 Score =   121 bits (304),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VT +YGWSANMERIM++Q L D S   YM  K+ LEINP HPI++ELR+RV  
Sbjct  584  VNSPCALVTGEYGWSANMERIMKAQALRDNSMSTYMVSKKTLEINPDHPIVQELRKRVHT  643

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ +P  FA RIY  VK  L++
Sbjct  644  DNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGRIYRMVKLGLSL  689



>ref|XP_004254906.1| heat shock protein 81-1, putative [Entamoeba invadens IP1]
 gb|ELP88135.1| heat shock protein 81-1, putative [Entamoeba invadens IP1]
Length=778

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = -3

Query  658  LATVWLTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELR  479
            ++T  +  PC +VT +YGWSANMERIM++Q L D S   YM  K+ LE+NP HPI++EL+
Sbjct  636  ISTRLVNSPCALVTGEYGWSANMERIMKAQALRDNSMSTYMVSKKTLELNPDHPIVEELK  695

Query  478  ERVVKDPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            +RV  D  D++ K+   L+++TAL+ SGF++ DP  FA RIY  VK  L++
Sbjct  696  KRVHTDNSDKTVKDLVVLLFETALLSSGFSLDDPAAFAGRIYRMVKLGLSL  746



>gb|AIA62362.1| hsp90, partial [Bactrocera minax]
Length=455

 Score =   119 bits (299),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D  
Sbjct  319  PCCIVTSQFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKADADKN  378

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  379  DKAVKDLCILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  421



>emb|CBJ23502.1| heat shock protein 90, partial [Dicentrarchus labrax]
Length=243

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 74/106 (70%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            ++ PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP HPI++ LR++   
Sbjct  101  VSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKADA  160

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ DP+  ++RIY  +K  L I
Sbjct  161  DKNDKAVKDLVILLFETALLSSGFSLDDPQTHSNRIYRMIKLGLGI  206



>ref|XP_003971591.1| PREDICTED: heat shock protein HSP 90-alpha 1-like [Takifugu rubripes]
Length=724

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VTS YGW+ANMERIM+SQ L D +   YM  K+ LEINP HPII+ LRE+   
Sbjct  585  VASPCCIVTSTYGWTANMERIMKSQALRDTATMGYMTAKKHLEINPLHPIIETLREKAEA  644

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+Y+TAL+ SGF + DP+  A+RIY  +K  L I
Sbjct  645  DKNDKAVKDLVILLYETALLSSGFTLEDPQTHANRIYRMIKLGLGI  690



>ref|XP_001735351.1| heat shock protein 81-1 [Entamoeba dispar SAW760]
 gb|EDR28463.1| heat shock protein 81-1, putative [Entamoeba dispar SAW760]
Length=744

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 75/106 (71%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +  PC +VT +YGWSANMERIM++Q L D S   YM  K+ LEINP HPI++ELR+RV  
Sbjct  610  VNSPCALVTGEYGWSANMERIMKAQALRDNSMSTYMVSKKTLEINPDHPIVQELRKRVHT  669

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D++ K+   L+++TAL+ SGF++ +P  FA RIY  VK  L++
Sbjct  670  DNSDKTVKDLVVLLFETALLSSGFSLDEPAAFAGRIYRMVKLGLSL  715



>gb|AER28024.1| heat shock protein 83S1 [Stratiomys singularior]
Length=719

 Score =   121 bits (304),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM  K+ LEINP HPII+ LR++   D  
Sbjct  582  PCCIVTSQYGWSANMERIMKAQALRDSSTMGYMTSKKHLEINPDHPIIENLRQKTEADKN  641

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++T+L+ SGF++ DP+  ASRIY  +K  L I
Sbjct  642  DKSVKDLVILLFETSLLSSGFSLDDPQVHASRIYRMIKLGLGI  684



>ref|XP_568451.1| chaperone [Cryptococcus neoformans var. neoformans JEC21]
 ref|XP_772092.1| hypothetical protein CNBM1380 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|EAL17445.1| hypothetical protein CNBM1380 [Cryptococcus neoformans var. neoformans 
B-3501A]
 gb|AAW46934.1| chaperone, putative [Cryptococcus neoformans var. neoformans 
JEC21]
Length=700

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT ++GWS+NMERIM++Q L D+S  +YM  K+ +E+NP HPII+EL+ RV +D  
Sbjct  565  PCVLVTGQFGWSSNMERIMKAQALRDSSMSSYMASKKTMELNPSHPIIRELKGRVAEDKS  624

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ ++   L+++TAL+ SGF + +P+DFASRI   +   L+I
Sbjct  625  DKTVRDLTYLLFETALLTSGFTLSNPQDFASRINRMIALGLSI  667



>ref|XP_001649751.1| AAEL014845-PA [Aedes aegypti]
 gb|EAT32918.1| AAEL014845-PA [Aedes aegypti]
Length=560

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM GK+ +EINP H II+ LR+R   D  
Sbjct  422  PCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHMEINPDHSIIETLRQRAEADKN  481

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++ +P   ASRIY  VK  L I
Sbjct  482  DKAVKDLVILLFETALLSSGFSLDEPGVHASRIYRMVKLGLGI  524



>dbj|BAN65820.1| hsp90 protein [Babesia bovis]
Length=449

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS++GWSANMERIM++Q L D+S  ++M  K+ +E+NP H I+KELR+R   D  
Sbjct  320  PCALVTSEFGWSANMERIMKAQALRDSSFGSFMISKKTMELNPHHSIMKELRQRAETDKS  379

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+Y TA++ SGFN+ DP  F  RIY  +K  L++
Sbjct  380  DKTLKDLVWLLYDTAMLTSGFNLDDPTQFGGRIYRMIKLGLSL  422



>gb|ADO30471.1| heat shock protein 90 [Bactrocera dorsalis]
Length=516

 Score =   119 bits (299),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D  
Sbjct  380  PCCIVTSQFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKN  439

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  440  DKAVKDLCILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  482



>pdb|3Q6M|A Chain A, Crystal Structure Of Human Mc-hsp90 In C2221 Space Group
 pdb|3Q6M|B Chain B, Crystal Structure Of Human Mc-hsp90 In C2221 Space Group
 pdb|3Q6M|C Chain C, Crystal Structure Of Human Mc-hsp90 In C2221 Space Group
 pdb|3Q6N|A Chain A, Crystal Structure Of Human Mc-hsp90 In P21 Space Group
 pdb|3Q6N|B Chain B, Crystal Structure Of Human Mc-hsp90 In P21 Space Group
 pdb|3Q6N|C Chain C, Crystal Structure Of Human Mc-hsp90 In P21 Space Group
 pdb|3Q6N|D Chain D, Crystal Structure Of Human Mc-hsp90 In P21 Space Group
 pdb|3Q6N|E Chain E, Crystal Structure Of Human Mc-hsp90 In P21 Space Group
 pdb|3Q6N|F Chain F, Crystal Structure Of Human Mc-hsp90 In P21 Space Group
Length=448

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP H II+ LR++   
Sbjct  303  VTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEA  362

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  363  DKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI  408



>gb|AAD52684.1|AF179480_1 90kDa heat-shock protein [Toxoplasma gondii]
Length=137

 Score =   113 bits (283),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VTS+YGWSANMERIM++Q L D S   YM  K+ +EINP +PI++EL+++   D  
Sbjct  18   PCVLVTSEYGWSANMERIMKAQALRDNSMTTYMVSKKTMEINPTNPIMEELKKKSNADKS  77

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L++ TAL+ SGF++ +P  FA+RI+  +K  L+I
Sbjct  78   DKTVKDLIWLLFDTALLTSGFSLDEPTQFAARIHRMIKLGLSI  120



>gb|KFB48797.1| hypothetical protein ZHAS_00016808 [Anopheles sinensis]
Length=573

 Score =   120 bits (300),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS+YGWSANMERIM++Q L D+S   YM GK+ LEINP H I++ LR+R   D  
Sbjct  430  PCCIVTSQYGWSANMERIMKAQALRDSSAMGYMAGKKHLEINPDHAIVETLRQRADADKN  489

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++ +P   ASRIY  +K  L I
Sbjct  490  DKAVKDLVILLFETALLSSGFSLDEPGTHASRIYRMIKLGLGI  532



>gb|AFK31312.1| heat shock protein 90 [Dunaliella salina]
Length=696

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PCV+VT +YGWSANMERIM++Q L D S  AYM  K+ LEINP +PI+ EL++R   D  
Sbjct  564  PCVLVTGEYGWSANMERIMKAQALRDNSMAAYMTSKKTLEINPNNPIMGELKKRSDADKS  623

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+ A L+++TAL+ SGF++ DP  FA RI+  +K  L+I
Sbjct  624  DKTVKDLAMLLFETALLSSGFSLEDPNTFAGRIHRMIKLGLSI  666



>emb|CAK22426.1| heat shock protein 83 [Beta vulgaris]
Length=350

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VT +YGWSANMERIM++Q L D+S  AYM  K+ +EINP + I++ELR+R   D  
Sbjct  220  PCCLVTGEYGWSANMERIMKAQALRDSSMGAYMSSKKTMEINPDNGIMEELRKRAEADKN  279

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D+S K+   L+++TAL+ SGF++ DP  FA+RI+  +K  L+I
Sbjct  280  DKSVKDLVMLLFETALLTSGFSLEDPNTFAARIHRMLKLGLSI  322



>emb|CAY56585.1| putative heat shock protein 83 [Bactrocera oleae]
Length=666

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 74/103 (72%), Gaps = 0/103 (0%)
 Frame = -3

Query  634  PCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVKDPE  455
            PC +VTS++GWSANMERIM++Q L D S   YM GK+ LEINP HPII+ LR++   D +
Sbjct  538  PCCIVTSQFGWSANMERIMKAQALRDTSTMGYMAGKKHLEINPEHPIIETLRQKAEADKD  597

Query  454  DESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D++ K+   L+++TAL+ SGF++  P+  ASRIY  +K  L I
Sbjct  598  DKAVKDLCILLFETALLSSGFSLDSPQVHASRIYRMIKLGLGI  640



>gb|EDL18665.1| mCG14932, isoform CRA_a [Mus musculus]
Length=449

 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = -3

Query  643  LTPPCVVVTSKYGWSANMERIMQSQTLSDASKQAYMRGKRVLEINPRHPIIKELRERVVK  464
            +T PC +VTS YGW+ANMERIM++Q L D S   YM  K+ LEINP H II+ LR++   
Sbjct  310  VTSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMAAKKHLEINPDHSIIETLRQKAEA  369

Query  463  DPEDESTKETAQLIYKTALMESGFNVPDPKDFASRIYNSVKSSLNI  326
            D  D+S K+   L+Y+TAL+ SGF++ DP+  A+RIY  +K  L I
Sbjct  370  DKNDKSVKDLVILLYETALLSSGFSLEDPQTHANRIYRMIKLGLGI  415



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1441039810680